Psyllid ID: psy11108

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100------
MNGQYAVIASRHSFVLCPYVAGQASFLSGVSQKKERFYHVEQALVNCQDYAGLQLIKSLRALPDDIMKHAYIAQHQGRFQTAENYQLQADRRTWKSKPSYWTRFNS
cccccHHHHcccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHcccccHHHHHHHHHccccHHHHHHHHHHHHHcHHHHHHHHHHccHHHHHHcccccccccc
ccccEEEEEEcccEEEcccccHHHHHHHHHHHHHccHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHcHccccccHHHccc
MNGQYAVIASRHSfvlcpyvagqasflsgvsqkKERFYHVEQALVNCQDYAGLQLIKSLRALPDDIMKHAYIAQHQGRFQTAENYQLQadrrtwkskpsywtrfns
MNGQYAVIASRHSFVLCPYVAGQASFLSGVSQKKERFYHVEQALVNCQDYAGLQLIKSLRALPDDIMKHAYIAQHQGRFQTAENyqlqadrrtwkskpsywtrfns
MNGQYAVIASRHSFVLCPYVAGQASFLSGVSQKKERFYHVEQALVNCQDYAGLQLIKSLRALPDDIMKHAYIAQHQGRFQTAENYQLQADRRTWKSKPSYWTRFNS
****YAVIASRHSFVLCPYVAGQASFLSGVSQKKERFYHVEQALVNCQDYAGLQLIKSLRALPDDIMKHAYIAQHQGRFQTAENYQLQA****W************
*********SRHSFVLCPYVAGQASFLSGVSQKKERFYHVEQALVNCQDYAGLQLIKSLRAL***IMKHAYIAQHQGRFQTAENYQLQADRRTWKSKPSYWTRFN*
MNGQYAVIASRHSFVLCPYVAGQASFLSGVSQKKERFYHVEQALVNCQDYAGLQLIKSLRALPDDIMKHAYIAQHQGRFQTAENYQLQADRRTWKSKP********
**GQYAVIASRHSFVLCPYVAGQASFLSGVSQKKERFYHVEQALVNCQDYAGLQLIKSLRALPDDIMKHAYIAQHQGRFQTAENYQLQADRRTWKSKPSYW*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooo
SSSSSSSSSSSSSSiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNGQYAVIASRHSFVLCPYVAGQASFLSGVSQKKERFYHVEQALVNCQDYAGLQLIKSLRALPDDIMKHAYIAQHQGRFQTAENYQLQADRRTWKSKPSYWTRFNS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query106 2.2.26 [Sep-21-2011]
Q9P2L0 1181 WD repeat-containing prot yes N/A 0.632 0.056 0.388 5e-07
A6N6J5 1170 WD repeat-containing prot no N/A 0.632 0.057 0.373 3e-06
Q8BND3 1181 WD repeat-containing prot yes N/A 0.632 0.056 0.358 3e-05
>sp|Q9P2L0|WDR35_HUMAN WD repeat-containing protein 35 OS=Homo sapiens GN=WDR35 PE=1 SV=3 Back     alignment and function desciption
 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 38/67 (56%)

Query: 26  FLSGVSQKKERFYHVEQALVNCQDYAGLQLIKSLRALPDDIMKHAYIAQHQGRFQTAENY 85
            L+  + +K   Y  EQA V C+DY G++ +K L  L  + MK A +  + GRF+ AE  
Sbjct: 701 LLAEAALQKLDLYTAEQAFVRCKDYQGIKFVKRLGKLLSESMKQAEVVGYFGRFEEAERT 760

Query: 86  QLQADRR 92
            L+ DRR
Sbjct: 761 YLEMDRR 767
May promote CASP3 activation and TNF-stimulated apoptosis. Required for ciliogenesis.
Homo sapiens (taxid: 9606)
>sp|A6N6J5|WDR35_RAT WD repeat-containing protein 35 OS=Rattus norvegicus GN=Wdr35 PE=1 SV=1 Back     alignment and function description
>sp|Q8BND3|WDR35_MOUSE WD repeat-containing protein 35 OS=Mus musculus GN=Wdr35 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query106
332812692 1181 PREDICTED: WD repeat-containing protein 0.632 0.056 0.402 2e-06
332812690 1170 PREDICTED: WD repeat-containing protein 0.632 0.057 0.402 2e-06
395828621 1169 PREDICTED: WD repeat-containing protein 0.632 0.057 0.402 7e-06
50949484 406 hypothetical protein [Homo sapiens] 0.632 0.165 0.388 1e-05
332253801 1170 PREDICTED: WD repeat-containing protein 0.632 0.057 0.388 2e-05
332253803 1181 PREDICTED: WD repeat-containing protein 0.632 0.056 0.388 2e-05
56243599 1170 WD repeat-containing protein 35 isoform 0.632 0.057 0.388 2e-05
426334829 1170 PREDICTED: WD repeat-containing protein 0.632 0.057 0.388 2e-05
397513507 1181 PREDICTED: WD repeat-containing protein 0.632 0.056 0.388 2e-05
193783815 1170 unnamed protein product [Homo sapiens] 0.632 0.057 0.388 2e-05
>gi|332812692|ref|XP_515315.3| PREDICTED: WD repeat-containing protein 35 isoform 2 [Pan troglodytes] Back     alignment and taxonomy information
 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 39/67 (58%)

Query: 26  FLSGVSQKKERFYHVEQALVNCQDYAGLQLIKSLRALPDDIMKHAYIAQHQGRFQTAENY 85
            L+G + +K   Y  EQA V C+DY G++ +K L  L  + MK A +  + GRF+ AE  
Sbjct: 701 LLAGAALQKLDLYTAEQAFVRCKDYQGIKFVKRLGKLLSESMKQAEVVGYFGRFEEAERT 760

Query: 86  QLQADRR 92
            L+ DRR
Sbjct: 761 YLEMDRR 767

Source: Pan troglodytes

Species: Pan troglodytes

Genus: Pan

Family: Hominidae

Order: Primates

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota
>gi|332812690|ref|XP_003308950.1| PREDICTED: WD repeat-containing protein 35 isoform 1 [Pan troglodytes] gi|410294186|gb|JAA25693.1| WD repeat domain 35 [Pan troglodytes] Back     alignment and taxonomy information
>gi|395828621|ref|XP_003787468.1| PREDICTED: WD repeat-containing protein 35 [Otolemur garnettii] Back     alignment and taxonomy information
>gi|50949484|emb|CAH10636.1| hypothetical protein [Homo sapiens] Back     alignment and taxonomy information
>gi|332253801|ref|XP_003276020.1| PREDICTED: WD repeat-containing protein 35 isoform 1 [Nomascus leucogenys] Back     alignment and taxonomy information
>gi|332253803|ref|XP_003276021.1| PREDICTED: WD repeat-containing protein 35 isoform 2 [Nomascus leucogenys] Back     alignment and taxonomy information
>gi|56243599|ref|NP_065830.2| WD repeat-containing protein 35 isoform 2 [Homo sapiens] gi|62630191|gb|AAX88936.1| unknown [Homo sapiens] gi|119621246|gb|EAX00841.1| WD repeat domain 35, isoform CRA_d [Homo sapiens] Back     alignment and taxonomy information
>gi|426334829|ref|XP_004028939.1| PREDICTED: WD repeat-containing protein 35 isoform 1 [Gorilla gorilla gorilla] Back     alignment and taxonomy information
>gi|397513507|ref|XP_003827054.1| PREDICTED: WD repeat-containing protein 35 isoform 2 [Pan paniscus] Back     alignment and taxonomy information
>gi|193783815|dbj|BAG53797.1| unnamed protein product [Homo sapiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query106
UNIPROTKB|F1SCU2 1186 WDR35 "Uncharacterized protein 0.490 0.043 0.461 2.6e-07
UNIPROTKB|Q9P2L0 1181 WDR35 "WD repeat-containing pr 0.622 0.055 0.393 4.1e-07
RGD|1564116 1170 Wdr35 "WD repeat domain 35" [R 0.622 0.056 0.378 5.1e-07
UNIPROTKB|E1BWD7 1180 WDR35 "Uncharacterized protein 0.490 0.044 0.461 8.3e-07
MGI|MGI:1921932 1181 Wdr35 "WD repeat domain 35" [M 0.622 0.055 0.363 1.7e-06
ZFIN|ZDB-GENE-060810-148 1203 wdr35 "WD repeat domain 35" [D 0.490 0.043 0.442 9.2e-06
FB|FBgn0035264 1205 Oseg4 "Oseg4" [Drosophila mela 0.566 0.049 0.383 3.1e-05
WB|WBGene00016935 1199 ifta-1 [Caenorhabditis elegans 0.641 0.056 0.352 4.9e-05
UNIPROTKB|F1SCU2 WDR35 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 120 (47.3 bits), Expect = 2.6e-07, Sum P(2) = 2.6e-07
 Identities = 24/52 (46%), Positives = 32/52 (61%)

Query:    41 EQALVNCQDYAGLQLIKSLRALPDDIMKHAYIAQHQGRFQTAENYQLQADRR 92
             EQA V C+DY G++ +K L  L  + MK A +A + GRF+ AE   L  DRR
Sbjct:   721 EQAFVRCKDYQGIKFVKCLGNLQSESMKQAEVAAYFGRFEEAERMYLNMDRR 772
GO:0042384 "cilium assembly" evidence=IEA
GO:0035085 "cilium axoneme" evidence=IEA
GO:0005932 "microtubule basal body" evidence=IEA
GO:0005813 "centrosome" evidence=IEA
UNIPROTKB|Q9P2L0 WDR35 "WD repeat-containing protein 35" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1564116 Wdr35 "WD repeat domain 35" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BWD7 WDR35 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1921932 Wdr35 "WD repeat domain 35" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060810-148 wdr35 "WD repeat domain 35" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0035264 Oseg4 "Oseg4" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00016935 ifta-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 106
KOG2041|consensus 1189 99.92
KOG1538|consensus 1081 99.68
KOG1524|consensus737 99.65
KOG3616|consensus 1636 98.85
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 98.62
KOG0292|consensus 1202 97.76
KOG3617|consensus 1416 97.43
KOG0276|consensus794 96.99
KOG2247|consensus 615 96.9
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 94.64
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 94.05
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 93.4
TIGR02552135 LcrH_SycD type III secretion low calcium response 93.06
PRK10747398 putative protoheme IX biogenesis protein; Provisio 91.06
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 90.84
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 90.42
PRK15359144 type III secretion system chaperone protein SscB; 90.3
PRK10370198 formate-dependent nitrite reductase complex subuni 89.94
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 89.77
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 89.37
cd00189100 TPR Tetratricopeptide repeat domain; typically con 88.63
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 88.37
TIGR02521 234 type_IV_pilW type IV pilus biogenesis/stability pr 88.22
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 88.03
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 87.69
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 86.97
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 86.39
PF11349129 DUF3151: Protein of unknown function (DUF3151); In 86.35
PLN03077 857 Protein ECB2; Provisional 86.07
PRK11189 296 lipoprotein NlpI; Provisional 86.04
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 85.96
PRK10153517 DNA-binding transcriptional activator CadC; Provis 85.72
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 85.69
KOG3616|consensus 1636 85.67
PRK12370 553 invasion protein regulator; Provisional 84.9
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 84.8
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 84.14
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 84.05
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 83.9
PF1337173 TPR_9: Tetratricopeptide repeat 83.66
cd00189100 TPR Tetratricopeptide repeat domain; typically con 83.59
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 81.92
PRK11788 389 tetratricopeptide repeat protein; Provisional 81.26
PF1342844 TPR_14: Tetratricopeptide repeat 80.78
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 80.76
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 80.67
CHL00033168 ycf3 photosystem I assembly protein Ycf3 80.23
>KOG2041|consensus Back     alignment and domain information 
Probab=99.92  E-value=3e-26  Score=196.65  Aligned_cols=97  Identities=29%  Similarity=0.404  Sum_probs=95.0

Q ss_pred             HhhhhhhhcCCCCHHHHHHHHHHHHhcccHHHHHHHHHHcCCchhhHHHHHhhCCCcHHHHHHHHHHHcCCHHHHHHHHH
Q psy11108          8 IASRHSFVLCPYVAGQASFLSGVSQKKERFYHVEQALVNCQDYAGLQLIKSLRALPDDIMKHAYIAQHQGRFQTAENYQL   87 (106)
Q Consensus         8 ~~~~~~f~~~~~~~~lW~~LA~~AL~~~~l~iAe~Af~rl~d~~~v~~I~~l~~~~~~~~~~Aei~ay~Gkf~EAe~i~l   87 (106)
                      |-+|..|++++|||.||++||+.||.+++|++||.||+||+||.+|.|+++|+.+.++++++|||.+|.|+|+|||++|+
T Consensus       679 ledA~qfiEdnPHprLWrllAe~Al~Kl~l~tAE~AFVrc~dY~Gik~vkrl~~i~s~~~q~aei~~~~g~feeaek~yl  758 (1189)
T KOG2041|consen  679 LEDAIQFIEDNPHPRLWRLLAEYALFKLALDTAEHAFVRCGDYAGIKLVKRLRTIHSKEQQRAEISAFYGEFEEAEKLYL  758 (1189)
T ss_pred             hHHHHHHHhcCCchHHHHHHHHHHHHHHhhhhHhhhhhhhccccchhHHHHhhhhhhHHHHhHhHhhhhcchhHhhhhhh
Confidence            67899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HcCCccccccCC----Ccccc
Q psy11108         88 QADRRTWKSKPS----YWTRF  104 (106)
Q Consensus        88 ~ag~~~~Aiemr----~W~r~  104 (106)
                      .++|.|+||+||    +|+||
T Consensus       759 d~drrDLAielr~klgDwfrV  779 (1189)
T KOG2041|consen  759 DADRRDLAIELRKKLGDWFRV  779 (1189)
T ss_pred             ccchhhhhHHHHHhhhhHHHH
Confidence            999999999987    89997

>KOG1538|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF11349 DUF3151: Protein of unknown function (DUF3151); InterPro: IPR014487 This group represents an uncharacterised conserved protein Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query106
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.41
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 99.25
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 98.15
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.55
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.08
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.54
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 95.36
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 95.27
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 95.04
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 94.29
2kat_A115 Uncharacterized protein; NESG, structure, structur 94.17
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 94.08
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 94.06
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 93.91
3q49_B137 STIP1 homology and U box-containing protein 1; E3 93.8
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 93.75
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 93.69
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 93.61
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 93.52
3q49_B137 STIP1 homology and U box-containing protein 1; E3 93.5
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 93.32
2l6j_A111 TPR repeat-containing protein associated with HSP; 93.2
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 93.0
3k9i_A117 BH0479 protein; putative protein binding protein, 92.8
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 92.73
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 92.66
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 92.57
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 92.57
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 92.54
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 92.51
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 92.46
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 92.28
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 92.25
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 92.23
3vtx_A 184 MAMA; tetratricopeptide repeats (TPR) containing p 92.23
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 92.21
3mkr_A 291 Coatomer subunit epsilon; tetratricopeptide repeat 92.17
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 91.97
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 91.92
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 91.88
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 91.74
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 91.68
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 91.61
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 91.45
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 91.3
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 91.24
2vq2_A 225 PILW, putative fimbrial biogenesis and twitching m 91.18
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 91.08
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 91.01
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 90.96
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 90.88
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 90.83
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 90.75
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 90.75
2pl2_A 217 Hypothetical conserved protein TTC0263; TPR, prote 90.68
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 90.56
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 90.5
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 90.44
2ho1_A 252 Type 4 fimbrial biogenesis protein PILF; type IV p 90.35
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 90.32
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 90.2
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 90.14
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 90.14
2q7f_A 243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 90.04
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 89.9
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 89.87
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 89.86
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 89.84
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 89.77
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 89.68
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 89.58
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 89.45
4eqf_A365 PEX5-related protein; accessory protein, tetratric 89.12
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 88.97
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 88.96
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 88.94
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 88.9
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 88.87
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 88.85
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 88.74
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 88.73
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 88.71
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 88.52
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 88.44
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 88.33
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 88.27
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 88.14
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 87.86
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 87.53
2gw1_A 514 Mitochondrial precursor proteins import receptor; 87.14
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 86.96
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 86.66
4i17_A 228 Hypothetical protein; TPR repeats protein, structu 86.53
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 86.38
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 86.34
3u4t_A 272 TPR repeat-containing protein; structural genomics 86.34
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 86.26
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 86.18
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 86.07
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 86.06
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 86.02
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 85.63
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 85.58
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 85.32
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 85.17
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 85.15
3u4t_A 272 TPR repeat-containing protein; structural genomics 85.1
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 85.01
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 85.0
4i17_A 228 Hypothetical protein; TPR repeats protein, structu 84.98
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 84.83
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 84.78
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 84.09
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 83.51
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 82.94
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 82.36
2gw1_A514 Mitochondrial precursor proteins import receptor; 82.17
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 81.97
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 81.85
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 81.77
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 81.62
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 81.55
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 81.37
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 80.89
2ond_A 308 Cleavage stimulation factor 77 kDa subunit; HAT do 80.68
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 80.5
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 80.48
3qww_A433 SET and MYND domain-containing protein 2; methyltr 80.31
3qky_A 261 Outer membrane assembly lipoprotein YFIO; membrane 80.3
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
Probab=99.41  E-value=4.1e-13  Score=108.80  Aligned_cols=91  Identities=18%  Similarity=0.099  Sum_probs=76.1

Q ss_pred             HhhhhhhhcCCCCHHHHHHHHHHHHhcccHHHHHHHHHHcCCchhhHHHHHhhCCCcHHHHHHHHHHHcCCHHHHHHHHH
Q psy11108          8 IASRHSFVLCPYVAGQASFLSGVSQKKERFYHVEQALVNCQDYAGLQLIKSLRALPDDIMKHAYIAQHQGRFQTAENYQL   87 (106)
Q Consensus         8 ~~~~~~f~~~~~~~~lW~~LA~~AL~~~~l~iAe~Af~rl~d~~~v~~I~~l~~~~~~~~~~Aei~ay~Gkf~EAe~i~l   87 (106)
                      +..|.+.++..+++.+|+.||..||+.+++++|++||.+++|++++.+|..+....+...+.|+++...|++++|+.+|+
T Consensus       668 ~~~A~~~~~~~~~~~~W~~la~~al~~~~~~~A~~~y~~~~d~~~l~~l~~~~~~~~~~~~~~~~a~~~~~~~~A~~~~~  747 (814)
T 3mkq_A          668 LTLARDLLTDESAEMKWRALGDASLQRFNFKLAIEAFTNAHDLESLFLLHSSFNNKEGLVTLAKDAETTGKFNLAFNAYW  747 (814)
T ss_dssp             HHHHHHHHTTCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHTCHHHHHHHHHHTTCHHHHHHHHHHHHHTTCHHHHHHHHH
T ss_pred             HHHHHHHHHhhCcHhHHHHHHHHHHHcCCHHHHHHHHHHccChhhhHHHHHHcCCHHHHHHHHHHHHHcCchHHHHHHHH
Confidence            34677778888889999999999999999999999999999999999999986666665677777777777777777777


Q ss_pred             HcCCccccccC
Q psy11108         88 QADRRTWKSKP   98 (106)
Q Consensus        88 ~ag~~~~Aiem   98 (106)
                      +.|+++.|++|
T Consensus       748 ~~g~~~~a~~~  758 (814)
T 3mkq_A          748 IAGDIQGAKDL  758 (814)
T ss_dssp             HHTCHHHHHHH
T ss_pred             HcCCHHHHHHH
Confidence            77777777664
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query106
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 95.47
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 94.11
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 94.1
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 93.27
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 93.09
d1hh8a_ 192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 93.02
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 92.81
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 91.55
d1fcha_ 323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 91.45
d1w3ba_ 388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 91.15
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 88.25
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 88.15
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 84.28
d1hz4a_366 Transcription factor MalT domain III {Escherichia 83.45
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 82.69
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: STIP1 homology and U box-containing protein 1, STUB1
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=95.47  E-value=0.036  Score=35.44  Aligned_cols=65  Identities=11%  Similarity=-0.078  Sum_probs=51.6

Q ss_pred             CCCCHHHHHHHHHHHHhcccHHHHHHHHHHcCCchhhHHHHHhhCCCcHHHHHHHHHHHcCCHHHHHHHHHHc
Q psy11108         17 CPYVAGQASFLSGVSQKKERFYHVEQALVNCQDYAGLQLIKSLRALPDDIMKHAYIAQHQGRFQTAENYQLQA   89 (106)
Q Consensus        17 ~~~~~~lW~~LA~~AL~~~~l~iAe~Af~rl~d~~~v~~I~~l~~~~~~~~~~Aei~ay~Gkf~EAe~i~l~a   89 (106)
                      ++.++..|..+|..-+..++++-|...|.+.-+++-        +..+.-...|.++.-+|+|++|...|.++
T Consensus        34 ~p~~~~~~~~lg~~y~~~~~~~~Ai~~~~~al~l~p--------~~~~a~~~lg~~~~~l~~~~~A~~~~~~a   98 (201)
T d2c2la1          34 NPLVAVYYTNRALCYLKMQQPEQALADCRRALELDG--------QSVKAHFFLGQCQLEMESYDEAIANLQRA   98 (201)
T ss_dssp             CSCCHHHHHHHHHHHHHTTCHHHHHHHHHHHTTSCT--------TCHHHHHHHHHHHHHTTCHHHHHHHHHHH
T ss_pred             CCCCHHHHHhHHHHHhhhhhhhhhhHHHHHHHHhCC--------CcHHHHHHHHHHHHHCCCHHHHHHHHHHH
Confidence            567799999999999999999999999987643311        01112356899999999999999999875
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure