Psyllid ID: psy11132


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---
MLVIFSTVPPKLSPTNPERTLNVGERASLICSITKGDIPLTIKWLKDGRYLDNSAALSITHVDQYNSMLVIDSVSARHSGNYSCTVRNMVAEDTQVQRLIVNVPPKIESFAFPFDGLPEGARTRVICGVTHGDPPLTIRWLKDGKPLSPRFPVNVSDLDSFSSLLSINSVSAAHSGEYTCVASNTAAQARYSSKLQVKGNLNRLPPSYTLVFSQASYMSTSYYSFEQDSWMIDNENYVYCTYL
cEEEEEEcccEEEEccccEEEEccccEEEEEEEcccccccEEEEEEccEEccccccEEEEEEcccccEEEEccccccccEEEEEEEEEcccEEEEEEEEEEEcccEEEEcccccccccccccEEEEEEcEEcccccEEEEEEccEEcccccccEEEEcccccEEEEEccccccccEEEEEEEEEccccEEEEEEEEEEcccccccccEEEEccccEEEEEEcccccccEEEEccEEEEEEEcc
cEEEEEEcccEEEcccccEEEEcccEEEEEEEEEccccccEEEEEEccEEccccccEEEEEEcccEEEEEEEccccccccEEEEEEEEccccEEEEEEEEEEccccccccccccEEEEcccEEEEEEEEcccccccEEEEEEccEEEcccccEEEEEEcccEEEEEEEEccccccEEEEEEEEEccccEEEEEEEEEEccccccccccEcccccEEEEcccEEEEEEEEEcccccEEEEEEcc
mlvifstvppklsptnpertlnvgeRASLICSitkgdipltikwlkdgryldnsaalsITHVDQYNSMLVIDSvsarhsgnysctvrnmvaedTQVQRLIVnvppkiesfafpfdglpegartrvicgvthgdppltirwlkdgkplsprfpvnvsdldsfSSLLsinsvsaahsgeytcvasntaaqaryssklqvkgnlnrlppsytlVFSQASymstsyysfeqdswmidnenyvyctyl
mlvifstvppklsptnpertlnvgeRASLIcsitkgdipltikWLKDGRYLDNSAALSITHVDQYNSMLVIDSVSARHSGNYSCTVRNMVAEDTQVQRLIVNVPPKIESFAFPFDGLPEGARTRVICGVTHGDPPLTIRWLKDGKPLSPRFPVNVSDLDSFSSLLSINSVSAAHSGEYTCVASNTAAQARYSSKLQVKGNLNRLPPSYTLVFSQASYMSTSYYSfeqdswmidNENYVYCTYL
MLVIFSTVPPKLSPTNPERTLNVGERASLICSITKGDIPLTIKWLKDGRYLDNSAALSITHVDQYNSMLVIDSVSARHSGNYSCTVRNMVAEDTQVQRLIVNVPPKIESFAFPFDGLPEGARTRVICGVTHGDPPLTIRWLKDGKPLSPRFPvnvsdldsfssllsinsvsAAHSGEYTCVASNTAAQARYSSKLQVKGNLNRLPPSYTLVFSQASYMSTSYYSFEQDSWMIDNENYVYCTYL
**********************VGERASLICSITKGDIPLTIKWLKDGRYLDNSAALSITHVDQYNSMLVIDSVSARHSGNYSCTVRNMVAEDTQVQRLIVNVPPKIESFAFPFDGLPEGARTRVICGVTHGDPPLTIRWLKDGKPLSPRFPVNVSDLDSFSSLLSINSVSAAHSGEYTCVASNTAAQARYSSKLQVKGNLNRLPPSYTLVFSQASYMSTSYYSFEQDSWMIDNENYVYCTY*
MLVIFSTVPPKLSPTNPERTLNVGERASLICSITKGDIPLTIKWLKDGRYLDNSAALSITHVDQYNSMLVIDSVSARHSGNYSCTVRNMVAEDTQVQRLIVNVPPKIESFAFP*DGLPEGARTRVICGVTHGDPPLTIRWLKDGKPLS***********SFSSLLSINSVSAAHSGEYTCVASNTAAQARYSSKLQVKGNLNRLPPSYTLV**********YYSFEQDSWMIDNENYV*CT*L
MLVIFSTVPPKLSPTNPERTLNVGERASLICSITKGDIPLTIKWLKDGRYLDNSAALSITHVDQYNSMLVIDSVSARHSGNYSCTVRNMVAEDTQVQRLIVNVPPKIESFAFPFDGLPEGARTRVICGVTHGDPPLTIRWLKDGKPLSPRFPVNVSDLDSFSSLLSINSVSAAHSGEYTCVASNTAAQARYSSKLQVKGNLNRLPPSYTLVFSQASYMSTSYYSFEQDSWMIDNENYVYCTYL
MLVIFSTVPPKLSPTNPERTLNVGERASLICSITKGDIPLTIKWLKDGRYLDNSAALSITHVDQYNSMLVIDSVSARHSGNYSCTVRNMVAEDTQVQRLIVNVPPKIESFAFPFDGLPEGARTRVICGVTHGDPPLTIRWLKDGKPLSPRFPVNVSDLDSFSSLLSINSVSAAHSGEYTCVASNTAAQARYSSKLQVKGNLNRLPPSYTLVFSQASYMSTSYYSFEQDSWMIDNENYVYCTYL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLVIFSTVPPKLSPTNPERTLNVGERASLICSITKGDIPLTIKWLKDGRYLDNSAALSITHVDQYNSMLVIDSVSARHSGNYSCTVRNMVAEDTQVQRLIVNVPPKIESFAFPFDGLPEGARTRVICGVTHGDPPLTIRWLKDGKPLSPRFPVNVSDLDSFSSLLSINSVSAAHSGEYTCVASNTAAQARYSSKLQVKGNLNRLPPSYTLVFSQASYMSTSYYSFEQDSWMIDNENYVYCTYL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query243 2.2.26 [Sep-21-2011]
Q9VS29 2074 Down syndrome cell adhesi no N/A 0.753 0.088 0.438 3e-27
O60469 2012 Down syndrome cell adhesi yes N/A 0.641 0.077 0.348 1e-16
Q9ERC8 2013 Down syndrome cell adhesi yes N/A 0.641 0.077 0.342 2e-16
Q8VHZ8 2013 Down syndrome cell adhesi no N/A 0.641 0.077 0.342 2e-16
Q8NDA2 5065 Hemicentin-2 OS=Homo sapi no N/A 0.703 0.033 0.309 5e-15
A2AJ76 5100 Hemicentin-2 OS=Mus muscu no N/A 0.736 0.035 0.338 7e-15
Q96RW7 5635 Hemicentin-1 OS=Homo sapi no N/A 0.790 0.034 0.309 1e-14
Q8WZ42 34350 Titin OS=Homo sapiens GN= no N/A 0.728 0.005 0.301 6e-14
A2ASS6 35213 Titin OS=Mus musculus GN= no N/A 0.814 0.005 0.316 8e-14
B4KPU0 1045 Tyrosine-protein kinase-l N/A N/A 0.716 0.166 0.326 1e-13
>sp|Q9VS29|DSCL_DROME Down syndrome cell adhesion molecule-like protein Dscam2 OS=Drosophila melanogaster GN=Dscam2 PE=2 SV=3 Back     alignment and function desciption
 Score =  122 bits (305), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 86/196 (43%), Positives = 109/196 (55%), Gaps = 13/196 (6%)

Query: 17  PERTLNVGERASLICSITKGDIPLTIKWLKDGRYLDNSAALSITHVDQYNSMLVIDSVSA 76
           P+ T   GE  +L C +    I   I W + GR L +     I    Q +  L I  V  
Sbjct: 527 PKVTAVSGETLNLKCPVAGYPIE-EIHWERGGRELPDD----IRQRVQPDGSLTISPVQK 581

Query: 77  R-HSGNYSCTVRNMVAEDTQVQ-RLIVNVPPKIESFAFPFDGLPEGARTRVICGVTHGDP 134
              SG Y+C  RN      +    + V VPP IE FAF  +GL EG RTR +CGV+ GDP
Sbjct: 582 NSDSGVYTCWARNKQGHSARRSGEVTVIVPPSIEPFAFQ-EGLAEGMRTRTVCGVSRGDP 640

Query: 135 PLTIRWLKDGKPLSPRFPVNVSDLDSFSSLLSINSVSAAHSGEYTCVASNTAAQARYSSK 194
           PL + WLKDG PL      NV+ LD +SSLLSI S+SA HSGEYTCVA N AA+ +Y++ 
Sbjct: 641 PLKLIWLKDGDPLPDLLGANVTMLDQYSSLLSIPSLSATHSGEYTCVAKNPAAEIKYTAL 700

Query: 195 LQVKGNLNRLPPSYTL 210
           LQVK     +PP + +
Sbjct: 701 LQVK-----VPPRWIV 711




Cell adhesion molecule.
Drosophila melanogaster (taxid: 7227)
>sp|O60469|DSCAM_HUMAN Down syndrome cell adhesion molecule OS=Homo sapiens GN=DSCAM PE=1 SV=2 Back     alignment and function description
>sp|Q9ERC8|DSCAM_MOUSE Down syndrome cell adhesion molecule homolog OS=Mus musculus GN=Dscam PE=1 SV=1 Back     alignment and function description
>sp|Q8VHZ8|DSCAM_RAT Down syndrome cell adhesion molecule homolog OS=Rattus norvegicus GN=Dscam PE=1 SV=1 Back     alignment and function description
>sp|Q8NDA2|HMCN2_HUMAN Hemicentin-2 OS=Homo sapiens GN=HMCN2 PE=2 SV=2 Back     alignment and function description
>sp|A2AJ76|HMCN2_MOUSE Hemicentin-2 OS=Mus musculus GN=Hmcn2 PE=1 SV=1 Back     alignment and function description
>sp|Q96RW7|HMCN1_HUMAN Hemicentin-1 OS=Homo sapiens GN=HMCN1 PE=1 SV=2 Back     alignment and function description
>sp|Q8WZ42|TITIN_HUMAN Titin OS=Homo sapiens GN=TTN PE=1 SV=4 Back     alignment and function description
>sp|A2ASS6|TITIN_MOUSE Titin OS=Mus musculus GN=Ttn PE=1 SV=1 Back     alignment and function description
>sp|B4KPU0|PTK7_DROMO Tyrosine-protein kinase-like otk OS=Drosophila mojavensis GN=otk PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query243
332028703 1703 Down syndrome cell adhesion molecule-lik 0.790 0.112 0.575 2e-60
322800338 1441 hypothetical protein SINV_02508 [Solenop 0.790 0.133 0.575 2e-60
307201299 2051 Down syndrome cell adhesion molecule [Ha 0.810 0.096 0.552 1e-59
270004557 1892 hypothetical protein TcasGA2_TC003918 [T 0.810 0.104 0.571 4e-57
170041655 1601 down syndrome cell adhesion molecule [Cu 0.765 0.116 0.549 3e-55
195588390 2851 GD13085 [Drosophila simulans] gi|1941959 0.810 0.069 0.568 2e-53
194747233 1870 GF24786 [Drosophila ananassae] gi|190623 0.810 0.105 0.563 2e-53
195017504 1893 GH14935 [Drosophila grimshawi] gi|193898 0.810 0.104 0.563 7e-53
198465008 1971 GA16861 [Drosophila pseudoobscura pseudo 0.810 0.099 0.563 9e-53
195129293 2101 GI11453 [Drosophila mojavensis] gi|19392 0.810 0.093 0.563 2e-52
>gi|332028703|gb|EGI68735.1| Down syndrome cell adhesion molecule-like protein [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  238 bits (607), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 114/198 (57%), Positives = 151/198 (76%), Gaps = 6/198 (3%)

Query: 8   VPPKLSPTNPERTLNVGERASLICSITKGDIPLTIKWLKDGRYLDNSAALSITHVDQYNS 67
           VPPK+SP   +R L++GER +L CS+T+GD+PL+I WLKDGR +  S  +++T++DQYNS
Sbjct: 330 VPPKISPFTADRDLHLGERTTLTCSVTRGDLPLSITWLKDGRSMGPSERVTVTNMDQYNS 389

Query: 68  MLVIDSVSARHSGNYSCTVRNMVAEDTQVQRLIVNVPPKIESFAFPFDGLPEGARTRVIC 127
           +L+I+S+S  H+GNYSC  RN+ AE +  QRL+V+VPP IE F F  +GL EG RTR +C
Sbjct: 390 ILMIESLSPDHNGNYSCVARNVAAEVSHTQRLVVHVPPIIEPFTFQ-EGLSEGMRTRTVC 448

Query: 128 GVTHGDPPLTIRWLKDGK---PLSPRFP--VNVSDLDSFSSLLSINSVSAAHSGEYTCVA 182
           GV  GDPPLTI WLKDG+   PL P      NVS LD +SSLLSI +++A HSG+YTCVA
Sbjct: 449 GVAAGDPPLTISWLKDGQSPFPLPPNLASVANVSQLDPYSSLLSITNLAAEHSGDYTCVA 508

Query: 183 SNTAAQARYSSKLQVKGN 200
           +N AA+ RY++KLQVKG+
Sbjct: 509 ANPAAEVRYTAKLQVKGS 526




Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|322800338|gb|EFZ21342.1| hypothetical protein SINV_02508 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307201299|gb|EFN81146.1| Down syndrome cell adhesion molecule [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|270004557|gb|EFA01005.1| hypothetical protein TcasGA2_TC003918 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|170041655|ref|XP_001848570.1| down syndrome cell adhesion molecule [Culex quinquefasciatus] gi|167865230|gb|EDS28613.1| down syndrome cell adhesion molecule [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|195588390|ref|XP_002083941.1| GD13085 [Drosophila simulans] gi|194195950|gb|EDX09526.1| GD13085 [Drosophila simulans] Back     alignment and taxonomy information
>gi|194747233|ref|XP_001956057.1| GF24786 [Drosophila ananassae] gi|190623339|gb|EDV38863.1| GF24786 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195017504|ref|XP_001984609.1| GH14935 [Drosophila grimshawi] gi|193898091|gb|EDV96957.1| GH14935 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|198465008|ref|XP_001353455.2| GA16861 [Drosophila pseudoobscura pseudoobscura] gi|198149975|gb|EAL30964.3| GA16861 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195129293|ref|XP_002009090.1| GI11453 [Drosophila mojavensis] gi|193920699|gb|EDW19566.1| GI11453 [Drosophila mojavensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query243
FB|FBgn0261046 2046 Dscam3 "Down syndrome cell adh 0.761 0.090 0.322 9.8e-18
UNIPROTKB|E1B9K4 5073 E1B9K4 "Uncharacterized protei 0.736 0.035 0.339 4.9e-16
UNIPROTKB|O60469 2012 DSCAM "Down syndrome cell adhe 0.765 0.092 0.331 4.9e-16
UNIPROTKB|F1SGT7 1656 F1SGT7 "Uncharacterized protei 0.765 0.112 0.331 6.4e-16
UNIPROTKB|F1MKB9 1859 DSCAM "Uncharacterized protein 0.765 0.100 0.331 7.3e-16
MGI|MGI:1196281 2013 Dscam "Down syndrome cell adhe 0.765 0.092 0.331 8e-16
RGD|619992 2013 Dscam "Down syndrome cell adhe 0.765 0.092 0.331 8e-16
UNIPROTKB|F1NY98 1994 DSCAM "Uncharacterized protein 0.765 0.093 0.326 2.1e-15
FB|FBgn0263219 1918 Dscam4 "Down syndrome cell adh 0.543 0.068 0.350 6.9e-15
ZFIN|ZDB-GENE-041014-322 5616 hmcn1 "hemicentin 1" [Danio re 0.728 0.031 0.289 2.9e-14
FB|FBgn0261046 Dscam3 "Down syndrome cell adhesion molecule 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 226 (84.6 bits), Expect = 9.8e-18, Sum P(2) = 9.8e-18
 Identities = 62/192 (32%), Positives = 87/192 (45%)

Query:     9 PPKLSPTNPERTLNVGERASLICSITKGDIPLTIKWLKDGRYLDNSAALSITHVDQYNSM 68
             PP +    P + +  GE   + C      +   I+W K  + L  S    +  V      
Sbjct:   539 PPYVRAIGPIKAV-AGEDIIVHCPFAGYPVE-QIRWEKAHQELTTSNHYELASVAD-GGQ 595

Query:    69 LVIDSVS-ARHSGNYSCTVRNMVAEDTQVQ-RLIVNVPPKIESFAFPFDGLPEGARTRVI 126
             LVI +V   R  G Y+C VR+   E+ +   +L VN PP IE F FP   L EG R ++ 
Sbjct:   596 LVIKNVEPGRDQGIYTCIVRSRAGEEARRDMQLNVNSPPVIEPFKFP-KNLQEGGRAQIT 654

Query:   127 CGVTHGDPPLTIRWLKDGKPLSPRFPXXXXXXXXXXXXXXXXXXXAAHSGEYTCVASNTA 186
             C V+ GD P+   W KD   + P                      A HSG+YTC ASN A
Sbjct:   655 CAVSSGDMPIYFSWKKDDSSI-PSSLQITEKKEEFYSLLVFKDISARHSGKYTCYASNAA 713

Query:   187 AQARYSSKLQVK 198
             A+  Y+++LQV+
Sbjct:   714 AKVNYTAELQVR 725


GO:0007155 "cell adhesion" evidence=ISS
GO:0005886 "plasma membrane" evidence=ISS
GO:0007156 "homophilic cell adhesion" evidence=IC
GO:0042802 "identical protein binding" evidence=IPI
GO:0005887 "integral to plasma membrane" evidence=ISM
UNIPROTKB|E1B9K4 E1B9K4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O60469 DSCAM "Down syndrome cell adhesion molecule" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SGT7 F1SGT7 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MKB9 DSCAM "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1196281 Dscam "Down syndrome cell adhesion molecule" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|619992 Dscam "Down syndrome cell adhesion molecule" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NY98 DSCAM "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0263219 Dscam4 "Down syndrome cell adhesion molecule 4" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041014-322 hmcn1 "hemicentin 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
pfam0767990 pfam07679, I-set, Immunoglobulin I-set domain 1e-12
pfam0767990 pfam07679, I-set, Immunoglobulin I-set domain 6e-12
smart0040863 smart00408, IGc2, Immunoglobulin C-2 Type 3e-11
cd0572985 cd05729, Ig2_FGFR_like, Second immunoglobulin (Ig) 3e-10
cd0009674 cd00096, Ig, Immunoglobulin domain 1e-09
pfam1392774 pfam13927, Ig_3, Immunoglobulin domain 4e-09
smart0041085 smart00410, IG_like, Immunoglobulin like 2e-08
smart0041085 smart00410, IG_like, Immunoglobulin like 2e-08
smart0040985 smart00409, IG, Immunoglobulin 2e-08
smart0040985 smart00409, IG, Immunoglobulin 2e-08
cd0009674 cd00096, Ig, Immunoglobulin domain 4e-08
pfam1392774 pfam13927, Ig_3, Immunoglobulin domain 2e-07
smart0040863 smart00408, IGc2, Immunoglobulin C-2 Type 4e-07
cd0575075 cd05750, Ig_Pro_neuregulin, Immunoglobulin (Ig)-li 4e-07
cd0573171 cd05731, Ig3_L1-CAM_like, Third immunoglobulin (Ig 5e-07
cd0572486 cd05724, Ig2_Robo, Second immunoglobulin (Ig)-like 2e-06
cd0585682 cd05856, Ig2_FGFRL1-like, Second immunoglobulin (I 2e-06
cd0574874 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like d 2e-06
pfam0004762 pfam00047, ig, Immunoglobulin domain 3e-06
cd0572569 cd05725, Ig3_Robo, Third immunoglobulin (Ig)-like 3e-06
pfam1389580 pfam13895, Ig_2, Immunoglobulin domain 4e-06
cd0585785 cd05857, Ig2_FGFR, Second immunoglobulin (Ig)-like 6e-06
cd05859101 cd05859, Ig4_PDGFR-alpha, Fourth immunoglobulin (I 9e-06
pfam0004762 pfam00047, ig, Immunoglobulin domain 1e-05
pfam1389580 pfam13895, Ig_2, Immunoglobulin domain 1e-05
cd0573676 cd05736, Ig2_Follistatin_like, Second immunoglobul 1e-05
cd0572985 cd05729, Ig2_FGFR_like, Second immunoglobulin (Ig) 3e-05
cd0575075 cd05750, Ig_Pro_neuregulin, Immunoglobulin (Ig)-li 3e-05
cd0572885 cd05728, Ig4_Contactin-2-like, Fourth Ig domain of 3e-05
cd04975101 cd04975, Ig4_SCFR_like, Fourth immunoglobulin (Ig) 3e-05
cd0574874 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like d 7e-05
cd0575485 cd05754, Ig3_Perlecan_like, Third immunoglobulin ( 8e-05
cd0573874 cd05738, Ig2_RPTP_IIa_LAR_like, Second immunoglobu 1e-04
cd0574792 cd05747, Ig5_Titin_like, M5, fifth immunoglobulin 2e-04
cd0574792 cd05747, Ig5_Titin_like, M5, fifth immunoglobulin 2e-04
cd0573095 cd05730, Ig3_NCAM-1_like, Third immunoglobulin (Ig 2e-04
cd0574669 cd05746, Ig4_Peroxidasin, Fourth immunoglobulin (I 4e-04
cd0587671 cd05876, Ig3_L1-CAM, Third immunoglobulin (Ig)-lik 4e-04
cd0497181 cd04971, Ig_TrKABC_d5, Fifth domain (immunoglobuli 5e-04
cd0497671 cd04976, Ig2_VEGFR, Second immunoglobulin (Ig)-lik 5e-04
cd0586367 cd05863, Ig2_VEGFR-3, Second immunoglobulin (Ig)-l 5e-04
cd0573792 cd05737, Ig_Myomesin_like_C, C-temrinal immunoglob 7e-04
cd0497876 cd04978, Ig4_L1-NrCAM_like, Fourth immunoglobulin 7e-04
cd0585785 cd05857, Ig2_FGFR, Second immunoglobulin (Ig)-like 0.001
cd0589576 cd05895, Ig_Pro_neuregulin-1, Immunoglobulin (Ig)- 0.001
cd0574574 cd05745, Ig3_Peroxidasin, Third immunoglobulin (Ig 0.002
cd07693100 cd07693, Ig1_Robo, First immunoglobulin (Ig)-like 0.002
cd0586286 cd05862, Ig1_VEGFR, First immunoglobulin (Ig)-like 0.002
cd0573588 cd05735, Ig8_DSCAM, Eight immunoglobulin (Ig) doma 0.002
cd0575792 cd05757, Ig2_IL1R_like, Second immunoglobulin (Ig) 0.002
cd0573377 cd05733, Ig6_L1-CAM_like, Sixth immunoglobulin (Ig 0.003
cd0574284 cd05742, Ig1_VEGFR_like, First immunoglobulin (Ig) 0.003
cd0576077 cd05760, Ig2_PTK7, Second immunoglobulin (Ig)-like 0.003
cd0576298 cd05762, Ig8_MLCK, Eighth immunoglobulin (Ig)-like 0.003
cd0573588 cd05735, Ig8_DSCAM, Eight immunoglobulin (Ig) doma 0.004
cd0576474 cd05764, Ig_2, Subgroup of the immunoglobulin (Ig) 0.004
>gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain Back     alignment and domain information
 Score = 61.9 bits (151), Expect = 1e-12
 Identities = 32/79 (40%), Positives = 45/79 (56%), Gaps = 2/79 (2%)

Query: 119 EGARTRVICGVTHGDPPLTIRWLKDGKPLSPRFPVNVSDLDSFSSLLSINSVSAAHSGEY 178
           EG   R  C VT GDP  T+ W KDG+PL       V+      +L +I++V     G+Y
Sbjct: 14  EGESARFTCTVT-GDPDPTVSWFKDGQPLRSSDRFKVTYEGGTYTL-TISNVQPDDEGKY 71

Query: 179 TCVASNTAAQARYSSKLQV 197
           TCVA+N+A +A  S++L V
Sbjct: 72  TCVATNSAGEAEASAELTV 90


Length = 90

>gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain Back     alignment and domain information
>gnl|CDD|197706 smart00408, IGc2, Immunoglobulin C-2 Type Back     alignment and domain information
>gnl|CDD|143206 cd05729, Ig2_FGFR_like, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|222457 pfam13927, Ig_3, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like Back     alignment and domain information
>gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like Back     alignment and domain information
>gnl|CDD|214652 smart00409, IG, Immunoglobulin Back     alignment and domain information
>gnl|CDD|214652 smart00409, IG, Immunoglobulin Back     alignment and domain information
>gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|222457 pfam13927, Ig_3, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|197706 smart00408, IGc2, Immunoglobulin C-2 Type Back     alignment and domain information
>gnl|CDD|143227 cd05750, Ig_Pro_neuregulin, Immunoglobulin (Ig)-like domain in neuregulins (NRGs) Back     alignment and domain information
>gnl|CDD|143208 cd05731, Ig3_L1-CAM_like, Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>gnl|CDD|143201 cd05724, Ig2_Robo, Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>gnl|CDD|143264 cd05856, Ig2_FGFRL1-like, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) Back     alignment and domain information
>gnl|CDD|143225 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>gnl|CDD|215677 pfam00047, ig, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143202 cd05725, Ig3_Robo, Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>gnl|CDD|206066 pfam13895, Ig_2, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143265 cd05857, Ig2_FGFR, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>gnl|CDD|143267 cd05859, Ig4_PDGFR-alpha, Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha Back     alignment and domain information
>gnl|CDD|215677 pfam00047, ig, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|206066 pfam13895, Ig_2, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143213 cd05736, Ig2_Follistatin_like, Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>gnl|CDD|143206 cd05729, Ig2_FGFR_like, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>gnl|CDD|143227 cd05750, Ig_Pro_neuregulin, Immunoglobulin (Ig)-like domain in neuregulins (NRGs) Back     alignment and domain information
>gnl|CDD|143205 cd05728, Ig4_Contactin-2-like, Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>gnl|CDD|143176 cd04975, Ig4_SCFR_like, Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins Back     alignment and domain information
>gnl|CDD|143225 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>gnl|CDD|143231 cd05754, Ig3_Perlecan_like, Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins Back     alignment and domain information
>gnl|CDD|143215 cd05738, Ig2_RPTP_IIa_LAR_like, Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>gnl|CDD|143224 cd05747, Ig5_Titin_like, M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>gnl|CDD|143224 cd05747, Ig5_Titin_like, M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>gnl|CDD|143207 cd05730, Ig3_NCAM-1_like, Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>gnl|CDD|143223 cd05746, Ig4_Peroxidasin, Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>gnl|CDD|143284 cd05876, Ig3_L1-CAM, Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>gnl|CDD|143172 cd04971, Ig_TrKABC_d5, Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>gnl|CDD|143177 cd04976, Ig2_VEGFR, Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) Back     alignment and domain information
>gnl|CDD|143271 cd05863, Ig2_VEGFR-3, Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) Back     alignment and domain information
>gnl|CDD|143214 cd05737, Ig_Myomesin_like_C, C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>gnl|CDD|143179 cd04978, Ig4_L1-NrCAM_like, Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) Back     alignment and domain information
>gnl|CDD|143265 cd05857, Ig2_FGFR, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>gnl|CDD|143303 cd05895, Ig_Pro_neuregulin-1, Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 Back     alignment and domain information
>gnl|CDD|143222 cd05745, Ig3_Peroxidasin, Third immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>gnl|CDD|143317 cd07693, Ig1_Robo, First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
>gnl|CDD|143270 cd05862, Ig1_VEGFR, First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) Back     alignment and domain information
>gnl|CDD|143212 cd05735, Ig8_DSCAM, Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>gnl|CDD|143234 cd05757, Ig2_IL1R_like, Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>gnl|CDD|143210 cd05733, Ig6_L1-CAM_like, Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>gnl|CDD|143219 cd05742, Ig1_VEGFR_like, First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins Back     alignment and domain information
>gnl|CDD|143237 cd05760, Ig2_PTK7, Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>gnl|CDD|143239 cd05762, Ig8_MLCK, Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) Back     alignment and domain information
>gnl|CDD|143212 cd05735, Ig8_DSCAM, Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>gnl|CDD|143241 cd05764, Ig_2, Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 243
KOG3513|consensus 1051 100.0
KOG3513|consensus 1051 99.97
KOG4194|consensus 873 99.95
KOG4221|consensus 1381 99.95
PHA02785326 IL-beta-binding protein; Provisional 99.93
KOG4194|consensus873 99.92
PHA02826227 IL-1 receptor-like protein; Provisional 99.91
KOG4221|consensus 1381 99.89
KOG4222|consensus 1281 99.88
PHA02785326 IL-beta-binding protein; Provisional 99.88
KOG4222|consensus 1281 99.88
cd0576298 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of 99.81
cd0576298 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of 99.75
cd0585188 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig 99.75
cd0573792 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- 99.73
cd0574792 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like 99.72
cd04975101 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma 99.72
cd04975101 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma 99.71
cd0573792 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- 99.71
cd0589486 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card 99.71
PF0767990 I-set: Immunoglobulin I-set domain; InterPro: IPR0 99.71
cd0589275 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like 99.71
cd0585188 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig 99.7
cd0589486 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card 99.7
cd0586596 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o 99.7
cd0574574 Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom 99.7
cd0585273 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig 99.69
cd0574574 Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom 99.68
cd0573588 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down 99.68
cd0589275 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like 99.68
cd05859101 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do 99.67
cd0585785 Ig2_FGFR Second immunoglobulin (Ig)-like domain of 99.67
cd0586596 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o 99.67
cd0496888 Ig3_Contactin_like Third Ig domain of contactin. I 99.67
cd0585273 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig 99.67
cd0573588 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down 99.67
cd0572885 Ig4_Contactin-2-like Fourth Ig domain of the neura 99.67
cd0589375 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like 99.67
cd0586367 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain 99.66
cd0585385 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig 99.66
cd0589192 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like 99.66
cd0574475 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain 99.66
cd0573095 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom 99.66
cd05771139 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain 99.66
cd0585785 Ig2_FGFR Second immunoglobulin (Ig)-like domain of 99.65
cd0574792 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like 99.65
cd0585385 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig 99.65
cd05859101 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do 99.65
cd0589192 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like 99.65
cd0586776 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do 99.65
cd0585485 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig 99.64
cd0497290 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o 99.64
cd0586367 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain 99.64
cd0585485 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig 99.64
cd0572371 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai 99.64
cd0586997 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o 99.64
cd0497290 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o 99.63
cd0574874 Ig_Titin_like Immunoglobulin (Ig)-like domain of t 99.63
cd0572885 Ig4_Contactin-2-like Fourth Ig domain of the neura 99.63
cd0496973 Ig5_Contactin_like Fifth Ig domain of contactin. I 99.63
PF0767990 I-set: Immunoglobulin I-set domain; InterPro: IPR0 99.63
cd0586876 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o 99.63
cd0572690 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in 99.63
cd0585579 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T 99.63
cd0587098 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o 99.63
cd0589375 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like 99.63
cd05773109 Ig8_hNephrin_like Eighth immunoglobulin-like domai 99.62
cd0573095 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom 99.62
cd0586776 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do 99.62
cd0497876 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like 99.62
cd0586997 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o 99.62
cd0574475 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain 99.62
cd0496888 Ig3_Contactin_like Third Ig domain of contactin. I 99.61
cd0497379 Ig1_FGFR First immunoglobulin (Ig)-like domain of 99.61
cd0586692 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o 99.61
cd0496973 Ig5_Contactin_like Fifth Ig domain of contactin. I 99.61
cd0573296 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom 99.61
cd0586876 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o 99.6
cd0497181 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of 99.6
cd0574874 Ig_Titin_like Immunoglobulin (Ig)-like domain of t 99.6
cd0497671 Ig2_VEGFR Second immunoglobulin (Ig)-like domain o 99.6
cd0572371 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai 99.6
cd07693100 Ig1_Robo First immunoglobulin (Ig)-like domain in 99.6
cd0574091 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai 99.6
cd0576375 Ig_1 Subgroup of the immunoglobulin (Ig) superfami 99.59
cd0573296 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom 99.59
cd0574669 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do 99.59
cd0587671 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o 99.59
cd0497085 Ig6_Contactin_like Sixth Ig domain of contactin. I 99.59
cd0497792 Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom 99.59
cd0574378 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai 99.59
cd0586470 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain 99.59
cd0572486 Ig2_Robo Second immunoglobulin (Ig)-like domain in 99.59
cd0497085 Ig6_Contactin_like Sixth Ig domain of contactin. I 99.58
cd0497876 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like 99.58
cd05773109 Ig8_hNephrin_like Eighth immunoglobulin-like domai 99.58
cd0497671 Ig2_VEGFR Second immunoglobulin (Ig)-like domain o 99.57
cd0587098 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o 99.57
cd0574378 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai 99.56
cd0573969 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li 99.56
cd0497379 Ig1_FGFR First immunoglobulin (Ig)-like domain of 99.56
cd0586692 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o 99.56
cd0576077 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of 99.56
cd0574669 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do 99.55
cd0585579 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T 99.55
cd0576474 Ig_2 Subgroup of the immunoglobulin (Ig) superfami 99.55
cd0574091 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai 99.55
cd0572569 Ig3_Robo Third immunoglobulin (Ig)-like domain in 99.55
cd0584894 Ig1_Contactin-5 First Ig domain of contactin-5. Ig 99.55
cd0497181 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of 99.54
cd0575278 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do 99.54
cd0497792 Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom 99.54
cd07693100 Ig1_Robo First immunoglobulin (Ig)-like domain in 99.54
cd0572690 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in 99.54
cd0585682 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do 99.54
cd0585890 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o 99.54
cd0586470 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain 99.54
cd0573171 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom 99.53
cd0585094 Ig1_Contactin-2 First Ig domain of contactin-2. Ig 99.53
cd0576375 Ig_1 Subgroup of the immunoglobulin (Ig) superfami 99.53
cd0573969 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li 99.53
cd0587671 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o 99.53
cd0575898 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do 99.53
cd0497490 Ig3_FGFR Third immunoglobulin (Ig)-like domain of 99.53
cd0575075 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain 99.53
cd0572295 Ig1_Neogenin First immunoglobulin (Ig)-like domain 99.53
cd0576077 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of 99.52
PHA02826227 IL-1 receptor-like protein; Provisional 99.52
cd0572486 Ig2_Robo Second immunoglobulin (Ig)-like domain in 99.52
cd0584993 Ig1_Contactin-1 First Ig domain of contactin-1. Ig 99.52
cd0576474 Ig_2 Subgroup of the immunoglobulin (Ig) superfami 99.52
cd0585682 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do 99.51
cd0575694 Ig1_IL1R_like First immunoglobulin (Ig)-like domai 99.51
cd0585890 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o 99.51
cd0573874 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l 99.51
cd0572569 Ig3_Robo Third immunoglobulin (Ig)-like domain in 99.51
cd0770272 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain 99.51
cd0574981 Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom 99.51
cd0573676 Ig2_Follistatin_like Second immunoglobulin (Ig)-li 99.5
KOG3515|consensus 741 99.5
cd0497490 Ig3_FGFR Third immunoglobulin (Ig)-like domain of 99.5
cd0576581 Ig_3 Subgroup of the immunoglobulin (Ig) superfami 99.5
cd0575383 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like 99.49
cd0573676 Ig2_Follistatin_like Second immunoglobulin (Ig)-li 99.49
cd0573874 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l 99.48
cd0589576 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai 99.48
cd0575075 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain 99.48
cd0584894 Ig1_Contactin-5 First Ig domain of contactin-5. Ig 99.48
cd0575694 Ig1_IL1R_like First immunoglobulin (Ig)-like domai 99.48
cd0589898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain 99.47
cd0573171 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom 99.47
cd0574284 Ig1_VEGFR_like First immunoglobulin (Ig)-like doma 99.47
cd0572985 Ig2_FGFR_like Second immunoglobulin (Ig)-like doma 99.47
cd0575898 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do 99.47
cd0587387 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of 99.45
cd0576581 Ig_3 Subgroup of the immunoglobulin (Ig) superfami 99.45
cd0770272 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain 99.45
cd0586184 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like 99.45
cd0572295 Ig1_Neogenin First immunoglobulin (Ig)-like domain 99.44
cd0572985 Ig2_FGFR_like Second immunoglobulin (Ig)-like doma 99.44
cd0575485 Ig3_Perlecan_like Third immunoglobulin (Ig)-like d 99.44
cd0770195 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- 99.44
cd0588295 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- 99.43
cd0589576 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai 99.43
cd0584993 Ig1_Contactin-1 First Ig domain of contactin-1. Ig 99.43
cd0574284 Ig1_VEGFR_like First immunoglobulin (Ig)-like doma 99.43
cd0575278 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do 99.42
cd0585094 Ig1_Contactin-2 First Ig domain of contactin-2. Ig 99.42
cd0575792 Ig2_IL1R_like Second immunoglobulin (Ig)-like doma 99.42
cd0574981 Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom 99.42
cd0573377 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom 99.41
cd0586184 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like 99.4
cd0575792 Ig2_IL1R_like Second immunoglobulin (Ig)-like doma 99.4
cd0575485 Ig3_Perlecan_like Third immunoglobulin (Ig)-like d 99.39
cd0587477 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of 99.39
cd0573377 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom 99.38
cd0587577 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li 99.38
cd0497989 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of 99.36
cd0587477 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of 99.36
cd0496791 Ig1_Contactin First Ig domain of contactin. Ig1_Co 99.36
cd0589898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain 99.36
cd0575383 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like 99.35
cd0573479 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain 99.35
cd0587577 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li 99.35
PHA03376221 BARF1; Provisional 99.35
cd0496791 Ig1_Contactin First Ig domain of contactin. Ig1_Co 99.33
cd0573479 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain 99.32
cd0572796 Ig2_Contactin-2-like Second Ig domain of the neura 99.31
cd0572796 Ig2_Contactin-2-like Second Ig domain of the neura 99.3
cd05896104 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like 99.29
cd0770195 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- 99.28
cd0588295 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- 99.28
cd0571795 Ig1_Necl-1-3_like First (N-terminal) immunoglobuli 99.27
cd0587387 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of 99.26
cd0587191 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do 99.25
cd0586286 Ig1_VEGFR First immunoglobulin (Ig)-like domain of 99.25
cd0588580 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain 99.25
PF0004764 ig: Immunoglobulin domain The Prosite family only 99.24
cd0586286 Ig1_VEGFR First immunoglobulin (Ig)-like domain of 99.24
cd05860101 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of 99.24
smart0040986 IG Immunoglobulin. 99.24
smart0041086 IG_like Immunoglobulin like. IG domains that canno 99.24
cd0584595 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do 99.24
smart0040863 IGc2 Immunoglobulin C-2 Type. 99.22
cd0588580 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain 99.21
cd0497989 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of 99.21
smart0040863 IGc2 Immunoglobulin C-2 Type. 99.19
cd0769094 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I 99.19
PF1389580 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V 99.19
cd0588195 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- 99.19
cd05860101 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of 99.18
PF0004764 ig: Immunoglobulin domain The Prosite family only 99.18
cd0589795 Ig2_IL1R2_like Second immunoglobulin (Ig)-like dom 99.16
cd0584595 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do 99.15
smart0040986 IG Immunoglobulin. 99.15
smart0041086 IG_like Immunoglobulin like. IG domains that canno 99.15
cd0587285 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of 99.13
cd0589795 Ig2_IL1R2_like Second immunoglobulin (Ig)-like dom 99.13
cd0571795 Ig1_Necl-1-3_like First (N-terminal) immunoglobuli 99.11
cd05896104 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like 99.11
cd0575982 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like d 99.09
cd0587191 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do 99.09
cd0769094 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I 99.09
PF1389580 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V 99.08
cd05877106 Ig_LP_like Immunoglobulin (Ig)-like domain of huma 99.06
cd0575191 Ig1_LILRB1_like First immunoglobulin (Ig)-like dom 99.05
cd0575982 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like d 99.03
cd05714106 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho 99.02
PF1392775 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V 99.01
KOG3515|consensus 741 98.99
cd0575191 Ig1_LILRB1_like First immunoglobulin (Ig)-like dom 98.99
cd0588382 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain 98.97
cd0588195 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- 98.96
cd05879116 Ig_P0 Immunoglobulin (Ig)-like domain of Protein z 98.96
cd05878110 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain o 98.95
cd0571898 Ig1_PVR_like First immunoglobulin (Ig) domain of p 98.95
cd05877106 Ig_LP_like Immunoglobulin (Ig)-like domain of huma 98.94
cd0588382 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain 98.94
cd05772111 IgC_SIRP Signal-regulatory protein (SIRP) immunogl 98.93
cd05774105 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain 98.93
cd04983109 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V 98.93
cd05900112 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the 98.91
cd05899110 IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma 98.91
cd0577597 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig) 98.9
cd05755100 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like do 98.88
cd05713100 Ig_MOG_like Immunoglobulin (Ig)-like domain of mye 98.87
cd0584697 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain 98.87
cd05771139 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain 98.87
PHA02987189 Ig domain OX-2-like protein; Provisional 98.87
cd00099105 IgV Immunoglobulin variable domain (IgV). IgV: Imm 98.87
cd0588699 Ig1_Nectin-1_like First immunoglobulin (Ig) domain 98.84
cd0574192 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like d 98.84
cd05755100 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like do 98.83
cd0571194 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of 98.83
cd05880115 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel 98.82
cd0588796 Ig1_Nectin-3_like First immunoglobulin (Ig) domain 98.81
cd05715116 Ig_P0-like Immunoglobulin (Ig)-like domain of Prot 98.79
cd05714106 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho 98.79
cd0576182 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like 98.78
cd04982116 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) dom 98.78
cd04980106 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa 98.77
cd0587285 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of 98.77
cd0571898 Ig1_PVR_like First immunoglobulin (Ig) domain of p 98.76
cd05900112 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the 98.75
cd0576182 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like 98.74
cd05713100 Ig_MOG_like Immunoglobulin (Ig)-like domain of mye 98.74
cd05902110 Ig_Neurocan Immunoglobulin (Ig)-like domain of the 98.72
cd05772111 IgC_SIRP Signal-regulatory protein (SIRP) immunogl 98.71
cd04983109 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V 98.71
cd0770583 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain 98.71
PF1392775 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V 98.7
cd05901117 Ig_Versican Immunoglobulin (Ig)-like domain of the 98.7
cd0770583 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain 98.7
cd0588996 Ig1_DNAM-1_like First immunoglobulin (Ig) domain o 98.69
cd05888100 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain 98.69
cd0571698 Ig_pIgR Immunoglobulin (Ig)-like domain in the pol 98.68
cd05774105 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain 98.67
cd07706116 IgV_TCR_delta Immunoglobulin (Ig) variable (V) dom 98.67
cd0588483 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain 98.67
cd05878110 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain o 98.67
cd0571194 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of 98.67
cd0588483 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain 98.66
cd0577597 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig) 98.65
cd00099105 IgV Immunoglobulin variable domain (IgV). IgV: Imm 98.64
cd0769488 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. 98.64
cd05899110 IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma 98.63
cd0498498 IgV_L_lambda Immunoglobulin (Ig) lambda light chai 98.62
cd0588699 Ig1_Nectin-1_like First immunoglobulin (Ig) domain 98.61
cd0574192 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like d 98.61
cd0584697 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain 98.6
cd0009895 IgC Immunoglobulin Constant domain. IgC: Immunoglo 98.6
cd0009895 IgC Immunoglobulin Constant domain. IgC: Immunoglo 98.58
cd05879116 Ig_P0 Immunoglobulin (Ig)-like domain of Protein z 98.57
PF07686114 V-set: Immunoglobulin V-set domain; InterPro: IPR0 98.55
cd0588796 Ig1_Nectin-3_like First immunoglobulin (Ig) domain 98.54
PHA02987189 Ig domain OX-2-like protein; Provisional 98.51
PHA03270466 envelope glycoprotein C; Provisional 98.5
cd0769488 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. 98.5
cd05888100 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain 98.49
cd0498498 IgV_L_lambda Immunoglobulin (Ig) lambda light chai 98.49
cd04982116 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) dom 98.48
cd07700107 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD 98.48
cd05712119 Ig_Siglec_N Immunoglobulin (Ig) domain at the N te 98.47
cd07699100 IgC_L Immunoglobulin Constant domain. IgC_L: Immun 98.46
cd07699100 IgC_L Immunoglobulin Constant domain. IgC_L: Immun 98.45
PHA03376221 BARF1; Provisional 98.44
cd0769893 IgC_MHC_I_alpha3 Class I major histocompatibility 98.43
PHA03269566 envelope glycoprotein C; Provisional 98.42
cd04980106 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa 98.41
cd05902110 Ig_Neurocan Immunoglobulin (Ig)-like domain of the 98.39
PF0820589 C2-set_2: CD80-like C2-set immunoglobulin domain ; 98.37
cd05901117 Ig_Versican Immunoglobulin (Ig)-like domain of the 98.37
cd05715116 Ig_P0-like Immunoglobulin (Ig)-like domain of Prot 98.36
cd05880115 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel 98.35
cd0577093 IgC_beta2m Class I major histocompatibility comple 98.33
cd0571698 Ig_pIgR Immunoglobulin (Ig)-like domain in the pol 98.32
cd0588996 Ig1_DNAM-1_like First immunoglobulin (Ig) domain o 98.31
cd0576694 IgC_MHC_II_beta Class II major histocompatibility 98.28
smart0040775 IGc1 Immunoglobulin C-Type. 98.28
PF0820589 C2-set_2: CD80-like C2-set immunoglobulin domain ; 98.27
cd0769893 IgC_MHC_I_alpha3 Class I major histocompatibility 98.26
PHA03271490 envelope glycoprotein C; Provisional 98.26
cd0009674 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) 98.25
cd0576694 IgC_MHC_II_beta Class II major histocompatibility 98.24
smart0040775 IGc1 Immunoglobulin C-Type. 98.24
cd05720104 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD 98.24
cd07700107 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD 98.23
cd05769115 IgC_TCR_beta T cell receptor (TCR) beta chain cons 98.22
cd0009674 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) 98.21
KOG1480|consensus 909 98.21
cd05769115 IgC_TCR_beta T cell receptor (TCR) beta chain cons 98.21
cd0584794 IgC_CH2_IgE CH2 domain (second constant Ig domain 98.21
cd07706116 IgV_TCR_delta Immunoglobulin (Ig) variable (V) dom 98.21
PF07686114 V-set: Immunoglobulin V-set domain; InterPro: IPR0 98.2
PHA03273 486 envelope glycoprotein C; Provisional 98.19
cd0576794 IgC_MHC_II_alpha Class II major histocompatibility 98.17
cd04981117 IgV_H Immunoglobulin (Ig) heavy chain (H), variabl 98.17
cd05768102 IgC_CH4 CH4 domain (fourth constant Ig domain of t 98.17
cd0576794 IgC_MHC_II_alpha Class II major histocompatibility 98.16
cd0584794 IgC_CH2_IgE CH2 domain (second constant Ig domain 98.15
PF0765483 C1-set: Immunoglobulin C1-set domain; InterPro: IP 98.13
cd05768102 IgC_CH4 CH4 domain (fourth constant Ig domain of t 98.13
cd0571995 Ig2_PVR_like Second immunoglobulin (Ig) domain of 98.1
PHA03270466 envelope glycoprotein C; Provisional 98.09
cd0577093 IgC_beta2m Class I major histocompatibility comple 98.09
cd0571995 Ig2_PVR_like Second immunoglobulin (Ig) domain of 98.08
PF0765483 C1-set: Immunoglobulin C1-set domain; InterPro: IP 98.08
cd05720104 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD 98.06
smart0040681 IGv Immunoglobulin V-Type. 98.06
cd0769696 IgC_CH3 CH3 domain (third constant Ig domain of th 98.04
cd0769696 IgC_CH3 CH3 domain (third constant Ig domain of th 98.02
cd0770395 Ig2_Nectin-2_like Second immunoglobulin (Ig) domai 98.0
cd0770395 Ig2_Nectin-2_like Second immunoglobulin (Ig) domai 98.0
cd0769796 IgC_TCR_gamma T cell receptor (TCR) gamma chain co 98.0
cd0498699 IgC_CH2 CH2 domain (second constant Ig domain of t 97.94
PHA02914500 Immunoglobulin-like domain protein; Provisional 97.93
cd0769796 IgC_TCR_gamma T cell receptor (TCR) gamma chain co 97.91
PF08204130 V-set_CD47: CD47 immunoglobulin-like domain; Inter 97.89
cd0498595 IgC_CH1 CH1 domain (first constant Ig domain of th 97.87
cd0770497 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) dom 97.85
PHA03269566 envelope glycoprotein C; Provisional 97.85
cd0769169 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain 97.84
cd0498595 IgC_CH1 CH1 domain (first constant Ig domain of th 97.82
cd0770497 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) dom 97.82
PHA03271490 envelope glycoprotein C; Provisional 97.81
cd0769265 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of 97.8
cd05712119 Ig_Siglec_N Immunoglobulin (Ig) domain at the N te 97.79
cd0769265 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of 97.75
cd0768999 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain 97.75
cd04981117 IgV_H Immunoglobulin (Ig) heavy chain (H), variabl 97.72
PHA02982251 hypothetical protein; Provisional 97.7
PHA0263363 hypothetical protein; Provisional 97.7
smart0040681 IGv Immunoglobulin V-Type. 97.67
cd0498699 IgC_CH2 CH2 domain (second constant Ig domain of t 97.63
cd0768999 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain 97.53
PHA0263363 hypothetical protein; Provisional 97.48
PHA03273486 envelope glycoprotein C; Provisional 97.43
cd0769169 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain 97.34
PHA02914500 Immunoglobulin-like domain protein; Provisional 97.19
PF08204130 V-set_CD47: CD47 immunoglobulin-like domain; Inter 97.17
cd05721115 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic 97.11
PHA02982251 hypothetical protein; Provisional 96.98
PHA03042286 CD47-like protein; Provisional 96.9
KOG1480|consensus 909 96.63
cd05721115 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic 96.57
PHA03042 286 CD47-like protein; Provisional 96.51
PF11465108 Receptor_2B4: Natural killer cell receptor 2B4; In 96.38
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 96.01
PF07354271 Sp38: Zona-pellucida-binding protein (Sp38); Inter 96.0
PF11465108 Receptor_2B4: Natural killer cell receptor 2B4; In 95.88
PF07354 271 Sp38: Zona-pellucida-binding protein (Sp38); Inter 95.81
KOG4597|consensus 560 95.32
PF0632889 Lep_receptor_Ig: Ig-like C2-type domain; InterPro: 95.19
cd0589098 Ig2_Nectin-1_like Second immunoglobulin (Ig) domai 94.9
KOG4597|consensus 560 94.86
PHA02865338 MHC-like TNF binding protein; Provisional 94.53
PHA02865338 MHC-like TNF binding protein; Provisional 94.39
PF0579080 C2-set: Immunoglobulin C2-set domain; InterPro: IP 94.24
PF0579080 C2-set: Immunoglobulin C2-set domain; InterPro: IP 94.02
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 93.99
KOG0613|consensus 1205 93.53
PHA03283 542 envelope glycoprotein E; Provisional 92.19
PF02124211 Marek_A: Marek's disease glycoprotein A; InterPro: 91.86
cd0589098 Ig2_Nectin-1_like Second immunoglobulin (Ig) domai 91.45
PHA0305269 Hypothetical protein; Provisional 90.47
PF0632889 Lep_receptor_Ig: Ig-like C2-type domain; InterPro: 90.27
KOG0613|consensus 1205 89.57
PHA03112141 IL-18 binding protein; Provisional 89.0
PF0392191 ICAM_N: Intercellular adhesion molecule (ICAM), N- 88.93
PF02124211 Marek_A: Marek's disease glycoprotein A; InterPro: 88.34
PHA03240258 envelope glycoprotein M; Provisional 88.15
KOG1026|consensus 774 87.71
PHA03286 492 envelope glycoprotein E; Provisional 84.29
KOG1026|consensus 774 83.11
PHA03189348 UL14 tegument protein; Provisional 82.46
PHA03286 492 envelope glycoprotein E; Provisional 82.14
PF0683289 BiPBP_C: Penicillin-Binding Protein C-terminus Fam 80.75
PHA0305269 Hypothetical protein; Provisional 80.52
>KOG3513|consensus Back     alignment and domain information
Probab=100.00  E-value=7.4e-32  Score=218.37  Aligned_cols=225  Identities=22%  Similarity=0.329  Sum_probs=184.7

Q ss_pred             eeEEEecCCCccCCCCCcccccCCeEEEEEEeeCCCCCceeEEEECCeeecCCCceEEEEeeeeceEEEEeecCCCCCee
Q psy11132          2 LVIFSTVPPKLSPTNPERTLNVGERASLICSITKGDIPLTIKWLKDGRYLDNSAALSITHVDQYNSMLVIDSVSARHSGN   81 (243)
Q Consensus         2 ~~l~v~~~p~~~~~~~~~~~~~g~~~~l~C~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~G~   81 (243)
                      ..|.+..+|.+...+++..+..|+++.|.|.+. +.|.+.|+|++||.++....+......  ....|+|.+++..|+|.
T Consensus       324 ~~v~v~a~P~w~~~~~d~~~~~gs~v~~eC~a~-g~P~p~v~WlkNg~pl~~~~r~~~~~i--~~g~L~is~v~~~dsg~  400 (1051)
T KOG3513|consen  324 GHVTVYAPPYWLQKPQDTEADTGSNVTLECKAS-GKPNPTVKWLKNGEPLEPAERDPRYKI--DDGTLIISNVQESDSGV  400 (1051)
T ss_pred             EEEEEecCchhhcccceeEecCCCCeEEEEEec-CCCCCceEEeeCCeecCccCCCcceEE--eCCEEEEEecccccCeE
Confidence            467899999999999999999999999999995 999999999999999987665221111  16789999999999999


Q ss_pred             EEEEEEeCCCcceeEEEEEEEcC-CCccccccCC-CCCCCCCcEEEEEEeecCCCCCEEEEEeCCEecCCCCCeeEEeec
Q psy11132         82 YSCTVRNMVAEDTQVQRLIVNVP-PKIESFAFPF-DGLPEGARTRVICGVTHGDPPLTIRWLKDGKPLSPRFPVNVSDLD  159 (243)
Q Consensus        82 Y~C~~~~~~~~~~~~~~l~v~~~-p~~~~~~~~~-~~~~~g~~~~l~C~~~~~~p~~~~~W~~~~~~~~~~~~~~~~~~~  159 (243)
                      |+|.|+|..|.....+.|.|... |.+...+... ..+..|.++.|.|.. .+.|.+.++|.+++..+....++.+..  
T Consensus       401 YQC~A~Nk~G~i~anA~L~V~a~~P~f~~~p~~~~~~a~~g~~v~i~C~~-~asP~p~~~W~k~~~~~~~~~r~~i~e--  477 (1051)
T KOG3513|consen  401 YQCIAENKYGTIYANAELKVLASAPVFPLNPVERKVMAVVGGTVTIDCKP-FASPKPKVSWLKGGEKLLQSGRIRILE--  477 (1051)
T ss_pred             EEeeeecccceEeeeeEEEEEccCCCCCCCccceEEEEEeCCeEEEeecc-CCCCcceEEEEcCCcccccCceEEECC--
Confidence            99999999999999999999876 5555444332 245689999999999 799999999999998655555444432  


Q ss_pred             cceeEEEEeecCCCCCeeEEEEEEccCcceeeeEEEEEEeecCCCCCeeee-------eccceeeeccCccccc----cc
Q psy11132        160 SFSSLLSINSVSAAHSGEYTCVASNTAAQARYSSKLQVKGNLNRLPPSYTL-------VFSQASYMSTSYYSFE----QD  228 (243)
Q Consensus       160 ~~~~~l~i~~~~~~d~g~y~C~~~n~~g~~~~~~~l~v~~~~~~~~p~~~~-------~~~~~~~~~~~~~~~~----~~  228 (243)
                        .++|.|.+++.+|+|.|+|.|.|..|.......|.|+     .++.+++       ..+..+++.|+...-+    .|
T Consensus       478 --dGtL~I~n~t~~DaG~YtC~A~N~~G~a~~~~~L~Vk-----d~tri~~~P~~~~v~~g~~v~l~Ce~shD~~ld~~f  550 (1051)
T KOG3513|consen  478 --DGTLEISNVTRSDAGKYTCVAENKLGKAESTGNLIVK-----DATRITLAPSNTDVKVGESVTLTCEASHDPSLDITF  550 (1051)
T ss_pred             --CCcEEecccCcccCcEEEEEEEcccCccceEEEEEEe-----cCceEEeccchhhhccCceEEEEeecccCCCcceEE
Confidence              5789999999999999999999999999999999999     4555444       4467888899876433    78


Q ss_pred             ceEEeCCeeEE
Q psy11132        229 SWMIDNENYVY  239 (243)
Q Consensus       229 ~W~~~~~~~~~  239 (243)
                      .|.+||+.+.+
T Consensus       551 ~W~~nG~~id~  561 (1051)
T KOG3513|consen  551 TWKKNGRPIDF  561 (1051)
T ss_pred             EEEECCEEhhc
Confidence            99999986543



>KOG3513|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) Back     alignment and domain information
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) Back     alignment and domain information
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 Back     alignment and domain information
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins Back     alignment and domain information
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins Back     alignment and domain information
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) Back     alignment and domain information
>PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin Back     alignment and domain information
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 Back     alignment and domain information
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) Back     alignment and domain information
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 Back     alignment and domain information
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 Back     alignment and domain information
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin Back     alignment and domain information
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha Back     alignment and domain information
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 Back     alignment and domain information
>cd04968 Ig3_Contactin_like Third Ig domain of contactin Back     alignment and domain information
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 Back     alignment and domain information
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin Back     alignment and domain information
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) Back     alignment and domain information
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 Back     alignment and domain information
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) Back     alignment and domain information
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin Back     alignment and domain information
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain Back     alignment and domain information
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 Back     alignment and domain information
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha Back     alignment and domain information
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) Back     alignment and domain information
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 Back     alignment and domain information
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) Back     alignment and domain information
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 Back     alignment and domain information
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin Back     alignment and domain information
>PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) Back     alignment and domain information
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB Back     alignment and domain information
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) Back     alignment and domain information
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin Back     alignment and domain information
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin Back     alignment and domain information
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) Back     alignment and domain information
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin Back     alignment and domain information
>cd04968 Ig3_Contactin_like Third Ig domain of contactin Back     alignment and domain information
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 Back     alignment and domain information
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin Back     alignment and domain information
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins Back     alignment and domain information
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) Back     alignment and domain information
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) Back     alignment and domain information
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins Back     alignment and domain information
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin Back     alignment and domain information
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins Back     alignment and domain information
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 Back     alignment and domain information
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) Back     alignment and domain information
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin Back     alignment and domain information
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) Back     alignment and domain information
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin Back     alignment and domain information
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) Back     alignment and domain information
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) Back     alignment and domain information
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 Back     alignment and domain information
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 Back     alignment and domain information
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB Back     alignment and domain information
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 Back     alignment and domain information
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins Back     alignment and domain information
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) Back     alignment and domain information
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) Back     alignment and domain information
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) Back     alignment and domain information
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 Back     alignment and domain information
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins Back     alignment and domain information
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) Back     alignment and domain information
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 Back     alignment and domain information
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) Back     alignment and domain information
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) Back     alignment and domain information
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) Back     alignment and domain information
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) Back     alignment and domain information
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>KOG3515|consensus Back     alignment and domain information
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 Back     alignment and domain information
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) Back     alignment and domain information
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 Back     alignment and domain information
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) Back     alignment and domain information
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins Back     alignment and domain information
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins Back     alignment and domain information
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D Back     alignment and domain information
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) Back     alignment and domain information
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) Back     alignment and domain information
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins Back     alignment and domain information
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 Back     alignment and domain information
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 Back     alignment and domain information
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins Back     alignment and domain information
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 Back     alignment and domain information
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) Back     alignment and domain information
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) Back     alignment and domain information
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins Back     alignment and domain information
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) Back     alignment and domain information
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) Back     alignment and domain information
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin Back     alignment and domain information
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) Back     alignment and domain information
>cd04967 Ig1_Contactin First Ig domain of contactin Back     alignment and domain information
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) Back     alignment and domain information
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) Back     alignment and domain information
>PHA03376 BARF1; Provisional Back     alignment and domain information
>cd04967 Ig1_Contactin First Ig domain of contactin Back     alignment and domain information
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) Back     alignment and domain information
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) Back     alignment and domain information
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D Back     alignment and domain information
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin Back     alignment and domain information
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) Back     alignment and domain information
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) Back     alignment and domain information
>PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs Back     alignment and domain information
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) Back     alignment and domain information
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) Back     alignment and domain information
>smart00409 IG Immunoglobulin Back     alignment and domain information
>smart00410 IG_like Immunoglobulin like Back     alignment and domain information
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>smart00408 IGc2 Immunoglobulin C-2 Type Back     alignment and domain information
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) Back     alignment and domain information
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin Back     alignment and domain information
>smart00408 IGc2 Immunoglobulin C-2 Type Back     alignment and domain information
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A Back     alignment and domain information
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) Back     alignment and domain information
>PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs Back     alignment and domain information
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2) Back     alignment and domain information
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>smart00409 IG Immunoglobulin Back     alignment and domain information
>smart00410 IG_like Immunoglobulin like Back     alignment and domain information
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B Back     alignment and domain information
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2) Back     alignment and domain information
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) Back     alignment and domain information
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) Back     alignment and domain information
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) Back     alignment and domain information
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin Back     alignment and domain information
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A Back     alignment and domain information
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) Back     alignment and domain information
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins Back     alignment and domain information
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) Back     alignment and domain information
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins Back     alignment and domain information
>PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C Back     alignment and domain information
>KOG3515|consensus Back     alignment and domain information
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins Back     alignment and domain information
>cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) Back     alignment and domain information
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG) Back     alignment and domain information
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) Back     alignment and domain information
>cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain Back     alignment and domain information
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins Back     alignment and domain information
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan Back     alignment and domain information
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain Back     alignment and domain information
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like Back     alignment and domain information
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) Back     alignment and domain information
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins Back     alignment and domain information
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain Back     alignment and domain information
>PHA02987 Ig domain OX-2-like protein; Provisional Back     alignment and domain information
>cd00099 IgV Immunoglobulin variable domain (IgV) Back     alignment and domain information
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins Back     alignment and domain information
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins Back     alignment and domain information
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI Back     alignment and domain information
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) Back     alignment and domain information
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins Back     alignment and domain information
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins Back     alignment and domain information
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins Back     alignment and domain information
>cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively) Back     alignment and domain information
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain Back     alignment and domain information
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain Back     alignment and domain information
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B Back     alignment and domain information
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan Back     alignment and domain information
>cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively) Back     alignment and domain information
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) Back     alignment and domain information
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan Back     alignment and domain information
>cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain Back     alignment and domain information
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins Back     alignment and domain information
>cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C Back     alignment and domain information
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican Back     alignment and domain information
>cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins Back     alignment and domain information
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins Back     alignment and domain information
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) Back     alignment and domain information
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain Back     alignment and domain information
>cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG) Back     alignment and domain information
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI Back     alignment and domain information
>cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like Back     alignment and domain information
>cd00099 IgV Immunoglobulin variable domain (IgV) Back     alignment and domain information
>cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain Back     alignment and domain information
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain Back     alignment and domain information
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins Back     alignment and domain information
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins Back     alignment and domain information
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins Back     alignment and domain information
>cd00098 IgC Immunoglobulin Constant domain Back     alignment and domain information
>cd00098 IgC Immunoglobulin Constant domain Back     alignment and domain information
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) Back     alignment and domain information
>PF07686 V-set: Immunoglobulin V-set domain; InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins Back     alignment and domain information
>PHA02987 Ig domain OX-2-like protein; Provisional Back     alignment and domain information
>PHA03270 envelope glycoprotein C; Provisional Back     alignment and domain information
>cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins Back     alignment and domain information
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain Back     alignment and domain information
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain Back     alignment and domain information
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain Back     alignment and domain information
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins) Back     alignment and domain information
>cd07699 IgC_L Immunoglobulin Constant domain Back     alignment and domain information
>cd07699 IgC_L Immunoglobulin Constant domain Back     alignment and domain information
>PHA03376 BARF1; Provisional Back     alignment and domain information
>cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>PHA03269 envelope glycoprotein C; Provisional Back     alignment and domain information
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain Back     alignment and domain information
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan Back     alignment and domain information
>PF08205 C2-set_2: CD80-like C2-set immunoglobulin domain ; InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican Back     alignment and domain information
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins Back     alignment and domain information
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) Back     alignment and domain information
>cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin Back     alignment and domain information
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) Back     alignment and domain information
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins Back     alignment and domain information
>cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain Back     alignment and domain information
>smart00407 IGc1 Immunoglobulin C-Type Back     alignment and domain information
>PF08205 C2-set_2: CD80-like C2-set immunoglobulin domain ; InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>PHA03271 envelope glycoprotein C; Provisional Back     alignment and domain information
>cd00096 Ig Immunoglobulin domain Back     alignment and domain information
>cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain Back     alignment and domain information
>smart00407 IGc1 Immunoglobulin C-Type Back     alignment and domain information
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain Back     alignment and domain information
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain Back     alignment and domain information
>cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain Back     alignment and domain information
>cd00096 Ig Immunoglobulin domain Back     alignment and domain information
>KOG1480|consensus Back     alignment and domain information
>cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain Back     alignment and domain information
>cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE) Back     alignment and domain information
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain Back     alignment and domain information
>PF07686 V-set: Immunoglobulin V-set domain; InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>PHA03273 envelope glycoprotein C; Provisional Back     alignment and domain information
>cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain Back     alignment and domain information
>cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE) Back     alignment and domain information
>PF07654 C1-set: Immunoglobulin C1-set domain; InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>PHA03270 envelope glycoprotein C; Provisional Back     alignment and domain information
>cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin Back     alignment and domain information
>cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>PF07654 C1-set: Immunoglobulin C1-set domain; InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain Back     alignment and domain information
>smart00406 IGv Immunoglobulin V-Type Back     alignment and domain information
>cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd07703 Ig2_Nectin-2_like Second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112) and similar proteins Back     alignment and domain information
>cd07703 Ig2_Nectin-2_like Second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112) and similar proteins Back     alignment and domain information
>cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain Back     alignment and domain information
>cd04986 IgC_CH2 CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>PHA02914 Immunoglobulin-like domain protein; Provisional Back     alignment and domain information
>cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain Back     alignment and domain information
>PF08204 V-set_CD47: CD47 immunoglobulin-like domain; InterPro: IPR013270 This family represents the CD47 leukocyte antigen V-set like Ig domain [, ] Back     alignment and domain information
>cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd07704 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3), nectin-4 (poliovirus receptor related protein 4) and similar proteins Back     alignment and domain information
>PHA03269 envelope glycoprotein C; Provisional Back     alignment and domain information
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains Back     alignment and domain information
>cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd07704 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3), nectin-4 (poliovirus receptor related protein 4) and similar proteins Back     alignment and domain information
>PHA03271 envelope glycoprotein C; Provisional Back     alignment and domain information
>cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain Back     alignment and domain information
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins) Back     alignment and domain information
>cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain Back     alignment and domain information
>cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain Back     alignment and domain information
>PHA02982 hypothetical protein; Provisional Back     alignment and domain information
>PHA02633 hypothetical protein; Provisional Back     alignment and domain information
>smart00406 IGv Immunoglobulin V-Type Back     alignment and domain information
>cd04986 IgC_CH2 CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>PHA02633 hypothetical protein; Provisional Back     alignment and domain information
>PHA03273 envelope glycoprotein C; Provisional Back     alignment and domain information
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains Back     alignment and domain information
>PHA02914 Immunoglobulin-like domain protein; Provisional Back     alignment and domain information
>PF08204 V-set_CD47: CD47 immunoglobulin-like domain; InterPro: IPR013270 This family represents the CD47 leukocyte antigen V-set like Ig domain [, ] Back     alignment and domain information
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) Back     alignment and domain information
>PHA02982 hypothetical protein; Provisional Back     alignment and domain information
>PHA03042 CD47-like protein; Provisional Back     alignment and domain information
>KOG1480|consensus Back     alignment and domain information
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) Back     alignment and domain information
>PHA03042 CD47-like protein; Provisional Back     alignment and domain information
>PF11465 Receptor_2B4: Natural killer cell receptor 2B4; InterPro: IPR024303 2B4 is a transmembrane receptor which is expressed primarily on natural killer (NK) cells Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>PF07354 Sp38: Zona-pellucida-binding protein (Sp38); InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals Back     alignment and domain information
>PF11465 Receptor_2B4: Natural killer cell receptor 2B4; InterPro: IPR024303 2B4 is a transmembrane receptor which is expressed primarily on natural killer (NK) cells Back     alignment and domain information
>PF07354 Sp38: Zona-pellucida-binding protein (Sp38); InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals Back     alignment and domain information
>KOG4597|consensus Back     alignment and domain information
>PF06328 Lep_receptor_Ig: Ig-like C2-type domain; InterPro: IPR010457 This entry represents a ligand-binding domain that displays similarity to C2-set immunoglobulin domains (antibody constant domain 2) [] Back     alignment and domain information
>cd05890 Ig2_Nectin-1_like Second immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins Back     alignment and domain information
>KOG4597|consensus Back     alignment and domain information
>PHA02865 MHC-like TNF binding protein; Provisional Back     alignment and domain information
>PHA02865 MHC-like TNF binding protein; Provisional Back     alignment and domain information
>PF05790 C2-set: Immunoglobulin C2-set domain; InterPro: IPR008424 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>PF05790 C2-set: Immunoglobulin C2-set domain; InterPro: IPR008424 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>KOG0613|consensus Back     alignment and domain information
>PHA03283 envelope glycoprotein E; Provisional Back     alignment and domain information
>PF02124 Marek_A: Marek's disease glycoprotein A; InterPro: IPR001038 Equid herpesvirus 1 (Equine herpesvirus 1, EHV-1) glycoprotein 13 (EHV-1 gp13) has the characteristic features of a membrane-spanning protein: an N-terminal signal sequence; a hydrophobic membrane anchor region; a charged C-terminal cytoplasmic tail; and an exterior domain with nine potential N-glycosylation sites [] Back     alignment and domain information
>cd05890 Ig2_Nectin-1_like Second immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins Back     alignment and domain information
>PHA03052 Hypothetical protein; Provisional Back     alignment and domain information
>PF06328 Lep_receptor_Ig: Ig-like C2-type domain; InterPro: IPR010457 This entry represents a ligand-binding domain that displays similarity to C2-set immunoglobulin domains (antibody constant domain 2) [] Back     alignment and domain information
>KOG0613|consensus Back     alignment and domain information
>PHA03112 IL-18 binding protein; Provisional Back     alignment and domain information
>PF03921 ICAM_N: Intercellular adhesion molecule (ICAM), N-terminal domain; InterPro: IPR013768 Intercellular adhesion molecules (ICAMs) and vascular cell adhesion molecule-1 (VCAM-1) are part of the immunoglobulin superfamily Back     alignment and domain information
>PF02124 Marek_A: Marek's disease glycoprotein A; InterPro: IPR001038 Equid herpesvirus 1 (Equine herpesvirus 1, EHV-1) glycoprotein 13 (EHV-1 gp13) has the characteristic features of a membrane-spanning protein: an N-terminal signal sequence; a hydrophobic membrane anchor region; a charged C-terminal cytoplasmic tail; and an exterior domain with nine potential N-glycosylation sites [] Back     alignment and domain information
>PHA03240 envelope glycoprotein M; Provisional Back     alignment and domain information
>KOG1026|consensus Back     alignment and domain information
>PHA03286 envelope glycoprotein E; Provisional Back     alignment and domain information
>KOG1026|consensus Back     alignment and domain information
>PHA03189 UL14 tegument protein; Provisional Back     alignment and domain information
>PHA03286 envelope glycoprotein E; Provisional Back     alignment and domain information
>PF06832 BiPBP_C: Penicillin-Binding Protein C-terminus Family; InterPro: IPR009647 This conserved region of approximately 90 residues is found in a sub-group of bacterial Penicillin-Binding Proteins (PBPs) Back     alignment and domain information
>PHA03052 Hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
3dmk_A816 Crystal Structure Of Down Syndrome Cell Adhesion Mo 2e-12
3dmk_A816 Crystal Structure Of Down Syndrome Cell Adhesion Mo 1e-08
2rjm_A284 3ig Structure Of Titin Domains I67-I69 E-To-A Mutat 3e-10
3b43_A 570 I-band Fragment I65-i70 From Titin Length = 570 5e-10
2rik_A284 I-Band Fragment I67-I69 From Titin Length = 284 5e-10
3v6b_R424 Vegfr-2VEGF-E Complex Structure Length = 424 1e-07
1qz1_A291 Crystal Structure Of The Ig 1-2-3 Fragment Of Ncam 2e-07
3v2a_R 772 Vegfr-2VEGF-A Complex Structure Length = 772 2e-07
2om5_A381 N-Terminal Fragment Of Human Tax1 Length = 381 3e-07
2yd5_A214 Crystal Structure Of The N-Terminal Ig1-2 Module Of 4e-07
2yd6_A212 Crystal Structure Of The N-Terminal Ig1-2 Module Of 8e-07
2yd9_A304 Crystal Structure Of The N-Terminal Ig1-3 Module Of 1e-06
1cs6_A382 N-terminal Fragment Of Axonin-1 From Chicken Length 3e-06
2yd3_A202 Crystal Structure Of The N-Terminal Ig1-2 Module Of 3e-06
2yd2_A214 Crystal Structure Of The N-Terminal Ig1-2 Module Of 4e-06
3pxh_A201 Tandem Ig Domains Of Tyrosine Phosphatase Lar Lengt 5e-06
2yd4_A210 Crystal Structure Of The N-Terminal Ig1-2 Module Of 8e-06
2npl_X96 Nmr Structure Of Card D2 Domain Length = 96 2e-05
1nbq_A209 Crystal Structure Of Human Junctional Adhesion Mole 3e-05
1nbq_A209 Crystal Structure Of Human Junctional Adhesion Mole 8e-04
1evt_C225 Crystal Structure Of Fgf1 In Complex With The Extra 5e-05
1cvs_C225 Crystal Structure Of A Dimeric Fgf2-Fgfr1 Complex L 5e-05
3ojv_C226 Crystal Structure Of Fgf1 Complexed With The Ectodo 5e-05
3jz7_A214 Crystal Structure Of The Extracellular Domains Of C 6e-05
3mj7_B225 Crystal Structure Of The Complex Of Jaml And Coxsac 6e-05
2vra_A208 Drosophila Robo Ig1-2 (Monoclinic Form) Length = 20 9e-05
2vr9_A217 Drosophila Robo Ig1-2 (Tetragonal Form) Length = 21 9e-05
3pxj_A210 Tandem Ig Repeats Of Dlar Length = 210 1e-04
2v5r_A391 Structural Basis For Dscam Isoform Specificity Leng 1e-04
1tnm_A100 Tertiary Structure Of An Immunoglobulin-Like Domain 1e-04
1nct_A106 Titin Module M5, N-Terminally Extended, Nmr Length 1e-04
3ojm_B231 Crystal Structure Of Fgf1 Complexed With The Ectodo 3e-04
2v5s_A394 Structural Basis For Dscam Isoform Specificity Leng 3e-04
2v5m_A388 Structural Basis For Dscam Isoform Specificity Leng 3e-04
3oj2_C231 Crystal Structure Of Fgf1 Complexed With The Ectodo 3e-04
1f97_A212 Soluble Part Of The Junction Adhesion Molecule From 5e-04
2e6p_A104 Solution Structure Of The Ig-Like Domain (714-804) 9e-04
>pdb|3DMK|A Chain A, Crystal Structure Of Down Syndrome Cell Adhesion Molecule (Dscam) Isoform 1.30.30, N-Terminal Eight Ig Domains Length = 816 Back     alignment and structure

Iteration: 1

Score = 69.7 bits (169), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 43/137 (31%), Positives = 67/137 (48%), Gaps = 5/137 (3%) Query: 8 VPPKLSP-TNPERTLNVGERASLICSITKGDIPLTIKWLKDGRYLDNSAALSITHVDQYN 66 V P++ P E VG+ +L CS+ GD+PL I W DG+ + ++ + V + Sbjct: 617 VLPRIIPFAFEEGPAQVGQYLTLHCSVPGGDLPLNIDWTLDGQAISEDLGITTSRVGRRG 676 Query: 67 SMLVIDSVSARHSGNYSCTVRNMVAEDTQVQRLIVNVPPKIESFAFPFD-GLPEGARTRV 125 S+L I++V A H+GN++C RN+ L V VPP+ P D +G+ +V Sbjct: 677 SVLTIEAVEASHAGNFTCHARNLAGHQQFTTPLNVYVPPRW--ILEPTDKAFAQGSDAKV 734 Query: 126 ICGVTHGDPPLTIRWLK 142 C G P + W K Sbjct: 735 ECK-ADGFPKPQVTWKK 750
>pdb|3DMK|A Chain A, Crystal Structure Of Down Syndrome Cell Adhesion Molecule (Dscam) Isoform 1.30.30, N-Terminal Eight Ig Domains Length = 816 Back     alignment and structure
>pdb|2RJM|A Chain A, 3ig Structure Of Titin Domains I67-I69 E-To-A Mutated Variant Length = 284 Back     alignment and structure
>pdb|3B43|A Chain A, I-band Fragment I65-i70 From Titin Length = 570 Back     alignment and structure
>pdb|2RIK|A Chain A, I-Band Fragment I67-I69 From Titin Length = 284 Back     alignment and structure
>pdb|3V6B|R Chain R, Vegfr-2VEGF-E Complex Structure Length = 424 Back     alignment and structure
>pdb|1QZ1|A Chain A, Crystal Structure Of The Ig 1-2-3 Fragment Of Ncam Length = 291 Back     alignment and structure
>pdb|3V2A|R Chain R, Vegfr-2VEGF-A Complex Structure Length = 772 Back     alignment and structure
>pdb|2OM5|A Chain A, N-Terminal Fragment Of Human Tax1 Length = 381 Back     alignment and structure
>pdb|2YD5|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Human Receptor Protein Tyrosine Phosphatase Lar Length = 214 Back     alignment and structure
>pdb|2YD6|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Human Receptor Protein Tyrosine Phosphatase Delta Length = 212 Back     alignment and structure
>pdb|2YD9|A Chain A, Crystal Structure Of The N-Terminal Ig1-3 Module Of Human Receptor Protein Tyrosine Phosphatase Sigma Length = 304 Back     alignment and structure
>pdb|1CS6|A Chain A, N-terminal Fragment Of Axonin-1 From Chicken Length = 382 Back     alignment and structure
>pdb|2YD3|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Human Receptor Protein Tyrosine Phosphatase Sigma Length = 202 Back     alignment and structure
>pdb|2YD2|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Human Receptor Protein Tyrosine Phosphatase Sigma Length = 214 Back     alignment and structure
>pdb|3PXH|A Chain A, Tandem Ig Domains Of Tyrosine Phosphatase Lar Length = 201 Back     alignment and structure
>pdb|2YD4|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Chicken Receptor Protein Tyrosine Phosphatase Sigma Length = 210 Back     alignment and structure
>pdb|2NPL|X Chain X, Nmr Structure Of Card D2 Domain Length = 96 Back     alignment and structure
>pdb|1NBQ|A Chain A, Crystal Structure Of Human Junctional Adhesion Molecule Type 1 Length = 209 Back     alignment and structure
>pdb|1NBQ|A Chain A, Crystal Structure Of Human Junctional Adhesion Molecule Type 1 Length = 209 Back     alignment and structure
>pdb|1EVT|C Chain C, Crystal Structure Of Fgf1 In Complex With The Extracellular Ligand Binding Domain Of Fgf Receptor 1 (Fgfr1) Length = 225 Back     alignment and structure
>pdb|1CVS|C Chain C, Crystal Structure Of A Dimeric Fgf2-Fgfr1 Complex Length = 225 Back     alignment and structure
>pdb|3OJV|C Chain C, Crystal Structure Of Fgf1 Complexed With The Ectodomain Of Fgfr1c Exhibiting An Ordered Ligand Specificity-Determining Betac'-Betae Loop Length = 226 Back     alignment and structure
>pdb|3JZ7|A Chain A, Crystal Structure Of The Extracellular Domains Of Coxsackie & Adenovirus Receptor From Mouse (Mcar) Length = 214 Back     alignment and structure
>pdb|3MJ7|B Chain B, Crystal Structure Of The Complex Of Jaml And Coxsackie And Adenovirus Receptor, Car Length = 225 Back     alignment and structure
>pdb|2VRA|A Chain A, Drosophila Robo Ig1-2 (Monoclinic Form) Length = 208 Back     alignment and structure
>pdb|2VR9|A Chain A, Drosophila Robo Ig1-2 (Tetragonal Form) Length = 217 Back     alignment and structure
>pdb|3PXJ|A Chain A, Tandem Ig Repeats Of Dlar Length = 210 Back     alignment and structure
>pdb|2V5R|A Chain A, Structural Basis For Dscam Isoform Specificity Length = 391 Back     alignment and structure
>pdb|1TNM|A Chain A, Tertiary Structure Of An Immunoglobulin-Like Domain From The Muscle Protein Titin: A New Member Of The I Set Length = 100 Back     alignment and structure
>pdb|1NCT|A Chain A, Titin Module M5, N-Terminally Extended, Nmr Length = 106 Back     alignment and structure
>pdb|3OJM|B Chain B, Crystal Structure Of Fgf1 Complexed With The Ectodomain Of Fgfr2b Harboring P253r Apert Mutation Length = 231 Back     alignment and structure
>pdb|2V5S|A Chain A, Structural Basis For Dscam Isoform Specificity Length = 394 Back     alignment and structure
>pdb|2V5M|A Chain A, Structural Basis For Dscam Isoform Specificity Length = 388 Back     alignment and structure
>pdb|3OJ2|C Chain C, Crystal Structure Of Fgf1 Complexed With The Ectodomain Of Fgfr2b Harboring The A172f Pfeiffer Syndrome Mutation Length = 231 Back     alignment and structure
>pdb|1F97|A Chain A, Soluble Part Of The Junction Adhesion Molecule From Mouse Length = 212 Back     alignment and structure
>pdb|2E6P|A Chain A, Solution Structure Of The Ig-Like Domain (714-804) From Human Obscurin-Like Protein 1 Length = 104 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 9e-45
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 1e-38
3b43_A 570 Titin; I-SET IG fold, extended poly-IG filament, e 1e-44
3b43_A 570 Titin; I-SET IG fold, extended poly-IG filament, e 9e-41
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 2e-40
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 3e-38
3b43_A 570 Titin; I-SET IG fold, extended poly-IG filament, e 2e-33
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 2e-43
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 4e-43
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 2e-33
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 3e-33
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 5e-28
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 5e-18
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 1e-16
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 4e-15
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 1e-41
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 5e-34
2ec8_A 524 MAST/stem cell growth factor receptor; glycoprotei 2e-29
2ec8_A 524 MAST/stem cell growth factor receptor; glycoprotei 6e-22
2ec8_A 524 MAST/stem cell growth factor receptor; glycoprotei 1e-13
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 3e-11
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 7e-40
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 2e-32
3qs9_E 527 FL cytokine receptor; immunoglobulin-like domain, 2e-27
3qs9_E 527 FL cytokine receptor; immunoglobulin-like domain, 9e-26
3qs9_E 527 FL cytokine receptor; immunoglobulin-like domain, 1e-14
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 2e-39
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 1e-26
3qs7_E 423 FL cytokine receptor; immunoglobulin-like domain, 8e-25
3qs7_E 423 FL cytokine receptor; immunoglobulin-like domain, 3e-17
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 5e-13
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 3e-39
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 5e-18
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 2e-38
3laf_A 403 Deleted in colorectal cancer; netrin-1 receptor, i 3e-25
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 2e-13
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 3e-37
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 5e-37
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 4e-28
1bih_A 395 Hemolin; insect immunity, LPS-binding, homophilic 4e-27
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 2e-09
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 6e-37
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 3e-34
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 1e-29
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 2e-28
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 3e-25
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 6e-18
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 5e-15
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 5e-05
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 1e-36
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 3e-31
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 4e-15
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 2e-36
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 6e-32
3p3y_A 404 Neurofascin; IG domains, cell adhesion; HET: NAG; 5e-24
3p3y_A 404 Neurofascin; IG domains, cell adhesion; HET: NAG; 1e-11
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 3e-36
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 3e-36
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 1e-17
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 2e-16
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 8e-36
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 8e-32
1qz1_A 291 Neural cell adhesion molecule 1, 140 kDa isoform; 5e-10
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 2e-35
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 4e-19
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 3e-35
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 9e-27
2v5m_A 388 Dscam; neurobiology SPL immunoglobulin domain, cel 1e-16
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 4e-35
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 3e-16
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 5e-35
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 9e-12
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 1e-34
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 2e-31
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 2e-10
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 2e-34
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 1e-32
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 1e-30
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 3e-29
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 8e-29
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 4e-19
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 1e-17
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 2e-34
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 1e-29
1cs6_A 382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 2e-25
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 9e-10
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 4e-34
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 8e-13
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 9e-34
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 5e-11
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 9e-34
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 4e-33
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 1e-16
2y25_A 317 Myomesin; structural protein, sarcomere, M-BAND, i 1e-15
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 1e-33
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 5e-16
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 2e-33
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 2e-15
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 6e-12
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 2e-33
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 3e-31
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 2e-09
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 3e-33
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 9e-31
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 2e-16
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 5e-33
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 4e-11
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 8e-33
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 1e-31
2yd9_A 304 Receptor-type tyrosine-protein phosphatase S; hydr 7e-15
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 4e-14
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 9e-33
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 1e-32
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 1e-15
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 1e-32
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 1e-16
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 2e-32
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 3e-17
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 2e-13
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 2e-32
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 1e-31
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 3e-32
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 4e-29
3kld_A 384 Contactin 4, axcam, BIG-2; cell adhesion, protein 2e-26
3kld_A 384 Contactin 4, axcam, BIG-2; cell adhesion, protein 2e-09
1nn8_R302 CD155 antigen, poliovirus receptor; icosahedral vi 4e-32
1nn8_R302 CD155 antigen, poliovirus receptor; icosahedral vi 4e-27
1nn8_R 302 CD155 antigen, poliovirus receptor; icosahedral vi 3e-04
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 5e-32
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 4e-19
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 9e-11
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 1e-31
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 2e-26
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 4e-31
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 6e-10
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 6e-31
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 3e-29
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 1e-17
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 9e-31
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 2e-12
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 3e-12
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 1e-30
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 1e-28
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 3e-06
2jll_A 389 NCAM2, neural cell adhesion molecule 2; immunoglob 2e-30
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 3e-14
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 4e-30
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 2e-10
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 6e-30
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 4e-13
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 7e-09
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 8e-30
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 1e-29
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 3e-12
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 5e-12
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 2e-29
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 2e-24
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 9e-11
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 2e-29
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 4e-23
2o26_X 290 MAST/stem cell growth factor receptor; stem cell f 2e-05
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 2e-28
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 8e-26
1itb_B 315 Type 1 interleukin-1 receptor; immunoglobulin fold 8e-13
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 5e-11
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 2e-27
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 5e-09
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 5e-27
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 1e-14
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 5e-27
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 7e-14
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 8e-26
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 2e-25
2ch8_A201 BARF1, P33, 33 kDa early protein; viral protein, i 7e-25
2ch8_A201 BARF1, P33, 33 kDa early protein; viral protein, i 3e-06
2ch8_A201 BARF1, P33, 33 kDa early protein; viral protein, i 2e-05
3mjg_X289 Beta-type platelet-derived growth factor receptor; 8e-25
3mjg_X289 Beta-type platelet-derived growth factor receptor; 3e-21
3mjg_X289 Beta-type platelet-derived growth factor receptor; 9e-14
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 2e-24
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 9e-10
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 3e-24
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 2e-12
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 9e-24
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 1e-23
4dep_C 349 Interleukin-1 receptor accessory protein; B-trefoi 1e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-23
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-08
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 4e-22
1z7z_I 450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 1e-17
1z7z_I 450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 4e-16
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 3e-15
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 4e-08
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 4e-22
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 2e-08
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 6e-22
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 7e-07
1wio_A 363 CD4, T-cell surface glycoprotein CD4; immunoglobul 6e-22
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 1e-19
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 9e-12
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 8e-22
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 5e-13
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 1e-05
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 1e-21
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 3e-14
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 7e-07
1wwb_X103 Protein (brain derived neurotrophic factor recepto 7e-21
1wwb_X103 Protein (brain derived neurotrophic factor recepto 1e-15
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 1e-20
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 4e-13
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 3e-20
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 3e-05
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 6e-19
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 6e-15
3shs_A304 HOC head outer capsid protein; immunoglobulin-like 7e-19
3shs_A304 HOC head outer capsid protein; immunoglobulin-like 1e-14
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 2e-18
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 1e-14
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 3e-18
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 2e-15
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 3e-18
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 1e-15
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 5e-18
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 6e-18
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 5e-12
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 6e-18
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 2e-13
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 8e-18
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 2e-13
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 1e-17
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 5e-14
2pet_A231 Lutheran blood group glycoprotein; immunoglobulin 1e-17
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 1e-17
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 4e-05
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 2e-17
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 3e-09
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 2e-17
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 2e-13
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 2e-17
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 1e-12
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 3e-17
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 6e-12
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 4e-17
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 3e-11
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 5e-17
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 2e-13
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 5e-17
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 6e-17
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 2e-16
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 2e-13
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 2e-16
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 2e-15
2fbo_J250 V1V2;, variable region-containing chitin-binding p 3e-16
2fbo_J250 V1V2;, variable region-containing chitin-binding p 2e-07
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 3e-16
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 5e-11
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 4e-16
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 5e-14
1he7_A126 High affinity nerve growth factor receptor; transf 5e-16
1he7_A126 High affinity nerve growth factor receptor; transf 2e-10
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 6e-16
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 3e-09
2ens_A96 Advanced glycosylation END product-specific recept 7e-16
2ens_A96 Advanced glycosylation END product-specific recept 1e-10
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 7e-16
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 1e-11
3eow_R221 Poliovirus receptor; immunoglobulin super family, 8e-16
3eow_R221 Poliovirus receptor; immunoglobulin super family, 8e-06
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 9e-16
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 3e-14
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 2e-15
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 9e-06
1gl4_B98 Basement membrane-specific heparan sulfate proteog 3e-15
1gl4_B98 Basement membrane-specific heparan sulfate proteog 4e-14
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 4e-15
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 9e-12
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 1e-14
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 1e-05
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 1e-14
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 8e-14
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 1e-14
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 2e-10
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 1e-14
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 2e-14
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 2e-14
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 2e-10
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 4e-14
2ocw_A 585 Polymeric-immunoglobulin receptor; SC, secretory, 2e-13
2ocw_A 585 Polymeric-immunoglobulin receptor; SC, secretory, 7e-10
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 3e-08
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 5e-14
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 4e-13
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 7e-14
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 2e-06
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 3e-13
2eo1_A102 OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 5e-13
2eo1_A102 OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 1e-10
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 6e-13
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 6e-09
1waa_A93 Titin; metal binding protein, calmodulin-binding, 1e-12
1waa_A93 Titin; metal binding protein, calmodulin-binding, 1e-09
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 1e-12
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 9e-05
1mq8_A291 ICAM-1, intercellular adhesion molecule-1, CD54 an 2e-12
1mq8_A291 ICAM-1, intercellular adhesion molecule-1, CD54 an 1e-11
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 2e-12
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 3e-12
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 2e-12
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 4e-11
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 2e-12
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 4e-12
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 2e-12
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 7e-06
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 2e-04
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 3e-12
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 4e-12
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 4e-12
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 4e-09
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 4e-12
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 2e-10
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 4e-12
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 5e-09
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 4e-12
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 4e-11
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 5e-12
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 2e-11
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 1e-11
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 7e-09
2v9t_A117 Roundabout homolog 1; structural protein-receptor 1e-11
2v9t_A117 Roundabout homolog 1; structural protein-receptor 2e-09
1b6u_A257 KIR2DL3, P58 killer cell inhibitory receptor; natu 2e-11
3s35_X122 Vascular endothelial growth factor receptor 2; ant 2e-11
3s35_X122 Vascular endothelial growth factor receptor 2; ant 6e-10
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 2e-11
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 6e-09
3bn3_B196 ICAM-5, intercellular adhesion molecule 5, telence 2e-11
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 3e-11
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 3e-11
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 3e-10
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 4e-11
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 4e-04
2zg1_A214 Sialic acid-binding IG-like lectin 5; siglec-5 inh 6e-11
2zg1_A214 Sialic acid-binding IG-like lectin 5; siglec-5 inh 5e-04
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 6e-11
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 1e-10
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 7e-11
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 5e-08
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 1e-10
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 9e-10
1ugn_A198 LIR1, leukocyte immunoglobulin-like receptor 1; im 1e-10
1nkr_A201 P58-CL42 KIR; inhibitory receptor, natural killer 1e-10
1nkr_A201 P58-CL42 KIR; inhibitory receptor, natural killer 1e-04
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 2e-10
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 8e-10
1gsm_A210 Madcam-1, mucosal addressin cell adhesion molecule 2e-10
1gsm_A210 Madcam-1, mucosal addressin cell adhesion molecule 2e-07
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 3e-10
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 6e-10
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 5e-10
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 7e-08
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 5e-10
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 3e-05
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 6e-10
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 2e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-08
3p2t_A196 Leukocyte immunoglobulin-like receptor subfamily 4 1e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-07
2wng_A327 Tyrosine-protein phosphatase non-receptor type sub 2e-09
2wng_A327 Tyrosine-protein phosphatase non-receptor type sub 4e-05
3so5_A112 LIG-3, leucine-rich repeats and immunoglobulin-lik 5e-09
3so5_A112 LIG-3, leucine-rich repeats and immunoglobulin-lik 8e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-08
1p6f_A242 NKP46, natural cytotoxicity triggering receptor 1; 5e-09
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 8e-09
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 8e-09
2wqr_A323 IG epsilon chain C region; immune system, immunogl 1e-08
2wqr_A323 IG epsilon chain C region; immune system, immunogl 3e-04
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 2e-08
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 2e-07
2d3v_A196 Leukocyte immunoglobulin-like receptor subfamily A 2e-08
1oll_A188 NK receptor; immune system/receptor, NK cell trigg 2e-08
3rbg_A124 Cytotoxic and regulatory T-cell molecule; IGV, crt 2e-08
3rbg_A124 Cytotoxic and regulatory T-cell molecule; IGV, crt 4e-04
1igy_B434 IGG1 intact antibody MAB61.1.3; intact immunoglobu 3e-08
1igy_B434 IGG1 intact antibody MAB61.1.3; intact immunoglobu 2e-05
3pv7_A248 B7-H6, IG-like domain-containing protein DKFZP686O 3e-08
3pv7_A248 B7-H6, IG-like domain-containing protein DKFZP686O 6e-04
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 4e-08
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 4e-04
1ow0_A214 IG alpha-1 chain C region; IGA1, fcari, CD89, anti 7e-08
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 9e-08
1n26_A 325 IL-6 receptor alpha chain; transmembrane, glycopro 5e-07
1zxq_A192 ICAM-2, intercellular adhesion molecule-2; immunog 1e-07
1iam_A185 ICAM-1, CD54, intercellular adhesion molecule-1; r 1e-07
1igt_B444 IGG2A intact antibody - MAB231; intact immunoglobu 2e-07
1igt_B444 IGG2A intact antibody - MAB231; intact immunoglobu 1e-04
2gi7_A184 GPVI protein; IG-like domains, blood clotting, cel 2e-07
3m45_A108 Cell adhesion molecule 2; IG fold, dimer, disulfid 3e-07
2vol_A207 Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, 6e-07
2rgs_A218 I, IG gamma-2B heavy chain; FC-fragment, immunoglo 1e-06
2w59_A231 IGY FCU3-4; immunoglobulin, avian, immune system; 3e-06
2rcj_C523 Light chain; immunoglobulin M, polymeric antibodie 4e-06
2rcj_C523 Light chain; immunoglobulin M, polymeric antibodie 2e-04
3f8u_B401 Tapasin; endoplasmic reticulum, glycoprotein, immu 8e-06
1i1c_A239 IGG2A, IG gamma-2A chain C region; FC, immune syst 8e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
1hzh_H457 IGG, immunoglobulin heavy chain; antibody, immune 4e-05
1hzh_H457 IGG, immunoglobulin heavy chain; antibody, immune 4e-04
4acp_A240 IG gamma-1 chain C region; immune system, antibody 4e-05
1l6x_A207 Immunoglobulin gamma-1 heavy chain constant regio; 6e-05
1z9m_A145 GAPA225; nectin-like, IG-like domain, V domain, ce 6e-05
1iga_A475 IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg 9e-05
3q0h_A117 T cell immunoreceptor with IG and ITIM domains; im 1e-04
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 1e-04
2edn_A118 Myosin-binding protein C, fast-type; beta-sandwich 5e-04
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
 Score =  150 bits (381), Expect = 9e-45
 Identities = 53/191 (27%), Positives = 86/191 (45%), Gaps = 4/191 (2%)

Query: 8   VPPKLSPTNPERTLNVGERASLICSITKGDIPLTIKWLKDGRYLDNSAALSITHVDQYNS 67
            PP          L +GE  +  C +T G  P+ I W KD R +       +T V+   +
Sbjct: 4   APPFFDLKPVSVDLALGESGTFKCHVT-GTAPIKITWAKDNREIRPGGNYKMTLVE-NTA 61

Query: 68  MLVIDSVSARHSGNYSCTVRNMVAEDTQVQRLIVNVPPKIESFAFPFDGLPEGARTRVIC 127
            L +  V+   +G Y+C   N+  +D+   +L V  PP+      P   + +   TR  C
Sbjct: 62  TLTVLKVTKGDAGQYTCYASNVAGKDSCSAQLGVQEPPRFIKKLEPSRIVKQDEHTRYEC 121

Query: 128 GVTHGDPPLTIRWLKDGKPLSPRFPVNVSDLDSFSSLLSINSVSAAHSGEYTCVASNTAA 187
            +  G P + + W KD   +       +S ++S + L  + ++S   SG+YTC A N A 
Sbjct: 122 KIG-GSPEIKVLWYKDETEIQESSKFRMSFVESVAVLE-MYNLSVEDSGDYTCEAHNAAG 179

Query: 188 QARYSSKLQVK 198
            A  S+ L+VK
Sbjct: 180 SASSSTSLKVK 190


>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 Back     alignment and structure
>1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 Back     alignment and structure
>1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 Back     alignment and structure
>2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 Back     alignment and structure
>2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 Back     alignment and structure
>2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Length = 231 Back     alignment and structure
>3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Length = 202 Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Length = 222 Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Length = 222 Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Length = 186 Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Length = 186 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Length = 193 Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Length = 193 Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Length = 226 Back     alignment and structure
>2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 104 Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 104 Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 Back     alignment and structure
>1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Length = 291 Back     alignment and structure
>1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Length = 291 Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Length = 218 Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Length = 218 Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Length = 218 Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Length = 316 Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Length = 316 Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 Back     alignment and structure
>1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 257 Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>3bn3_B ICAM-5, intercellular adhesion molecule 5, telencephalin; I domain, integrin, allosteric mobility, cell adhesi immune system; HET: NAG; 2.10A {Homo sapiens} Length = 196 Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Length = 201 Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Length = 180 Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Length = 180 Back     alignment and structure
>2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A Length = 214 Back     alignment and structure
>2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A Length = 214 Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Length = 198 Back     alignment and structure
>1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A Length = 201 Back     alignment and structure
>1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A Length = 201 Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 Back     alignment and structure
>1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* Length = 210 Back     alignment and structure
>1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* Length = 210 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Length = 196 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Length = 327 Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Length = 327 Back     alignment and structure
>3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Length = 112 Back     alignment and structure
>3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Length = 112 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 242 Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 Back     alignment and structure
>2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A Length = 323 Back     alignment and structure
>2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A Length = 323 Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Length = 196 Back     alignment and structure
>1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 188 Back     alignment and structure
>3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Length = 124 Back     alignment and structure
>3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Length = 124 Back     alignment and structure
>1igy_B IGG1 intact antibody MAB61.1.3; intact immunoglobulin, V region, C region, hinge region, immunoglobulin; HET: NAG FUL NDG BMA MAN GAL FUC; 3.20A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Length = 434 Back     alignment and structure
>1igy_B IGG1 intact antibody MAB61.1.3; intact immunoglobulin, V region, C region, hinge region, immunoglobulin; HET: NAG FUL NDG BMA MAN GAL FUC; 3.20A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Length = 434 Back     alignment and structure
>3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* Length = 248 Back     alignment and structure
>3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* Length = 248 Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Length = 171 Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Length = 171 Back     alignment and structure
>1ow0_A IG alpha-1 chain C region; IGA1, fcari, CD89, antibody, immunoglobulin-LIK immune system; HET: NAG FUL BMA GAL SIA FUC MAN NDG; 3.10A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2qej_A* Length = 214 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>1zxq_A ICAM-2, intercellular adhesion molecule-2; immunoglobulin fold, cell adhesion, glycoprotein, transmembr; HET: NAG; 2.20A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Length = 192 Back     alignment and structure
>1iam_A ICAM-1, CD54, intercellular adhesion molecule-1; rhinovirus receptor, cell adhesion, integrin ligand, glycopr LFA-1 ligand, immunoglobulin fold; HET: NAG; 2.10A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ic1_A* 1d3l_A 1d3e_I 1d3i_I 3tcx_A Length = 185 Back     alignment and structure
>1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Length = 444 Back     alignment and structure
>1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Length = 444 Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Length = 184 Back     alignment and structure
>3m45_A Cell adhesion molecule 2; IG fold, dimer, disulfide bond, glycoprotein, immunoglobulin membrane, transmembrane; HET: NAG; 2.21A {Mus musculus} Length = 108 Back     alignment and structure
>2vol_A Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, cytoplasm, mouse IGG, zinc-finger, DNA-binding, RNA-binding, tripartite motif (TRIM) protein; HET: NAG MAN GAL FUC; 1.95A {Mus musculus} PDB: 3hkf_A 1i1a_C* 1cqk_A Length = 207 Back     alignment and structure
>2rgs_A I, IG gamma-2B heavy chain; FC-fragment, immunoglobulin, glycosylation, immune system; HET: NAG FUC MAN GAL; 2.13A {Mus musculus} Length = 218 Back     alignment and structure
>2w59_A IGY FCU3-4; immunoglobulin, avian, immune system; HET: NAG MAN; 1.75A {Gallus gallus} Length = 231 Back     alignment and structure
>2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Length = 523 Back     alignment and structure
>2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Length = 523 Back     alignment and structure
>3f8u_B Tapasin; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} Length = 401 Back     alignment and structure
>1i1c_A IGG2A, IG gamma-2A chain C region; FC, immune system; HET: NAG FUL BMA MAN FUC; 2.70A {Rattus norvegicus} SCOP: b.1.1.2 b.1.1.2 PDB: 1i1a_D* Length = 239 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1hzh_H IGG, immunoglobulin heavy chain; antibody, immune system; HET: NAG BMA MAN GAL FUC; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 PDB: 2ig2_H 1mco_H* Length = 457 Back     alignment and structure
>1hzh_H IGG, immunoglobulin heavy chain; antibody, immune system; HET: NAG BMA MAN GAL FUC; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 PDB: 2ig2_H 1mco_H* Length = 457 Back     alignment and structure
>4acp_A IG gamma-1 chain C region; immune system, antibody, kifunensine; HET: NAG; 2.49A {Homo sapiens} PDB: 2j6e_A* Length = 240 Back     alignment and structure
>1l6x_A Immunoglobulin gamma-1 heavy chain constant regio; IGG1 FC, FC complex, immune system; HET: NAG BMA MAN GAL FUL; 1.65A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2iwg_A* 3v7m_A* 3d6g_A* 3agv_A* 1oqo_A* 1oqx_A* 3v95_A* 2wah_A* 3sgj_A* 3sgk_A* 2dtq_A* 2dts_A* 3ave_A* 3ay4_A* 3do3_A* 2gj7_A* 1t83_A* 1t89_A* 1dn2_A* 3dnk_A ... Length = 207 Back     alignment and structure
>1z9m_A GAPA225; nectin-like, IG-like domain, V domain, cell adhesion; 2.40A {Homo sapiens} Length = 145 Back     alignment and structure
>1iga_A IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg_A 2qtj_A 3chn_A 1r70_B 3cm9_A Length = 475 Back     alignment and structure
>3q0h_A T cell immunoreceptor with IG and ITIM domains; immune receptor, adhesion, structural genomics, NEW YORK STR genomics research consortium, nysgrc; 1.70A {Homo sapiens} PDB: 3rq3_A 3udw_A* 3ucr_A Length = 117 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query243
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 100.0
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 100.0
3b43_A 570 Titin; I-SET IG fold, extended poly-IG filament, e 100.0
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 99.98
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 99.97
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 99.97
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 99.97
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 99.97
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 99.97
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 99.97
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 99.97
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 99.97
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 99.97
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 99.97
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 99.97
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 99.97
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 99.97
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 99.97
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 99.96
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 99.96
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 99.96
2jll_A 389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.96
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 99.96
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 99.96
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 99.96
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 99.96
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 99.96
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 99.96
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 99.96
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 99.96
4fa8_A203 Secreted protein BARF1; immunoglobulin-like domain 99.96
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 99.96
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 99.96
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 99.96
2wng_A327 Tyrosine-protein phosphatase non-receptor type sub 99.96
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 99.96
3qs7_E 423 FL cytokine receptor; immunoglobulin-like domain, 99.96
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 99.96
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 99.96
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 99.96
2ec8_A 524 MAST/stem cell growth factor receptor; glycoprotei 99.96
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 99.95
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 99.95
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 99.95
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 99.95
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 99.95
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 99.95
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 99.95
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 99.95
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 99.95
2rcj_C 523 Light chain; immunoglobulin M, polymeric antibodie 99.95
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 99.95
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 99.95
4fom_A308 Poliovirus receptor-related protein 3; immunoglobu 99.95
1bih_A 395 Hemolin; insect immunity, LPS-binding, homophilic 99.95
2rcj_C523 Light chain; immunoglobulin M, polymeric antibodie 99.95
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 99.95
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 99.95
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 99.95
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 99.95
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 99.95
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 99.95
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 99.95
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 99.95
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 99.95
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 99.95
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 99.95
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 99.95
3p2t_A196 Leukocyte immunoglobulin-like receptor subfamily 4 99.95
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 99.95
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 99.95
4fqp_A313 Poliovirus receptor; immunoglobulin-like domain, I 99.95
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 99.94
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 99.94
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 99.94
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 99.94
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.94
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 99.94
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 99.94
2ocw_A 585 Polymeric-immunoglobulin receptor; SC, secretory, 99.94
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 99.94
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 99.94
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 99.94
1z7z_I 450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 99.94
1ugn_A198 LIR1, leukocyte immunoglobulin-like receptor 1; im 99.94
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 99.94
2d3v_A196 Leukocyte immunoglobulin-like receptor subfamily A 99.94
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 99.94
4fom_A308 Poliovirus receptor-related protein 3; immunoglobu 99.94
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 99.94
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 99.94
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 99.94
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 99.94
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 99.94
1wio_A 363 CD4, T-cell surface glycoprotein CD4; immunoglobul 99.94
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 99.94
4fqp_A313 Poliovirus receptor; immunoglobulin-like domain, I 99.94
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 99.94
2gi7_A184 GPVI protein; IG-like domains, blood clotting, cel 99.94
1qgc_4438 Protein (immunoglobulin); virus-antibody complex, 99.94
1z7z_I 450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 99.94
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 99.94
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 99.93
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 99.93
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 99.93
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 99.93
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 99.93
1za6_B344 IGG heavy chain; immunoglobulin fold, CH2-domain-d 99.93
3mj8_L213 Stimulatory hamster antibody HL4E10 FAB light CHA; 99.93
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 99.93
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 99.93
1nkr_A201 P58-CL42 KIR; inhibitory receptor, natural killer 99.93
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 99.93
3qs9_E 527 FL cytokine receptor; immunoglobulin-like domain, 99.93
1oll_A188 NK receptor; immune system/receptor, NK cell trigg 99.93
4frw_A218 Poliovirus receptor-related protein 4; immunoglobu 99.93
2fbo_J250 V1V2;, variable region-containing chitin-binding p 99.93
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 99.93
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 99.93
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 99.93
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 99.93
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 99.92
1qgc_4 438 Protein (immunoglobulin); virus-antibody complex, 99.92
2wqr_A323 IG epsilon chain C region; immune system, immunogl 99.92
1igt_B444 IGG2A intact antibody - MAB231; intact immunoglobu 99.92
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 99.92
1b6u_A257 KIR2DL3, P58 killer cell inhibitory receptor; natu 99.92
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 99.92
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 99.92
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 99.92
2pet_A231 Lutheran blood group glycoprotein; immunoglobulin 99.91
3tv3_L211 PGT128 light chain, IG lambda-2 chain C regions; F 99.91
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 99.91
4i0k_A222 CD276 antigen; immunoglobulin domain, glycoprotein 99.91
1p6f_A242 NKP46, natural cytotoxicity triggering receptor 1; 99.91
3s96_B218 3B5H10 FAB light chain; huntingtin, immune system; 99.91
3d9a_L213 Light chain of hyhel10 antibody fragment (FAB); ly 99.91
1lk3_L210 9D7 light chain; antigen-antibody complex, immune 99.91
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 99.91
3nl4_L213 Antigen binding fragment, immunoglobulin IGG - LI; 99.91
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 99.91
3eow_R221 Poliovirus receptor; immunoglobulin super family, 99.9
1hzh_H 457 IGG, immunoglobulin heavy chain; antibody, immune 99.9
3mjg_X289 Beta-type platelet-derived growth factor receptor; 99.9
2zg1_A214 Sialic acid-binding IG-like lectin 5; siglec-5 inh 99.9
3pv7_A248 B7-H6, IG-like domain-containing protein DKFZP686O 99.9
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 99.9
1q0x_L212 FAB 9B1, light chain; anti-morphine antibody, FAB 99.9
2c1o_A254 IGK-C protein; FAB fragment, enantioselective, fin 99.9
1igt_B 444 IGG2A intact antibody - MAB231; intact immunoglobu 99.9
2xzc_L216 FAB A.17 light chain; immune system; HET: XOP; 1.3 99.9
2j6e_L234 IGM, FAB light chain; autoimmune complex human IGM 99.9
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 99.9
1hzh_H457 IGG, immunoglobulin heavy chain; antibody, immune 99.89
1c1e_H219 Catalytic antibody 1E9 (heavy chain); diels-alder, 99.89
3sob_L237 Antibody light chain; beta propeller, protein bind 99.89
3r06_A213 Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; 99.89
1iga_A475 IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg 99.89
2ghw_B247 Anti-SARS SCFV antibody, 80R; S protein, neutraliz 99.89
1f3r_B257 FV antibody fragment; IG-fold, immuno complex, ant 99.89
1igy_B 434 IGG1 intact antibody MAB61.1.3; intact immunoglobu 99.89
2wng_A327 Tyrosine-protein phosphatase non-receptor type sub 99.89
1nfd_E212 H57 FAB; complex (immunoreceptor-immunoglobulin), 99.89
4fmk_A225 Poliovirus receptor-related protein 2; immunoglobu 99.89
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 99.89
1nqb_A256 Single-chain antibody fragment; multivalent antibo 99.89
1igy_B434 IGG1 intact antibody MAB61.1.3; intact immunoglobu 99.89
3mjg_X289 Beta-type platelet-derived growth factor receptor; 99.89
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 99.89
2p1y_A238 Bispecific alpha/beta TCR; autoimmunity, immunoglo 99.89
4dzb_B246 Vbeta2 (MAIT T cell receptor); immune system; 1.70 99.88
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 99.88
3tf7_C256 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; 99.88
1q9r_B222 S25-2 FAB (IGG1K) heavy chain; antigen-binding fra 99.88
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 99.88
3d9a_H210 Heavy chain of hyhel10 antibody fragment (FAB); ly 99.88
3bkj_L252 WO2 IGG2A FAB fragment light chain kappa; abeta, F 99.88
3esu_F250 Antibody 14B7* light chain and antibody 14B7* heav 99.88
3auv_A276 SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid 99.88
2rgs_A218 I, IG gamma-2B heavy chain; FC-fragment, immunoglo 99.87
3pl6_D268 MBP peptide / T-cell receptor beta chain chimera; 99.87
1moe_A240 Anti-CEA MAB T84.66; anti carcinoembryonic antigen 99.87
3uzq_A253 Anti-dengue MAB 4E11; dengue antibody neutralizati 99.87
3juy_B256 3B3 single chain variant HIV-1 antibody; envelope 99.87
1hxm_B242 Gamma-delta T-cell receptor; IG domain, TCR, GDTCR 99.87
3nl4_H215 Antigen binding fragment,immunoglobulin IGG - HEA; 99.87
1gsm_A210 Madcam-1, mucosal addressin cell adhesion molecule 99.87
1dee_B223 IGM RF 2A2; FAB-IBP complex 2.7A resolution bindin 99.87
3umt_A256 SCFV heavy chain and light chain; stability engine 99.87
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 99.87
1pz5_B220 Heavy chain of FAB (SYA/J6); antibody-antigen stru 99.87
3nfj_J245 T cell receptor beta chain; immunoglobulin family, 99.87
1mju_H227 Immunoglobulin MS6-12; catalytic antibody, ester h 99.87
2znx_A242 SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s 99.87
3bqu_C233 3H6 FAB light chain; beta sheet, immune system; 3. 99.87
2vol_A207 Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, 99.86
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 99.86
3ux9_B256 SCFV antibody; five helices, long loop connecting 99.86
1svz_A247 Immunoglobulin;, single-chain FV fragment 1696; an 99.86
3gkz_A257 Anti-methamphetamine single chain FV; therapeutic 99.86
1qok_A282 MFE-23 recombinant antibody fragment; immunoglobul 99.86
4ei6_B245 Vbeta16 XV19 type II natural killer T cell recept 99.86
1op3_H225 FAB 2G12, heavy chain; domain-swapped FAB 2G12, an 99.86
2gjj_A264 A21 single-chain antibody fragment against ERBB2; 99.86
3q5y_A240 TCR N15 beta; IG, T cell receptor, antigen peptide 99.86
2fbj_H220 IGA-kappa J539 FAB (heavy chain); immunoglobulin; 99.86
3bae_H228 WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO 99.86
1dn0_B232 IGM-kappa cold agglutinin (heavy chain); FAB, anti 99.85
1zvo_C512 Myeloma immunoglobulin D delta; immunoglobulin fol 99.85
2wqr_A323 IG epsilon chain C region; immune system, immunogl 99.85
3qib_D270 2B4 beta chain; IG domain, immune system; HET: NAG 99.85
1iga_A 475 IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg 99.85
3o3u_N581 Maltose-binding periplasmic protein, advanced Gly 99.85
3omz_A259 Human vdelta1 gamma delta T cell receptor delta1A; 99.85
2wbj_D279 OB TCR; transmembrane, immune response, T cell rec 99.84
1x9q_A268 SCFV, 4M5.3 anti-fluorescein single chain antibody 99.84
2w59_A231 IGY FCU3-4; immunoglobulin, avian, immune system; 99.84
1c5d_H215 Monoclonal antibody against the main immunogenic t 99.84
3m8o_H221 Immunoglobulin A1 heavy chain; immunoglobulin fold 99.84
3fku_X280 Neutralizing antibody F10; influenza, hemagglutini 99.84
1i1c_A239 IGG2A, IG gamma-2A chain C region; FC, immune syst 99.84
1l6x_A207 Immunoglobulin gamma-1 heavy chain constant regio; 99.83
2xqy_G261 A13-D6.3 monoclonal antibody, envelope glycoprotei 99.83
3liz_H253 4C3 monoclonal antibody heavy chain; hydrolase-imm 99.83
2gki_A291 Nuclease; anti-DNA antibody, catalytic antibody, i 99.83
1bec_A238 14.3.D T cell antigen receptor; T cell receptor; 1 99.82
1zvo_C 512 Myeloma immunoglobulin D delta; immunoglobulin fol 99.82
1mq8_A291 ICAM-1, intercellular adhesion molecule-1, CD54 an 99.82
3bn9_D257 E2 FAB heavy chain; antibody-protease complex, pro 99.82
1oga_E252 TRBC1, T-cell receptor beta chain C region; immune 99.81
3shs_A304 HOC head outer capsid protein; immunoglobulin-like 99.81
3knb_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, AT 99.81
1ypz_F230 T-cell receptor gamma chain, beta-2-microglobulin; 99.81
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.8
1za6_B344 IGG heavy chain; immunoglobulin fold, CH2-domain-d 99.8
3to4_D253 NKT vbeta2 (mouse variable domain, human constant; 99.79
3u2s_H248 PG9 heavy chain; greek KEY, immunoglobulin, immune 99.78
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 99.78
3qhz_H232 Human monoclonal antibody DEL2D1, FAB heavy chain; 99.78
3tv3_H239 PGT128 heavy chain, IG gamma-1 chain C region; FAB 99.77
3knb_A100 Titin; IG-like, titin, OBSL1, ATP-binding, calmodu 99.77
1ow0_A214 IG alpha-1 chain C region; IGA1, fcari, CD89, anti 99.76
4acp_A240 IG gamma-1 chain C region; immune system, antibody 99.76
3n9g_H230 FAB fragment of MAB CR4354, heavy chain; human neu 99.76
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 99.76
1mq8_A291 ICAM-1, intercellular adhesion molecule-1, CD54 an 99.76
1iam_A185 ICAM-1, CD54, intercellular adhesion molecule-1; r 99.75
2aty_A376 Complement receptor chimeric conjugate CR2-IG; imm 99.75
3knb_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, AT 99.75
2c1o_A254 IGK-C protein; FAB fragment, enantioselective, fin 99.74
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 99.74
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 99.73
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 99.73
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 99.72
3sob_H256 Antibody heavy chain, low-density lipoprotein rece 99.72
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 99.72
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 99.72
3knb_A100 Titin; IG-like, titin, OBSL1, ATP-binding, calmodu 99.72
3mlr_H226 Human monoclonal anti-HIV-1 GP120 V3 antibody 255 99.71
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 99.71
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 99.71
3iu4_H263 CHP3 FAB heavy chain; antibody, ganglioside, idiot 99.71
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 99.71
1ypz_E207 T cell receptor delta, beta-2-microglobulin; H2-T2 99.7
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 99.7
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 99.7
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 99.7
1wwb_X103 Protein (brain derived neurotrophic factor recepto 99.69
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 99.69
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 99.69
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 99.68
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 99.68
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 99.68
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 99.68
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 99.68
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 99.67
3f8u_B401 Tapasin; endoplasmic reticulum, glycoprotein, immu 99.67
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 99.67
3bn3_B196 ICAM-5, intercellular adhesion molecule 5, telence 99.67
1waa_A93 Titin; metal binding protein, calmodulin-binding, 99.67
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 99.67
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 99.67
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 99.66
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 99.66
1he7_A126 High affinity nerve growth factor receptor; transf 99.66
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 99.65
1wwb_X103 Protein (brain derived neurotrophic factor recepto 99.65
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 99.65
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 99.65
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 99.65
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 99.65
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 99.64
2lu7_A84 Obscurin-like protein 1; structural genomics, nort 99.64
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 99.64
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 99.64
1he7_A126 High affinity nerve growth factor receptor; transf 99.64
4fa8_A203 Secreted protein BARF1; immunoglobulin-like domain 99.64
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 99.64
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 99.64
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 99.64
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 99.63
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 99.63
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 99.63
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 99.63
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 99.62
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 99.62
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 99.62
1hxm_A229 Gamma-delta T-cell receptor; IG domain, TCR, GDTCR 99.62
3m45_A108 Cell adhesion molecule 2; IG fold, dimer, disulfid 99.62
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 99.62
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 99.62
3u1s_H267 FAB PGT145 heavy chain; IGG, broadly neutralizing 99.62
2lvc_A91 Obscurin-like protein 1; structural genomics, nort 99.62
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 99.62
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 99.61
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 99.61
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 99.61
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 99.61
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 99.61
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 99.61
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 99.61
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 99.61
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 99.61
2edn_A118 Myosin-binding protein C, fast-type; beta-sandwich 99.6
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 99.6
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 99.6
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 99.6
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 99.6
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 99.59
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 99.59
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 99.59
1zxq_A192 ICAM-2, intercellular adhesion molecule-2; immunog 99.59
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 99.59
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 99.59
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 99.59
3so5_A112 LIG-3, leucine-rich repeats and immunoglobulin-lik 99.59
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 99.58
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 99.58
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 99.58
3p2t_A196 Leukocyte immunoglobulin-like receptor subfamily 4 99.58
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 99.58
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 99.57
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 99.57
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 99.57
2d3v_A196 Leukocyte immunoglobulin-like receptor subfamily A 99.57
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 99.57
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 99.57
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 99.57
2gi7_A184 GPVI protein; IG-like domains, blood clotting, cel 99.57
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 99.57
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 99.57
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 99.56
2lu7_A84 Obscurin-like protein 1; structural genomics, nort 99.56
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 99.56
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 99.56
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 99.56
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 99.56
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 99.56
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 99.56
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 99.55
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 99.55
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 99.55
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 99.55
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 99.55
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 99.55
2e6q_A112 Obscurin-like protein 1; IG-like domain, structura 99.55
3mj8_L213 Stimulatory hamster antibody HL4E10 FAB light CHA; 99.55
4hwu_A95 Fibroblast growth factor receptor 2; FGFR2, KGFR, 99.55
3qib_D270 2B4 beta chain; IG domain, immune system; HET: NAG 99.55
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 99.55
1gsm_A210 Madcam-1, mucosal addressin cell adhesion molecule 99.54
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 99.54
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 99.54
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.54
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 99.54
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 99.53
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 99.53
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 99.53
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 99.53
3rbg_A124 Cytotoxic and regulatory T-cell molecule; IGV, crt 99.53
1gl4_B98 Basement membrane-specific heparan sulfate proteog 99.53
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 99.52
3s35_X122 Vascular endothelial growth factor receptor 2; ant 99.52
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 99.52
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.52
1waa_A93 Titin; metal binding protein, calmodulin-binding, 99.52
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 99.52
3nl4_L213 Antigen binding fragment, immunoglobulin IGG - LI; 99.52
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 99.51
1z9m_A145 GAPA225; nectin-like, IG-like domain, V domain, ce 99.51
3s35_X122 Vascular endothelial growth factor receptor 2; ant 99.51
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 99.51
2ens_A96 Advanced glycosylation END product-specific recept 99.51
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 99.5
2lvc_A91 Obscurin-like protein 1; structural genomics, nort 99.5
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 99.5
1gl4_B98 Basement membrane-specific heparan sulfate proteog 99.5
3tv3_L211 PGT128 light chain, IG lambda-2 chain C regions; F 99.5
1nkr_A201 P58-CL42 KIR; inhibitory receptor, natural killer 99.5
1oll_A188 NK receptor; immune system/receptor, NK cell trigg 99.5
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 99.49
2edn_A118 Myosin-binding protein C, fast-type; beta-sandwich 99.49
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 99.49
2eo1_A102 OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 99.49
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 99.49
3m45_A108 Cell adhesion molecule 2; IG fold, dimer, disulfid 99.49
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 99.49
3d9a_L213 Light chain of hyhel10 antibody fragment (FAB); ly 99.48
3so5_A112 LIG-3, leucine-rich repeats and immunoglobulin-lik 99.48
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 99.48
1ugn_A198 LIR1, leukocyte immunoglobulin-like receptor 1; im 99.48
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 99.48
1lk3_L210 9D7 light chain; antigen-antibody complex, immune 99.47
4acp_A240 IG gamma-1 chain C region; immune system, antibody 99.47
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 99.47
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 99.47
3pv7_A248 B7-H6, IG-like domain-containing protein DKFZP686O 99.47
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 99.47
3r06_A213 Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; 99.46
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 99.46
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 99.46
2v9t_A117 Roundabout homolog 1; structural protein-receptor 99.46
2rgs_A218 I, IG gamma-2B heavy chain; FC-fragment, immunoglo 99.46
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 99.45
3s96_B218 3B5H10 FAB light chain; huntingtin, immune system; 99.45
2vol_A207 Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, 99.45
4hwu_A95 Fibroblast growth factor receptor 2; FGFR2, KGFR, 99.45
4dzb_B246 Vbeta2 (MAIT T cell receptor); immune system; 1.70 99.45
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 99.45
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 99.45
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 99.44
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 99.44
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 99.44
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 99.44
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 99.43
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 99.42
2j6e_L234 IGM, FAB light chain; autoimmune complex human IGM 99.42
3nfj_J245 T cell receptor beta chain; immunoglobulin family, 99.42
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 99.41
3sob_L237 Antibody light chain; beta propeller, protein bind 99.41
1q0x_L212 FAB 9B1, light chain; anti-morphine antibody, FAB 99.41
2xzc_L216 FAB A.17 light chain; immune system; HET: XOP; 1.3 99.41
1ntl_A551 CRRY-IG; immunology, complement, glycoprotein, SCR 99.41
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 99.41
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 99.41
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 99.41
1p6f_A242 NKP46, natural cytotoxicity triggering receptor 1; 99.41
2pet_A231 Lutheran blood group glycoprotein; immunoglobulin 99.4
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 99.4
2fbo_J250 V1V2;, variable region-containing chitin-binding p 99.4
2ens_A96 Advanced glycosylation END product-specific recept 99.4
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 99.4
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 99.4
2w59_A231 IGY FCU3-4; immunoglobulin, avian, immune system; 99.4
3rbg_A124 Cytotoxic and regulatory T-cell molecule; IGV, crt 99.4
1z9m_A145 GAPA225; nectin-like, IG-like domain, V domain, ce 99.39
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 99.39
3bkj_L252 WO2 IGG2A FAB fragment light chain kappa; abeta, F 99.39
1b6u_A257 KIR2DL3, P58 killer cell inhibitory receptor; natu 99.38
3eow_R221 Poliovirus receptor; immunoglobulin super family, 99.38
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 99.38
1nfd_E212 H57 FAB; complex (immunoreceptor-immunoglobulin), 99.38
3esu_F250 Antibody 14B7* light chain and antibody 14B7* heav 99.38
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 99.37
3pl6_D268 MBP peptide / T-cell receptor beta chain chimera; 99.36
1c1e_H219 Catalytic antibody 1E9 (heavy chain); diels-alder, 99.36
2v9t_A117 Roundabout homolog 1; structural protein-receptor 99.36
1i1c_A239 IGG2A, IG gamma-2A chain C region; FC, immune syst 99.36
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 99.36
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 99.36
4ei6_B245 Vbeta16 XV19 type II natural killer T cell recept 99.36
2wbj_D279 OB TCR; transmembrane, immune response, T cell rec 99.35
3bqu_C233 3H6 FAB light chain; beta sheet, immune system; 3. 99.35
2eo1_A102 OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 99.35
3c6l_A185 TCR 2W20 alpha chain; TCR-PMHC complex; 3.40A {Mus 99.04
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 99.34
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 99.34
3rgv_A200 YAE62 TCR A chain; TCR, MHC, MHC class I, immune s 99.34
1f3r_B257 FV antibody fragment; IG-fold, immuno complex, ant 99.33
2ghw_B247 Anti-SARS SCFV antibody, 80R; S protein, neutraliz 99.33
1q9r_B222 S25-2 FAB (IGG1K) heavy chain; antigen-binding fra 99.33
2eys_A210 NKT15; natural killer T cell receptor, immune syst 99.32
1nqb_A256 Single-chain antibody fragment; multivalent antibo 99.32
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 99.32
1moe_A240 Anti-CEA MAB T84.66; anti carcinoembryonic antigen 99.32
2e6q_A112 Obscurin-like protein 1; IG-like domain, structura 99.32
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 99.32
3d9a_H210 Heavy chain of hyhel10 antibody fragment (FAB); ly 99.32
1dee_B223 IGM RF 2A2; FAB-IBP complex 2.7A resolution bindin 99.31
1l6x_A207 Immunoglobulin gamma-1 heavy chain constant regio; 99.31
3q5y_A240 TCR N15 beta; IG, T cell receptor, antigen peptide 99.31
2fbj_H220 IGA-kappa J539 FAB (heavy chain); immunoglobulin; 99.31
3omz_A259 Human vdelta1 gamma delta T cell receptor delta1A; 99.3
3auv_A276 SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid 99.3
2znx_A242 SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s 99.3
1op3_H225 FAB 2G12, heavy chain; domain-swapped FAB 2G12, an 99.29
2p1y_A238 Bispecific alpha/beta TCR; autoimmunity, immunoglo 99.29
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 99.29
3ux9_B256 SCFV antibody; five helices, long loop connecting 99.28
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.28
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
Probab=100.00  E-value=3.2e-33  Score=207.16  Aligned_cols=227  Identities=25%  Similarity=0.419  Sum_probs=181.5

Q ss_pred             ecCCCccCCCCCcccccCCeEEEEEEeeCCCCCceeEEEECCeeecCCCceEEEEeeeeceEEEEeecCCCCCeeEEEEE
Q psy11132          7 TVPPKLSPTNPERTLNVGERASLICSITKGDIPLTIKWLKDGRYLDNSAALSITHVDQYNSMLVIDSVSARHSGNYSCTV   86 (243)
Q Consensus         7 ~~~p~~~~~~~~~~~~~g~~~~l~C~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~G~Y~C~~   86 (243)
                      ..||.+...+....+.+|+.++|.|.+. +.|.+.+.|++++..+....++...... ....|.|.+++.+|+|.|+|.+
T Consensus         3 ~~pP~~~~~p~~~~~~~G~~v~l~C~~~-g~p~~~v~W~~~~~~~~~~~~~~~~~~~-~~~~L~i~~v~~~d~G~Y~C~~   80 (284)
T 2rik_A            3 MAPPFFDLKPVSVDLALGESGTFKCHVT-GTAPIKITWAKDNREIRPGGNYKMTLVE-NTATLTVLKVTKGDAGQYTCYA   80 (284)
T ss_dssp             CCCCEEEECCCCEEEETTCCEEEEEEEE-SSSCCEEEEEETTEECCSSSSEEEEEET-TEEEEEESSCCGGGCEEEEEEE
T ss_pred             cCCCEEEccccceEecCCCcEEEEEEEE-cCCCCEEEEEECCEECcCCCcEEEEEcC-CEEEEEEecCCcccCEEEEEEE
Confidence            4688888888888999999999999996 7777899999999998876665544322 3578999999999999999999


Q ss_pred             EeCCCcceeEEEEEEEcCCCccccccCCCCCCCCCcEEEEEEeecCCCCCEEEEEeCCEecCCCCCeeEEeeccceeEEE
Q psy11132         87 RNMVAEDTQVQRLIVNVPPKIESFAFPFDGLPEGARTRVICGVTHGDPPLTIRWLKDGKPLSPRFPVNVSDLDSFSSLLS  166 (243)
Q Consensus        87 ~~~~~~~~~~~~l~v~~~p~~~~~~~~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~~~~~~~~~~~~~~~~~~~~~~l~  166 (243)
                      .+..+..+..+.|.|..+|.+.........+..|+.+.|.|.+ .|.|.+.+.|++++..+.......... ......|.
T Consensus        81 ~n~~g~~~~~~~l~V~~~p~~~~~~~~~~~v~~g~~~~l~C~~-~g~p~~~v~W~~~~~~~~~~~~~~~~~-~~~~~~L~  158 (284)
T 2rik_A           81 SNVAGKDSCSAQLGVQEPPRFIKKLEPSRIVKQDEHTRYECKI-GGSPEIKVLWYKDETEIQESSKFRMSF-VESVAVLE  158 (284)
T ss_dssp             EETTEEEEEEEEEEEECCCEEEECCCSEEEEETTCCEEEEEEE-ESSSCCEEEEEETTEECCCSSSEEEEE-ETTEEEEE
T ss_pred             EECCceEEEEEEEEccCCCcccccCCCceEecCCceEEEEEEE-eeeCCCEEEEEECCEECcCCCcEEEEE-cCCEEEEE
Confidence            9998888888899999888765443333446789999999999 588999999999999988765544332 23357899


Q ss_pred             EeecCCCCCeeEEEEEEccCcceeeeEEEEEEeecC--CCCCeeeeeccceeeeccCccccc--ccceEEeCCee
Q psy11132        167 INSVSAAHSGEYTCVASNTAAQARYSSKLQVKGNLN--RLPPSYTLVFSQASYMSTSYYSFE--QDSWMIDNENY  237 (243)
Q Consensus       167 i~~~~~~d~g~y~C~~~n~~g~~~~~~~l~v~~~~~--~~~p~~~~~~~~~~~~~~~~~~~~--~~~W~~~~~~~  237 (243)
                      |.++..+|+|.|+|.|.|..|.....+.|.|...+.  ..|....+..+..+.+.|.....|  .+.|+++|..+
T Consensus       159 i~~~~~~d~G~Y~C~a~n~~g~~~~~~~l~V~~~p~~~~~~~~~~~~~g~~v~l~C~~~g~p~~~v~W~~~~~~~  233 (284)
T 2rik_A          159 MYNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPVFRKKPHPVETLKGADVHLECELQGTPPFQVSWHKDKREL  233 (284)
T ss_dssp             ECSCCGGGCEEEEEEEECSSCEEEEEEEEEEECCCBCCSCCCCEEECTTCCEEEEEECBSSSCCEEEEEETTEEE
T ss_pred             ECCCCcccCEEEEEEEEcCCCceeEEEEEEEecCCcceeCCCcceecCCCeEEEEEEEEecCCCEEEEEECCEEC
Confidence            999999999999999999999988888998883221  122233455677888899876654  89999998654



>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Back     alignment and structure
>4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Back     alignment and structure
>4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Back     alignment and structure
>1za6_B IGG heavy chain; immunoglobulin fold, CH2-domain-deletion, immune system; 2.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 Back     alignment and structure
>3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Back     alignment and structure
>1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Back     alignment and structure
>1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Back     alignment and structure
>1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 Back     alignment and structure
>2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A Back     alignment and structure
>1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Back     alignment and structure
>1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Back     alignment and structure
>3tv3_L PGT128 light chain, IG lambda-2 chain C regions; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_L* 3twc_L* 3tnm_L 2mcg_1 1mcw_M 1a8j_L 3mcg_1 1dcl_A 1mcb_A* 1mcc_A* 1mcd_A* 1mce_A* 1mcf_A* 1mch_A 1mci_A* 1mcj_A* 1mck_A 1mcl_A* 1mcn_A* 1mcq_A ... Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Back     alignment and structure
>4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} Back     alignment and structure
>1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3s96_B 3B5H10 FAB light chain; huntingtin, immune system; 1.90A {Mus musculus} PDB: 2qhr_L 3ffd_B 4dcq_A Back     alignment and structure
>3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... Back     alignment and structure
>1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Back     alignment and structure
>1hzh_H IGG, immunoglobulin heavy chain; antibody, immune system; HET: NAG BMA MAN GAL FUC; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 PDB: 2ig2_H 1mco_H* Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A Back     alignment and structure
>3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Back     alignment and structure
>1q0x_L FAB 9B1, light chain; anti-morphine antibody, FAB fragment, immune system; HET: PG4; 1.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q0y_L* 1ngp_L* 1ngq_L 3ks0_L* 1gig_L 2vir_A 2vis_A* 2vit_A 1sm3_L 4a6y_L 1ind_L* 1ine_L* 1yuh_L* 2zpk_L 3rhw_K* 3ri5_K* 3ria_K* 3rif_K* 1mfe_L* 1mfb_L* ... Back     alignment and structure
>2c1o_A IGK-C protein; FAB fragment, enantioselective, finrozole, immune system, antibody, ENA11His antibody, immunoglobulin domain; 2.75A {Mus musculus} Back     alignment and structure
>1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>2xzc_L FAB A.17 light chain; immune system; HET: XOP; 1.36A {Homo sapiens} PDB: 2xza_L* 3kdm_L* 3nps_C 1dn0_A 1qlr_A* 2v7n_A 3eo0_A 3eo1_A 2agj_L* 2fx7_L 1tzg_L 2fx8_L 2fx9_L* 1u6a_L 3hi1_L* 3kym_A 3kyk_L 3qwo_L* 3ixt_L* 3qeg_L ... Back     alignment and structure
>2j6e_L IGM, FAB light chain; autoimmune complex human IGM rheumatoid factor IGG1-FC, immunoglobulin C region, membrane, glycoprotein, transmembrane; HET: NAG FUL BMA MAN NDG GAL; 3.0A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Back     alignment and structure
>1hzh_H IGG, immunoglobulin heavy chain; antibody, immune system; HET: NAG BMA MAN GAL FUC; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 PDB: 2ig2_H 1mco_H* Back     alignment and structure
>1c1e_H Catalytic antibody 1E9 (heavy chain); diels-alder, immunoglobulin, immune system; HET: ENH; 1.90A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1dbb_H* 1dba_H* 1dbj_H* 1dbk_H* 1dbm_H* 2dbl_H* 3ojd_B 1jgl_H* 1jhk_H 1ghf_H 1tet_H* 3e8u_H 1fj1_B 1cl7_H Back     alignment and structure
>3sob_L Antibody light chain; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_A 3u1s_L* Back     alignment and structure
>3r06_A Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; anti-CD3epsilon, T-cell receptor, signalling, IMMU; 2.50A {Cricetulus migratorius} PDB: 3r08_L 3ld8_B 3ldb_B* Back     alignment and structure
>1iga_A IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg_A 2qtj_A 3chn_A 1r70_B 3cm9_A Back     alignment and structure
>2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>1igy_B IGG1 intact antibody MAB61.1.3; intact immunoglobulin, V region, C region, hinge region, immunoglobulin; HET: NAG FUL NDG BMA MAN GAL FUC; 3.20A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Back     alignment and structure
>1nfd_E H57 FAB; complex (immunoreceptor-immunoglobulin), complex (immunorece immunoglobulin) complex; HET: NAG NDG; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Back     alignment and structure
>1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H Back     alignment and structure
>1igy_B IGG1 intact antibody MAB61.1.3; intact immunoglobulin, V region, C region, hinge region, immunoglobulin; HET: NAG FUL NDG BMA MAN GAL FUC; 3.20A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Back     alignment and structure
>2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A Back     alignment and structure
>4dzb_B Vbeta2 (MAIT T cell receptor); immune system; 1.70A {Homo sapiens} PDB: 1ymm_E* 3o4l_E* 3o6f_D 3t0e_D 1ktk_E 3mfg_B 2ij0_E Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Back     alignment and structure
>3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} Back     alignment and structure
>1q9r_B S25-2 FAB (IGG1K) heavy chain; antigen-binding fragment, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, KDO, complex, immune system; HET: KDA KDO; 1.45A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q9l_B 1q9k_B* 1q9q_B* 1q9v_B* 2r1w_B* 2r1x_B* 2r1y_B* 2r2b_B* 2r2e_B* 2r2h_B* 3bpc_B* 3sy0_B* 3t4y_B* 3t65_B* 2r23_B* 1q9t_B* 3t77_B* 3okl_B* 3okk_B* 3okm_B ... Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Back     alignment and structure
>3d9a_H Heavy chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_H 1gpo_H 3ks0_H* 1dqd_H 1ndm_B 1nak_H 1dqq_B 1dqm_H 1dqj_B 1nby_B 1nbz_B 1xgu_B 1ndg_B 1xgt_B 1xgp_B 1xgq_B 1xgr_B 1s5i_H 1f8t_H 1f90_H ... Back     alignment and structure
>3bkj_L WO2 IGG2A FAB fragment light chain kappa; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} PDB: 3bkc_L 3bkm_L 2zuq_B* 1h3p_L Back     alignment and structure
>3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* Back     alignment and structure
>3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L Back     alignment and structure
>2rgs_A I, IG gamma-2B heavy chain; FC-fragment, immunoglobulin, glycosylation, immune system; HET: NAG FUC MAN GAL; 2.13A {Mus musculus} Back     alignment and structure
>3pl6_D MBP peptide / T-cell receptor beta chain chimera; TCR-MHC complex, immunoglobulin fold, immune receptor, membr immune system; HET: NAG; 2.55A {Homo sapiens} Back     alignment and structure
>1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A Back     alignment and structure
>3juy_B 3B3 single chain variant HIV-1 antibody; envelope protein GP120, broadly neutralizing antibody, 3B3 single chain variable fragment, immune system; 2.50A {Homo sapiens} Back     alignment and structure
>1hxm_B Gamma-delta T-cell receptor; IG domain, TCR, GDTCR, immune system; 3.12A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* Back     alignment and structure
>1dee_B IGM RF 2A2; FAB-IBP complex 2.7A resolution binding outside the antigen combining site superantigen FAB VH3 specificity; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1hez_B 1adq_H Back     alignment and structure
>3umt_A SCFV heavy chain and light chain; stability engineering, anthrax, anti-BCLA antibody, immunoglobulin fold (VH and VL domains), antibody, immune S; HET: NHE; 1.80A {Mus musculus} PDB: 1xiw_D Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Back     alignment and structure
>1pz5_B Heavy chain of FAB (SYA/J6); antibody-antigen structure, peptide-carbohydrate mimicry, VA design, immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1m7d_B* 1m71_B* 1m7i_B* 1r24_B 1uz6_F 1uz8_B* 1clz_H* Back     alignment and structure
>1mju_H Immunoglobulin MS6-12; catalytic antibody, ester hydrolysis, esterolytic, FAB, immune system; 1.22A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mjj_B 1mie_H 1mj7_H* 1mj8_H 1mh5_B* 4aeh_H 2y5t_A 2vwe_E 2op4_H 2ntf_H 3loh_C 1e4x_H 2vl5_A 1e4x_I 1e4w_H 3opz_H 3oz9_H 1plg_H 1hi6_B 1cfn_B ... Back     alignment and structure
>2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* Back     alignment and structure
>3bqu_C 3H6 FAB light chain; beta sheet, immune system; 3.00A {Mus musculus} Back     alignment and structure
>2vol_A Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, cytoplasm, mouse IGG, zinc-finger, DNA-binding, RNA-binding, tripartite motif (TRIM) protein; HET: NAG MAN GAL FUC; 1.95A {Mus musculus} PDB: 3hkf_A 1i1a_C* 1cqk_A Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} Back     alignment and structure
>1svz_A Immunoglobulin;, single-chain FV fragment 1696; antibody-antigen complex, HIV inhibiting antibody; 1.89A {Mus musculus} PDB: 1jp5_A Back     alignment and structure
>3gkz_A Anti-methamphetamine single chain FV; therapeutic antibody, MDMA, IGG, immune system; HET: B40; 1.90A {Mus musculus} PDB: 3gm0_A* 1rvf_L 3ab0_C 2a0l_C 3iy5_A Back     alignment and structure
>1qok_A MFE-23 recombinant antibody fragment; immunoglobulin, single-chain FV, anti-carcinoembryonic antigen; 2.4A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>4ei6_B Vbeta16 XV19 type II natural killer T cell recept variable domain, human constant...; natural killer T cell receptor, immune system; 1.60A {Mus musculus} PDB: 4ei5_D 4elk_B 4elm_F* 2esv_E 3ffc_E 3utt_E 3utp_E* 3uts_E 3qjf_B 3qjh_B 3qiw_D* 3qiu_D Back     alignment and structure
>1op3_H FAB 2G12, heavy chain; domain-swapped FAB 2G12, anti-carbohydrate antibody, immune system; HET: MAN; 1.75A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1om3_H* 1op5_H* 3oay_M* 1zlu_H* 1zlv_H* 1zlw_H* 2oqj_B 1zls_H* 3ob0_H* 3oau_H* 3oaz_H* 3ghe_H 3eyf_B 3eyo_B 3ghb_H 3c2a_H 1q1j_H 2fl5_H* Back     alignment and structure
>2gjj_A A21 single-chain antibody fragment against ERBB2; IG family, SCFV, immune system; 2.10A {Mus musculus} PDB: 3h3b_C Back     alignment and structure
>3q5y_A TCR N15 beta; IG, T cell receptor, antigen peptide/MHC, membrane, immune S; HET: EPE; 1.90A {Mus musculus} PDB: 1nfd_B* 3q5t_A Back     alignment and structure
>2fbj_H IGA-kappa J539 FAB (heavy chain); immunoglobulin; HET: NAG FUC; 1.95A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mcp_H 2mcp_H* Back     alignment and structure
>3bae_H WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} SCOP: b.1.1.2 PDB: 3bkc_H 3bkj_H 3bkm_H 3mck_H 2r0w_H* 2iqa_H 2iq9_H 1ggi_H 1ggb_H 1ggc_H 3eys_H* 2ipt_H 2ipu_H 3eyu_H* 2r0z_H* 3rkd_H 1r0a_H* 1n5y_H* 1n6q_H* 1t03_H* ... Back     alignment and structure
>1dn0_B IGM-kappa cold agglutinin (heavy chain); FAB, antibody, human, immune system; 2.28A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1qlr_B* 2j6e_H* 2agj_H* 2h32_H Back     alignment and structure
>1zvo_C Myeloma immunoglobulin D delta; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A Back     alignment and structure
>3qib_D 2B4 beta chain; IG domain, immune system; HET: NAG FUC BMA; 2.70A {Mus musculus} Back     alignment and structure
>1iga_A IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg_A 2qtj_A 3chn_A 1r70_B 3cm9_A Back     alignment and structure
>3o3u_N Maltose-binding periplasmic protein, advanced Gly END product-specific receptor; RAGE, AGER, scavenger receptor; HET: MLR; 1.50A {Escherichia coli} PDB: 3s59_A 3s58_A 3cjj_A 2l7u_A* 2e5e_A Back     alignment and structure
>3omz_A Human vdelta1 gamma delta T cell receptor delta1A; immunoglobulin fold, immune surveillance of cell stress PROT A/B, MIC-A/B binding, epithelium; 3.04A {Homo sapiens} Back     alignment and structure
>2wbj_D OB TCR; transmembrane, immune response, T cell receptor, MHC II, MEM receptor, molecular mimicry, multiple sclerosis, immune SYS autoimmunity; HET: NAG BMA MAN; 3.00A {Homo sapiens} Back     alignment and structure
>1x9q_A SCFV, 4M5.3 anti-fluorescein single chain antibody fragment; VERY high affinity, antibody binding, electrostatics, directed evolution; HET: FLU; 1.50A {Homo sapiens} Back     alignment and structure
>2w59_A IGY FCU3-4; immunoglobulin, avian, immune system; HET: NAG MAN; 1.75A {Gallus gallus} Back     alignment and structure
>1c5d_H Monoclonal antibody against the main immunogenic the human muscle acetylcholine receptor...; immunoglobulin, immune system; 2.40A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 2arj_H 3b9k_H* 2gk0_H 2gjz_H 1fn4_B 3mj8_H 3mj9_H* Back     alignment and structure
>3m8o_H Immunoglobulin A1 heavy chain; immunoglobulin fold, immune system; 1.55A {Homo sapiens} PDB: 3qnx_B 3qny_B Back     alignment and structure
>3fku_X Neutralizing antibody F10; influenza, hemagglutinin, SCFV, F membrane, envelope protein, fusion protein, membrane, trans virion; HET: NAG BMA; 3.20A {Homo sapiens} Back     alignment and structure
>1i1c_A IGG2A, IG gamma-2A chain C region; FC, immune system; HET: NAG FUL BMA MAN FUC; 2.70A {Rattus norvegicus} SCOP: b.1.1.2 b.1.1.2 PDB: 1i1a_D* Back     alignment and structure
>1l6x_A Immunoglobulin gamma-1 heavy chain constant regio; IGG1 FC, FC complex, immune system; HET: NAG BMA MAN GAL FUL; 1.65A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2iwg_A* 3v7m_A* 3d6g_A* 3agv_A* 1oqo_A* 1oqx_A* 3v95_A* 2wah_A* 3sgj_A* 3sgk_A* 2dtq_A* 2dts_A* 3ave_A* 3ay4_A* 3do3_A* 2gj7_A* 1t83_A* 1t89_A* 1dn2_A* 3dnk_A ... Back     alignment and structure
>2xqy_G A13-D6.3 monoclonal antibody, envelope glycoprotein H; immune system-viral protein complex, envelope protein; HET: NAG; 2.05A {Mus musculus} Back     alignment and structure
>3liz_H 4C3 monoclonal antibody heavy chain; hydrolase-immune system complex; HET: NAG BMA MAN; 1.80A {Mus musculus} PDB: 3rvv_D* 3rvu_D 3rvt_D* 3rvw_D* 3rvx_D 1lo4_H 1ub6_H 3r06_B 3r08_H Back     alignment and structure
>2gki_A Nuclease; anti-DNA antibody, catalytic antibody, immune system; 2.88A {Mus musculus} Back     alignment and structure
>1bec_A 14.3.D T cell antigen receptor; T cell receptor; 1.70A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1jck_A 1l0x_A 1sbb_A 1l0y_A 3c6l_B 1mwa_B* 1g6r_B* 1tcr_B* 2ckb_B 2q86_B* 1lp9_F 2j8u_F 2jcc_F 2uwe_F 3mbe_D* 1d9k_B* 2aq3_A 3mc0_A 3byt_A 3bzd_A ... Back     alignment and structure
>1zvo_C Myeloma immunoglobulin D delta; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Back     alignment and structure
>3bn9_D E2 FAB heavy chain; antibody-protease complex, protein-protein complex, enzyme- inhibitor complex, disease mutation, glycoprotein, hydrolase; 2.17A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 3kr3_H 2xtj_E Back     alignment and structure
>1oga_E TRBC1, T-cell receptor beta chain C region; immune system/receptor, immune system/receptor/complex, TCR, MHC, immunodominance, FLU, complex; 1.40A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 2vlm_E 2vlk_E 2vlj_E 2vlr_E 2xna_B 2xn9_B 2axh_A 2axj_A 3scm_D* 3sda_D* 3sdc_D* 3sdd_D* 3qi9_D* 3mff_B* 2ak4_E 3he7_D* 2eyr_B 3pqy_E 3kxf_E 2cde_B ... Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Back     alignment and structure
>3knb_B Obscurin-like protein 1; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2wp3_O* 2wwm_C 2wwk_O Back     alignment and structure
>1ypz_F T-cell receptor gamma chain, beta-2-microglobulin; H2-T22 protein, T cell receptor delta, immune system; HET: NAG MAN FUC; 3.40A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>1za6_B IGG heavy chain; immunoglobulin fold, CH2-domain-deletion, immune system; 2.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 Back     alignment and structure
>3to4_D NKT vbeta2 (mouse variable domain, human constant; mouse CD1D, mouse NKT, immune system; HET: AGH NAG; 3.10A {Homo sapiens} Back     alignment and structure
>3u2s_H PG9 heavy chain; greek KEY, immunoglobulin, immune recognition, immune system; HET: PCA TYS BU3 NAG BMA MAN; 1.80A {Homo sapiens} PDB: 3u4e_H* 3u36_H 3mug_B* 3lrs_H* 3mme_H* 2qsc_H* Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>3qhz_H Human monoclonal antibody DEL2D1, FAB heavy chain; immunoglobulin, immune recognition, influenza A hemagglutini system; 1.55A {Homo sapiens} PDB: 3lzf_H* 3qrg_H* 3mod_H 3mob_H 3moa_H 3lev_H* 3idg_B 3d0l_B 3d0v_B 3idi_B 3idj_B 3idm_B* 3idn_B* 1tjg_H* 1tjh_H* 1tji_H* 2pr4_H 3drq_B 2p8m_B 2p8p_B ... Back     alignment and structure
>3tv3_H PGT128 heavy chain, IG gamma-1 chain C region; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_H* 3twc_H* 3tje_H* 3thm_H* 4fqq_H 2xzc_H* 2xza_H* 3b2u_H* 3b2v_H* 3mly_H 3mlz_H 4fq2_H 2ykl_H* 3tnm_H 4fqc_H* 4fq1_H* 2yk1_H* 3mlx_H 2jix_D 2vxq_H ... Back     alignment and structure
>3knb_A Titin; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 3q5o_A 2wp3_T* 2wwk_T 2wwm_D 2y9r_T* Back     alignment and structure
>1ow0_A IG alpha-1 chain C region; IGA1, fcari, CD89, antibody, immunoglobulin-LIK immune system; HET: NAG FUL BMA GAL SIA FUC MAN NDG; 3.10A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2qej_A* Back     alignment and structure
>4acp_A IG gamma-1 chain C region; immune system, antibody, kifunensine; HET: NAG; 2.49A {Homo sapiens} PDB: 2j6e_A* Back     alignment and structure
>3n9g_H FAB fragment of MAB CR4354, heavy chain; human neutralizing antibody, immun anti-WEST NIle virus; 1.43A {Homo sapiens} PDB: 3iyw_H 3qeh_A 3sqo_H 4hk0_A 4hk3_J 4hkx_A* 3u0t_D 3c08_H 3lmj_H 3lqa_H* 3c09_H* 4dn3_H 3pp4_H 3pp3_H 4hkb_J 2jb5_H* 2jb6_B* 2eh7_H 2eh8_H 3jwd_H* ... Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Back     alignment and structure
>1iam_A ICAM-1, CD54, intercellular adhesion molecule-1; rhinovirus receptor, cell adhesion, integrin ligand, glycopr LFA-1 ligand, immunoglobulin fold; HET: NAG; 2.10A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ic1_A* 1d3l_A 1d3e_I 1d3i_I 3tcx_A Back     alignment and structure
>2aty_A Complement receptor chimeric conjugate CR2-IG; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>3knb_B Obscurin-like protein 1; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2wp3_O* 2wwm_C 2wwk_O Back     alignment and structure
>2c1o_A IGK-C protein; FAB fragment, enantioselective, finrozole, immune system, antibody, ENA11His antibody, immunoglobulin domain; 2.75A {Mus musculus} Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sob_H Antibody heavy chain, low-density lipoprotein receptor-related protein; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_B 3uls_H 3ulu_D* 3ulv_D* Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>3knb_A Titin; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 3q5o_A 2wp3_T* 2wwk_T 2wwm_D 2y9r_T* Back     alignment and structure
>3mlr_H Human monoclonal anti-HIV-1 GP120 V3 antibody 255 heavy chain; human monoclonal antibody, FAB, third variable antibody-antigen interaction; 1.80A {Homo sapiens} PDB: 3mls_H 3mlt_H 3mlu_H 3mlv_H Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Back     alignment and structure
>1ypz_E T cell receptor delta, beta-2-microglobulin; H2-T22 protein, T cell receptor delta, immune system; HET: NAG MAN FUC; 3.40A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} SCOP: b.1.1.0 Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Back     alignment and structure
>3f8u_B Tapasin; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>3bn3_B ICAM-5, intercellular adhesion molecule 5, telencephalin; I domain, integrin, allosteric mobility, cell adhesi immune system; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Back     alignment and structure
>2lu7_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Back     alignment and structure
>4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1hxm_A Gamma-delta T-cell receptor; IG domain, TCR, GDTCR, immune system; 3.12A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>3m45_A Cell adhesion molecule 2; IG fold, dimer, disulfide bond, glycoprotein, immunoglobulin membrane, transmembrane; HET: NAG; 2.21A {Mus musculus} Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Back     alignment and structure
>3u1s_H FAB PGT145 heavy chain; IGG, broadly neutralizing antibody, HIV-1 GP120, immune SYST; HET: TYS; 2.30A {Homo sapiens} Back     alignment and structure
>2lvc_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} SCOP: b.1.1.0 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Back     alignment and structure
>1zxq_A ICAM-2, intercellular adhesion molecule-2; immunoglobulin fold, cell adhesion, glycoprotein, transmembr; HET: NAG; 2.20A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Back     alignment and structure
>3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2lu7_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Back     alignment and structure
>2e6q_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* Back     alignment and structure
>4hwu_A Fibroblast growth factor receptor 2; FGFR2, KGFR, CD332, IG-C2 type 1 domain, IG superfamily, IMM system, structural genomics, PSI-biology; 2.90A {Mus musculus} Back     alignment and structure
>3qib_D 2B4 beta chain; IG domain, immune system; HET: NAG FUC BMA; 2.70A {Mus musculus} Back     alignment and structure
>3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Back     alignment and structure
>1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Back     alignment and structure
>1z9m_A GAPA225; nectin-like, IG-like domain, V domain, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Back     alignment and structure
>2lvc_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Back     alignment and structure
>3tv3_L PGT128 light chain, IG lambda-2 chain C regions; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_L* 3twc_L* 3tnm_L 2mcg_1 1mcw_M 1a8j_L 3mcg_1 1dcl_A 1mcb_A* 1mcc_A* 1mcd_A* 1mce_A* 1mcf_A* 1mch_A 1mci_A* 1mcj_A* 1mck_A 1mcl_A* 1mcn_A* 1mcq_A ... Back     alignment and structure
>1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A Back     alignment and structure
>1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Back     alignment and structure
>2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>3m45_A Cell adhesion molecule 2; IG fold, dimer, disulfide bond, glycoprotein, immunoglobulin membrane, transmembrane; HET: NAG; 2.21A {Mus musculus} Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Back     alignment and structure
>3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... Back     alignment and structure
>3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* Back     alignment and structure
>4acp_A IG gamma-1 chain C region; immune system, antibody, kifunensine; HET: NAG; 2.49A {Homo sapiens} PDB: 2j6e_A* Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Back     alignment and structure
>3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Back     alignment and structure
>3r06_A Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; anti-CD3epsilon, T-cell receptor, signalling, IMMU; 2.50A {Cricetulus migratorius} PDB: 3r08_L 3ld8_B 3ldb_B* Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Back     alignment and structure
>2rgs_A I, IG gamma-2B heavy chain; FC-fragment, immunoglobulin, glycosylation, immune system; HET: NAG FUC MAN GAL; 2.13A {Mus musculus} Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s96_B 3B5H10 FAB light chain; huntingtin, immune system; 1.90A {Mus musculus} PDB: 2qhr_L 3ffd_B 4dcq_A Back     alignment and structure
>2vol_A Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, cytoplasm, mouse IGG, zinc-finger, DNA-binding, RNA-binding, tripartite motif (TRIM) protein; HET: NAG MAN GAL FUC; 1.95A {Mus musculus} PDB: 3hkf_A 1i1a_C* 1cqk_A Back     alignment and structure
>4hwu_A Fibroblast growth factor receptor 2; FGFR2, KGFR, CD332, IG-C2 type 1 domain, IG superfamily, IMM system, structural genomics, PSI-biology; 2.90A {Mus musculus} Back     alignment and structure
>4dzb_B Vbeta2 (MAIT T cell receptor); immune system; 1.70A {Homo sapiens} PDB: 1ymm_E* 3o4l_E* 3o6f_D 3t0e_D 1ktk_E 3mfg_B 2ij0_E Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Back     alignment and structure
>2j6e_L IGM, FAB light chain; autoimmune complex human IGM rheumatoid factor IGG1-FC, immunoglobulin C region, membrane, glycoprotein, transmembrane; HET: NAG FUL BMA MAN NDG GAL; 3.0A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>3sob_L Antibody light chain; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_A 3u1s_L* Back     alignment and structure
>1q0x_L FAB 9B1, light chain; anti-morphine antibody, FAB fragment, immune system; HET: PG4; 1.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q0y_L* 1ngp_L* 1ngq_L 3ks0_L* 1gig_L 2vir_A 2vis_A* 2vit_A 1sm3_L 4a6y_L 1ind_L* 1ine_L* 1yuh_L* 2zpk_L 3rhw_K* 3ri5_K* 3ria_K* 3rif_K* 1mfe_L* 1mfb_L* ... Back     alignment and structure
>2xzc_L FAB A.17 light chain; immune system; HET: XOP; 1.36A {Homo sapiens} PDB: 2xza_L* 3kdm_L* 3nps_C 1dn0_A 1qlr_A* 2v7n_A 3eo0_A 3eo1_A 2agj_L* 2fx7_L 1tzg_L 2fx8_L 2fx9_L* 1u6a_L 3hi1_L* 3kym_A 3kyk_L 3qwo_L* 3ixt_L* 3qeg_L ... Back     alignment and structure
>1ntl_A CRRY-IG; immunology, complement, glycoprotein, SCR, CCP, immune system; NMR {Mus musculus} Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Back     alignment and structure
>1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2w59_A IGY FCU3-4; immunoglobulin, avian, immune system; HET: NAG MAN; 1.75A {Gallus gallus} Back     alignment and structure
>3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Back     alignment and structure
>1z9m_A GAPA225; nectin-like, IG-like domain, V domain, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Back     alignment and structure
>3bkj_L WO2 IGG2A FAB fragment light chain kappa; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} PDB: 3bkc_L 3bkm_L 2zuq_B* 1h3p_L Back     alignment and structure
>1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Back     alignment and structure
>1nfd_E H57 FAB; complex (immunoreceptor-immunoglobulin), complex (immunorece immunoglobulin) complex; HET: NAG NDG; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3pl6_D MBP peptide / T-cell receptor beta chain chimera; TCR-MHC complex, immunoglobulin fold, immune receptor, membr immune system; HET: NAG; 2.55A {Homo sapiens} Back     alignment and structure
>1c1e_H Catalytic antibody 1E9 (heavy chain); diels-alder, immunoglobulin, immune system; HET: ENH; 1.90A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1dbb_H* 1dba_H* 1dbj_H* 1dbk_H* 1dbm_H* 2dbl_H* 3ojd_B 1jgl_H* 1jhk_H 1ghf_H 1tet_H* 3e8u_H 1fj1_B 1cl7_H Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Back     alignment and structure
>1i1c_A IGG2A, IG gamma-2A chain C region; FC, immune system; HET: NAG FUL BMA MAN FUC; 2.70A {Rattus norvegicus} SCOP: b.1.1.2 b.1.1.2 PDB: 1i1a_D* Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Back     alignment and structure
>4ei6_B Vbeta16 XV19 type II natural killer T cell recept variable domain, human constant...; natural killer T cell receptor, immune system; 1.60A {Mus musculus} PDB: 4ei5_D 4elk_B 4elm_F* 2esv_E 3ffc_E 3utt_E 3utp_E* 3uts_E 3qjf_B 3qjh_B 3qiw_D* 3qiu_D Back     alignment and structure
>2wbj_D OB TCR; transmembrane, immune response, T cell receptor, MHC II, MEM receptor, molecular mimicry, multiple sclerosis, immune SYS autoimmunity; HET: NAG BMA MAN; 3.00A {Homo sapiens} Back     alignment and structure
>3bqu_C 3H6 FAB light chain; beta sheet, immune system; 3.00A {Mus musculus} Back     alignment and structure
>2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3c6l_A TCR 2W20 alpha chain; TCR-PMHC complex; 3.40A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Back     alignment and structure
>3rgv_A YAE62 TCR A chain; TCR, MHC, MHC class I, immune system; 2.90A {Mus musculus} PDB: 3c60_A Back     alignment and structure
>1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>1q9r_B S25-2 FAB (IGG1K) heavy chain; antigen-binding fragment, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, KDO, complex, immune system; HET: KDA KDO; 1.45A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q9l_B 1q9k_B* 1q9q_B* 1q9v_B* 2r1w_B* 2r1x_B* 2r1y_B* 2r2b_B* 2r2e_B* 2r2h_B* 3bpc_B* 3sy0_B* 3t4y_B* 3t65_B* 2r23_B* 1q9t_B* 3t77_B* 3okl_B* 3okk_B* 3okm_B ... Back     alignment and structure
>2eys_A NKT15; natural killer T cell receptor, immune system; 2.21A {Homo sapiens} PDB: 2eyr_A 2eyt_A 3huj_E* 3tyf_A 3tzv_A* 3sdx_E* 2po6_C* 2cde_A 3to4_C* Back     alignment and structure
>1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>2e6q_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Back     alignment and structure
>3d9a_H Heavy chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_H 1gpo_H 3ks0_H* 1dqd_H 1ndm_B 1nak_H 1dqq_B 1dqm_H 1dqj_B 1nby_B 1nbz_B 1xgu_B 1ndg_B 1xgt_B 1xgp_B 1xgq_B 1xgr_B 1s5i_H 1f8t_H 1f90_H ... Back     alignment and structure
>1dee_B IGM RF 2A2; FAB-IBP complex 2.7A resolution binding outside the antigen combining site superantigen FAB VH3 specificity; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1hez_B 1adq_H Back     alignment and structure
>1l6x_A Immunoglobulin gamma-1 heavy chain constant regio; IGG1 FC, FC complex, immune system; HET: NAG BMA MAN GAL FUL; 1.65A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2iwg_A* 3v7m_A* 3d6g_A* 3agv_A* 1oqo_A* 1oqx_A* 3v95_A* 2wah_A* 3sgj_A* 3sgk_A* 2dtq_A* 2dts_A* 3ave_A* 3ay4_A* 3do3_A* 2gj7_A* 1t83_A* 1t89_A* 1dn2_A* 3dnk_A ... Back     alignment and structure
>3q5y_A TCR N15 beta; IG, T cell receptor, antigen peptide/MHC, membrane, immune S; HET: EPE; 1.90A {Mus musculus} PDB: 1nfd_B* 3q5t_A Back     alignment and structure
>2fbj_H IGA-kappa J539 FAB (heavy chain); immunoglobulin; HET: NAG FUC; 1.95A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mcp_H 2mcp_H* Back     alignment and structure
>3omz_A Human vdelta1 gamma delta T cell receptor delta1A; immunoglobulin fold, immune surveillance of cell stress PROT A/B, MIC-A/B binding, epithelium; 3.04A {Homo sapiens} Back     alignment and structure
>3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L Back     alignment and structure
>2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* Back     alignment and structure
>1op3_H FAB 2G12, heavy chain; domain-swapped FAB 2G12, anti-carbohydrate antibody, immune system; HET: MAN; 1.75A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1om3_H* 1op5_H* 3oay_M* 1zlu_H* 1zlv_H* 1zlw_H* 2oqj_B 1zls_H* 3ob0_H* 3oau_H* 3oaz_H* 3ghe_H 3eyf_B 3eyo_B 3ghb_H 3c2a_H 1q1j_H 2fl5_H* Back     alignment and structure
>2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 243
d1f97a2110 b.1.1.4 (A:129-238) Junction adhesion molecule, JA 5e-13
d1f97a2110 b.1.1.4 (A:129-238) Junction adhesion molecule, JA 7e-12
d3dara197 b.1.1.4 (A:153-249) Fibroblast growth factor recep 3e-12
d3dara197 b.1.1.4 (A:153-249) Fibroblast growth factor recep 6e-12
d1nbqa2104 b.1.1.4 (A:130-233) Junction adhesion molecule, JA 3e-12
d1nbqa2104 b.1.1.4 (A:130-233) Junction adhesion molecule, JA 2e-10
d1qz1a3100 b.1.1.4 (A:190-289) Neural cell adhesion molecule 2e-11
d1qz1a3100 b.1.1.4 (A:190-289) Neural cell adhesion molecule 1e-09
d2cqva1101 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T 4e-11
d2cqva1101 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T 4e-10
d1g1ca_98 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 2e-09
d1g1ca_98 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 7e-09
d1n26a193 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chai 5e-09
d1n26a193 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chai 2e-06
d1biha489 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr 6e-09
d1biha489 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr 7e-09
d1fhga_102 b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) 8e-09
d1fhga_102 b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) 9e-08
d1gl4b_89 b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus muscu 9e-09
d1gl4b_89 b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus muscu 1e-07
d2fdbp2109 b.1.1.4 (P:2252-2360) Fibroblast growth factor rec 3e-08
d2fdbp2109 b.1.1.4 (P:2252-2360) Fibroblast growth factor rec 4e-08
d1cs6a391 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall 4e-08
d1cs6a391 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall 1e-07
d2crya1115 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRR 4e-08
d2crya1115 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRR 3e-04
d1iama1103 b.1.1.3 (A:83-185) Intercellular cell adhesion mol 5e-08
d1iama1103 b.1.1.3 (A:83-185) Intercellular cell adhesion mol 2e-05
d1tnna_91 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 9e-08
d1tnna_91 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 2e-06
d1wwbx_103 b.1.1.4 (X:) Ligand binding domain of trkB recepto 1e-07
d1wwbx_103 b.1.1.4 (X:) Ligand binding domain of trkB recepto 9e-06
d1he7a_107 b.1.1.4 (A:) High affinity nerve growth factor rec 2e-07
d1he7a_107 b.1.1.4 (A:) High affinity nerve growth factor rec 1e-05
d1rhfa191 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor 2e-07
d1rhfa191 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor 2e-06
d1x44a190 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-ty 3e-07
d1x44a190 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-ty 9e-07
d1epfa292 b.1.1.4 (A:98-189) Neural cell adhesion molecule ( 3e-07
d1epfa292 b.1.1.4 (A:98-189) Neural cell adhesion molecule ( 4e-06
d1koaa197 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha 3e-07
d1koaa197 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha 9e-07
d1cs6a489 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall 3e-07
d1cs6a489 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall 7e-06
d1wwca_105 b.1.1.4 (A:) NT3 binding domain of trkC receptor { 4e-07
d1wwca_105 b.1.1.4 (A:) NT3 binding domain of trkC receptor { 5e-06
d1pd6a_94 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 4e-07
d1pd6a_94 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 6e-06
d1iray2103 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor 9e-07
d1iray2103 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor 9e-05
d1iray1101 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {H 1e-06
d1iray1101 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {H 6e-06
d3b5ha1101 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo 2e-06
d3b5ha1101 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo 3e-06
d1gxea_130 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 3e-06
d1gxea_130 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 2e-05
d1zxqa1106 b.1.1.3 (A:87-192) Intercellular cell adhesion mol 3e-06
d1zxqa1106 b.1.1.3 (A:87-192) Intercellular cell adhesion mol 3e-06
d1iray3107 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor 9e-06
d1iray3107 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor 0.003
d1cs6a197 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus 4e-05
d1cs6a197 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus 6e-04
d1biha397 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecr 5e-05
d1biha397 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecr 0.001
d2oz4a384 b.1.1.4 (A:367-450) Intercellular adhesion molecul 7e-05
d2oz4a384 b.1.1.4 (A:367-450) Intercellular adhesion molecul 8e-04
d1kcvh2101 b.1.1.2 (H:117-217) Immunoglobulin heavy chain gam 8e-05
d1wiua_93 b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis el 8e-05
d1wiua_93 b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis el 0.001
d1pkoa_126 b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein ( 1e-04
d1pkoa_126 b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein ( 0.002
d1biha2111 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecro 1e-04
d1biha2111 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecro 0.003
d2c9aa196 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein 2e-04
d2c9aa196 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein 8e-04
d1tiua_89 b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig re 2e-04
d2avga1110 b.1.1.4 (A:1-110) Cardiac myosin binding protein C 2e-04
d2avga1110 b.1.1.4 (A:1-110) Cardiac myosin binding protein C 0.002
d1nfde2104 b.1.1.2 (E:108-215) Immunoglobulin light chain lam 2e-04
d1nfde2104 b.1.1.2 (E:108-215) Immunoglobulin light chain lam 0.003
d2aw2a1104 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator 2e-04
d2aw2a1104 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator 3e-04
d1mjul2107 b.1.1.2 (L:108-214) Immunoglobulin light chain kap 3e-04
d1q0xl2102 b.1.1.2 (L:108-212) Immunoglobulin light chain lam 4e-04
d1biha194 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropi 5e-04
d1biha194 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropi 0.001
d2dava1113 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-t 6e-04
d1hdmb198 b.1.1.2 (B:88-185) Class II MHC beta chain, C-term 7e-04
d1gsma190 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion m 7e-04
d1gsma190 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion m 0.003
d1epfa197 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NC 0.001
d1o0va1104 b.1.1.2 (A:228-330) Immunoglobulin heavy chain eps 0.001
d2fcba288 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (C 0.001
d1fp5a2105 b.1.1.2 (A:439-543) Immunoglobulin heavy chain eps 0.001
d1rhfa285 b.1.1.4 (A:98-182) Tyrosine-protein kinase recepto 0.001
d1ucta199 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD8 0.002
d2ifga192 b.1.1.4 (A:192-283) High affinity nerve growth fac 0.002
d3frua191 b.1.1.2 (A:179-269) Fc (IgG) receptor, alpha-3 dom 0.002
d1c5cl2107 b.1.1.2 (L:108-214) Immunoglobulin light chain kap 0.003
d2mhaa189 b.1.1.2 (A:182-270) Class I MHC, alpha-3 domain {M 0.003
d3b5ha280 b.1.1.4 (A:23-102) Cervical EMMPRIN {Human (Homo s 0.003
d1fnga1101 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-ter 0.003
d1ogae2127 b.1.1.2 (E:119-245) T-cell antigen receptor {Human 0.003
d1eaja_124 b.1.1.1 (A:) Coxsackie virus and adenovirus recept 0.004
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Immunoglobulin
family: I set domains
domain: Junction adhesion molecule, JAM, C-terminal domain
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 61.6 bits (148), Expect = 5e-13
 Identities = 27/102 (26%), Positives = 36/102 (35%), Gaps = 8/102 (7%)

Query: 103 VPPKIESFAFPFDGLPEGARTRVICGVTHGDPPLTIRWLKDGKPLSPRFPVNVSDLDSFS 162
           VPP   + + P   +  G R  + C    G PP    W KDG  +            + S
Sbjct: 1   VPPSKPTISVPSS-VTIGNRAVLTCSEHDGSPPSEYSWFKDGISMLTADAKKTRAFMNSS 59

Query: 163 -------SLLSINSVSAAHSGEYTCVASNTAAQARYSSKLQV 197
                    L  + V+A  SGEY C A N    A  S    +
Sbjct: 60  FTIDPKSGDLIFDPVTAFDSGEYYCQAQNGYGTAMRSEAAHM 101


>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 97 Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 97 Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 97 Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 97 Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1kcvh2 b.1.1.2 (H:117-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 93 Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 93 Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 126 Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 126 Back     information, alignment and structure
>d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 111 Back     information, alignment and structure
>d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 111 Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1nfde2 b.1.1.2 (E:108-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Length = 104 Back     information, alignment and structure
>d1nfde2 b.1.1.2 (E:108-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Length = 104 Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1mjul2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 Back     information, alignment and structure
>d1q0xl2 b.1.1.2 (L:108-212) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 94 Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 94 Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1hdmb1 b.1.1.2 (B:88-185) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 97 Back     information, alignment and structure
>d1o0va1 b.1.1.2 (A:228-330) Immunoglobulin heavy chain epsilon constant domain 2, CH2-epsilon {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1fp5a2 b.1.1.2 (A:439-543) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d3frua1 b.1.1.2 (A:179-269) Fc (IgG) receptor, alpha-3 domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1c5cl2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2mhaa1 b.1.1.2 (A:182-270) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d3b5ha2 b.1.1.4 (A:23-102) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1fnga1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1ogae2 b.1.1.2 (E:119-245) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query243
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1g1ca_98 Titin {Human (Homo sapiens), different modules [Ta 99.78
d1fhga_102 Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 99.77
d1koaa197 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.76
d1cs6a489 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.76
d1wiua_93 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.75
d1g1ca_98 Titin {Human (Homo sapiens), different modules [Ta 99.74
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1fhga_102 Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 99.73
d1tnna_91 Titin {Human (Homo sapiens), different modules [Ta 99.72
d1cs6a489 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.7
d1biha489 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.7
d1koaa197 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.7
d1cs6a391 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.7
d1wiua_93 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.69
d3dara197 Fibroblast growth factor receptor, FGFR {Human (Ho 99.69
d1gsma190 Mucosal addressin cell adhesion molecule-1 (MADCAM 99.69
d1gl4b_89 Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 99.69
d3dara197 Fibroblast growth factor receptor, FGFR {Human (Ho 99.68
d1biha489 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.68
d2fcba288 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.68
d1qz1a3100 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.68
d1f2qa289 IgE high affinity receptor alpha subunit {Human (H 99.67
d1gl4b_89 Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 99.66
d1wwbx_103 Ligand binding domain of trkB receptor {Human (Hom 99.66
d1fnla289 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.66
d1epfa292 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.66
d1tnna_91 Titin {Human (Homo sapiens), different modules [Ta 99.66
d1cs6a391 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.66
d1rhfa285 Tyrosine-protein kinase receptor tyro3, second dom 99.66
d1wwbx_103 Ligand binding domain of trkB receptor {Human (Hom 99.66
d1rhfa191 Tyrosine-protein kinase receptor tyro3, N-terminal 99.66
d1wwca_105 NT3 binding domain of trkC receptor {Human (Homo s 99.65
d1wwca_105 NT3 binding domain of trkC receptor {Human (Homo s 99.65
d2nxyb284 CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 99.65
d1qz1a3100 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.65
d1epfa197 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.65
d2nxyb284 CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 99.65
d1gsma190 Mucosal addressin cell adhesion molecule-1 (MADCAM 99.64
d1biha397 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.64
d1biha194 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.64
d2fdbp2109 Fibroblast growth factor receptor, FGFR {Human (Ho 99.64
d3b5ha1101 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 99.63
d1l6za296 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t 99.63
d1vcaa290 Vascular cell adhesion molecule-1 (VCAM-1) {Human 99.63
d1n26a193 Interleukin-6 receptor alpha chain, N-terminal dom 99.63
d1gxea_130 Cardiac myosin binding protein C, different domain 99.62
d1vcaa290 Vascular cell adhesion molecule-1 (VCAM-1) {Human 99.62
d1rhfa191 Tyrosine-protein kinase receptor tyro3, N-terminal 99.62
d2fdbp2109 Fibroblast growth factor receptor, FGFR {Human (Ho 99.61
d1biha397 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.6
d2avga1110 Cardiac myosin binding protein C, different domain 99.6
d1f97a2110 Junction adhesion molecule, JAM, C-terminal domain 99.6
d2ifga192 High affinity nerve growth factor receptor TrkA, d 99.6
d1rhfa285 Tyrosine-protein kinase receptor tyro3, second dom 99.6
d1nbqa2104 Junction adhesion molecule, JAM, C-terminal domain 99.6
d2oz4a384 Intercellular adhesion molecule-1, ICAM-1 {Human ( 99.6
d2dava1113 Myosin-binding protein C, slow-type {Human (Homo s 99.59
d1f97a2110 Junction adhesion molecule, JAM, C-terminal domain 99.59
d2fcba288 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.59
d1gxea_130 Cardiac myosin binding protein C, different domain 99.59
d1he7a_107 High affinity nerve growth factor receptor TrkA, d 99.59
d3b5ha1101 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 99.59
d1epfa292 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.59
d1nbqa2104 Junction adhesion molecule, JAM, C-terminal domain 99.58
d1l6za296 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t 99.58
d1iama1103 Intercellular cell adhesion molecule-1 (ICAM-1) {H 99.58
d1cs6a197 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.57
d1f2qa289 IgE high affinity receptor alpha subunit {Human (H 99.57
d1he7a_107 High affinity nerve growth factor receptor TrkA, d 99.56
d1cs6a2105 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.56
d1pd6a_94 Cardiac myosin binding protein C, different domain 99.56
d1pd6a_94 Cardiac myosin binding protein C, different domain 99.56
d2ifga192 High affinity nerve growth factor receptor TrkA, d 99.55
d1x44a190 Myosin-binding protein C, slow-type {Human (Homo s 99.55
d2aw2a1104 B- and T-lymphocyte attenuator CD272 {Human (Homo 99.55
d1fnla289 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.55
d2crya1115 Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s 99.55
d2avga1110 Cardiac myosin binding protein C, different domain 99.55
d1iama1103 Intercellular cell adhesion molecule-1 (ICAM-1) {H 99.54
d2oz4a384 Intercellular adhesion molecule-1, ICAM-1 {Human ( 99.54
d1iray1101 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.53
d2crya1115 Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s 99.53
d2dava1113 Myosin-binding protein C, slow-type {Human (Homo s 99.53
d1epfa197 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.52
d1iray3107 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.52
d2c9aa196 Receptor-type tyrosine-protein phosphatase mu {Hum 99.52
d1f97a1102 Junction adhesion molecule, JAM, N-terminal domain 99.52
d1tiua_89 Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI 99.51
d1nbqa1105 Junction adhesion molecule, JAM, N-terminal domain 99.51
d1biha194 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.5
d1f2qa182 IgE high affinity receptor alpha subunit {Human (H 99.5
d2fcba185 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.5
d2aw2a1104 B- and T-lymphocyte attenuator CD272 {Human (Homo 99.49
d1fnla184 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.48
d1iray3107 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.48
d1cs6a2105 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.48
d2c9aa196 Receptor-type tyrosine-protein phosphatase mu {Hum 99.46
d1n26a193 Interleukin-6 receptor alpha chain, N-terminal dom 99.45
d1iray2103 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.45
d1x44a190 Myosin-binding protein C, slow-type {Human (Homo s 99.44
d1iray1101 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.44
d1cs6a197 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.43
d1olza192 Semaphorin 4d Ig-like domain {Human (Homo sapiens) 99.43
d1zxqa1106 Intercellular cell adhesion molecule-2 (ICAM-2) {H 99.43
d1nbqa1105 Junction adhesion molecule, JAM, N-terminal domain 99.42
d1iray2103 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.42
d1olza192 Semaphorin 4d Ig-like domain {Human (Homo sapiens) 99.41
d1f97a1102 Junction adhesion molecule, JAM, N-terminal domain 99.39
d1zxqa1106 Intercellular cell adhesion molecule-2 (ICAM-2) {H 99.37
d2fcba185 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.37
d1tiua_89 Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI 99.34
d1f2qa182 IgE high affinity receptor alpha subunit {Human (H 99.33
d1biha2111 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.31
d1fnla184 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.3
d1biha2111 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.27
d1pkoa_126 Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra 99.27
d1ccza193 CD2-binding domain of CD58, N-terminal domain {Hum 99.19
d1hnga198 CD2, first domain {Rat (Rattus norvegicus) [TaxId: 99.18
d1ccza193 CD2-binding domain of CD58, N-terminal domain {Hum 99.06
d1ucta199 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 99.04
d1pkoa_126 Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra 99.02
d1eaja_124 Coxsackie virus and adenovirus receptor (Car), dom 98.97
d1l6za1107 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t 98.96
d3bp5a1114 Programmed cell death protein 1, PD1, extracellula 98.94
d1ucta199 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 98.92
d1nezg_122 CD8 {Mouse (Mus musculus) [TaxId: 10090]} 98.92
d1olla195 Ligand binding domain of NK receptor NKp46 {Human 98.91
d1hnga198 CD2, first domain {Rat (Rattus norvegicus) [TaxId: 98.9
d1xeda_116 Polymeric-immunoglobulin receptor, PIGR {Human (Ho 98.9
d1tvda_116 T-cell antigen receptor {Human (Homo sapiens), del 98.84
d1akjd_114 CD8 {Human (Homo sapiens) [TaxId: 9606]} 98.84
d1vcaa1109 Vascular cell adhesion molecule-1 (VCAM-1) {Human 98.81
d2cdea1114 T-cell antigen receptor {Human (Homo sapiens), bet 98.81
d1vcaa1109 Vascular cell adhesion molecule-1 (VCAM-1) {Human 98.81
d1hkfa_108 NK cell activating receptor NKP44 {Human (Homo sap 98.79
d2nxyb197 CD4 V-set domains {Human (Homo sapiens) [TaxId: 96 98.77
d2esvd1110 T-cell antigen receptor {Human (Homo sapiens), alp 98.77
d1l6za1107 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t 98.76
d2bnqd1113 T-cell antigen receptor {Human (Homo sapiens), alp 98.76
d1olla293 Ligand binding domain of NK receptor NKp46 {Human 98.76
d2ak4d1114 T-cell antigen receptor {Human (Homo sapiens), alp 98.76
d2atpb1115 CD8 {Mouse (Mus musculus), beta-chain [TaxId: 1009 98.75
d1fo0a_115 T-cell antigen receptor {Mouse (Mus musculus), alp 98.74
d1a0ql1106 Immunoglobulin light chain kappa variable domain, 98.73
d1neua_119 Myelin membrane adhesion molecule P0 {Rat (Rattus 98.73
d1sq2n_112 Novel antigen receptor (against lysozyme) {Nurse s 98.73
d1vesa_113 Novel antigen receptor 12Y-2 {Spotted wobbegong (O 98.72
d1i8ka_106 Immunoglobulin light chain kappa variable domain, 98.69
d1olla195 Ligand binding domain of NK receptor NKp46 {Human 98.69
d2ij0c1118 T-cell antigen receptor {Human (Homo sapiens), bet 98.68
d1dr9a1105 CD80, N-terminal domain {Human (Homo sapiens) [Tax 98.67
d1ospl1107 Immunoglobulin light chain kappa variable domain, 98.66
d1lp9e1115 T-cell antigen receptor {Mouse (Mus musculus), alp 98.66
d1u3ha1110 T-cell antigen receptor {Mouse (Mus musculus), alp 98.66
d1lk2b_99 beta2-microglobulin {Mouse (Mus musculus) [TaxId: 98.66
d1nkra299 Killer cell inhibitory receptor {Human (Homo sapie 98.66
d1h5ba_113 T-cell antigen receptor {Mouse (Mus musculus), alp 98.66
d2rhea_114 Immunoglobulin light chain lambda variable domain, 98.65
d1c5cl1107 Immunoglobulin light chain kappa variable domain, 98.65
d1k5nb_100 beta2-microglobulin {Human (Homo sapiens) [TaxId: 98.65
d1nkra196 Killer cell inhibitory receptor {Human (Homo sapie 98.65
d1ucta296 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 98.65
d1j8hd1115 T-cell antigen receptor {Human (Homo sapiens), alp 98.64
d2aq2a1110 T-cell antigen receptor {Mouse (Mus musculus), bet 98.64
d2g5ra1121 N-terminal domain of sialic acid binding Ig-like l 98.64
d1j1pl_107 Immunoglobulin light chain kappa variable domain, 98.64
d1tjgl1107 Immunoglobulin light chain kappa variable domain, 98.63
d1bd2d1111 T-cell antigen receptor {Human (Homo sapiens), alp 98.62
d2fx7l1108 Immunoglobulin light chain kappa variable domain, 98.62
d1muja1100 Class II MHC alpha chain, C-terminal domain {Mouse 98.62
d1kcvl1107 Immunoglobulin light chain kappa variable domain, 98.61
d1jhll_108 Immunoglobulin light chain kappa variable domain, 98.61
d1op3k1106 Immunoglobulin light chain kappa variable domain, 98.61
d2esve1111 T-cell antigen receptor {Human (Homo sapiens), bet 98.6
d1muja1100 Class II MHC alpha chain, C-terminal domain {Mouse 98.58
d1eaja_124 Coxsackie virus and adenovirus receptor (Car), dom 98.58
d1lk3l1106 Immunoglobulin light chain kappa variable domain, 98.58
d1dr9a295 CD80, second domain {Human (Homo sapiens) [TaxId: 98.57
d1mexl1107 Immunoglobulin light chain kappa variable domain, 98.57
d1rzfl1111 Immunoglobulin light chain lambda variable domain, 98.56
d1i9ea_115 T-cell antigen receptor {Mouse (Mus musculus), alp 98.56
d1lk2b_99 beta2-microglobulin {Mouse (Mus musculus) [TaxId: 98.56
d1mqkl_109 Immunoglobulin light chain kappa variable domain, 98.55
d1nezg_122 CD8 {Mouse (Mus musculus) [TaxId: 10090]} 98.55
d1j8he1113 T-cell antigen receptor {Human (Homo sapiens), bet 98.55
d3frua191 Fc (IgG) receptor, alpha-3 domain {Rat (Rattus nor 98.54
d1kgce1112 T-cell antigen receptor {Human (Homo sapiens), bet 98.54
d8faba1103 Immunoglobulin light chain lambda variable domain, 98.54
d3cx5k1107 Immunoglobulin light chain kappa variable domain, 98.54
d1a0ql1106 Immunoglobulin light chain kappa variable domain, 98.54
d1k5nb_100 beta2-microglobulin {Human (Homo sapiens) [TaxId: 98.54
d1d5il1107 Immunoglobulin light chain kappa variable domain, 98.54
d2ntsp1113 T-cell antigen receptor {Human (Homo sapiens), bet 98.54
d1ucta296 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 98.53
d1dr9a295 CD80, second domain {Human (Homo sapiens) [TaxId: 98.53
d1yqvl1104 Immunoglobulin light chain kappa variable domain, 98.53
d1xeda_116 Polymeric-immunoglobulin receptor, PIGR {Human (Ho 98.53
d3frua191 Fc (IgG) receptor, alpha-3 domain {Rat (Rattus nor 98.52
d1bwwa_109 Immunoglobulin light chain kappa variable domain, 98.52
d1ncna_110 CD86 (b7-2), N-terminal domain {Human (Homo sapien 98.51
d2nxyb197 CD4 V-set domains {Human (Homo sapiens) [TaxId: 96 98.51
d1ogae1114 T-cell antigen receptor {Human (Homo sapiens), bet 98.5
d1w72l1109 Immunoglobulin light chain lambda variable domain, 98.5
d1smoa_113 TREM-1 (triggering receptor expressed on myeloid c 98.49
d1q9ra1113 Immunoglobulin light chain kappa variable domain, 98.49
d1qfoa_118 N-terminal domain of sialoadhesin {Mouse (Mus musc 98.48
d1nfdb1113 T-cell antigen receptor {Mouse (Mus musculus), bet 98.48
d2gj6d194 T-cell antigen receptor {Mouse (Mus musculus), bet 98.48
d1j1pl_107 Immunoglobulin light chain kappa variable domain, 98.48
d1fnga1101 Class II MHC alpha chain, C-terminal domain {Mouse 98.48
d1lgva1112 Immunoglobulin light chain lambda variable domain, 98.47
d1hdmb198 Class II MHC beta chain, C-terminal domain {Human 98.47
d1f3rb2119 Immunoglobulin light chain kappa variable domain, 98.47
d1kgcd1112 T-cell antigen receptor {Human (Homo sapiens), alp 98.47
d1j05a_111 Immunoglobulin light chain kappa variable domain, 98.47
d1hkfa_108 NK cell activating receptor NKP44 {Human (Homo sap 98.46
d1nkra299 Killer cell inhibitory receptor {Human (Homo sapie 98.46
d1olla293 Ligand binding domain of NK receptor NKp46 {Human 98.46
d1i8ka_106 Immunoglobulin light chain kappa variable domain, 98.45
d1c5cl1107 Immunoglobulin light chain kappa variable domain, 98.45
d1ogad1115 T-cell antigen receptor {Human (Homo sapiens), alp 98.45
d1kcvl1107 Immunoglobulin light chain kappa variable domain, 98.45
d1ugna196 Ligand binding domain of lir-1 (ilt2) {Human (Homo 98.44
d1mjul1112 Immunoglobulin light chain kappa variable domain, 98.44
d1ospl1107 Immunoglobulin light chain kappa variable domain, 98.44
d2esvd1110 T-cell antigen receptor {Human (Homo sapiens), alp 98.44
d1akjd_114 CD8 {Human (Homo sapiens) [TaxId: 9606]} 98.43
d2bnub1112 T-cell antigen receptor {Human (Homo sapiens), bet 98.43
d1t7va194 Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Hu 98.43
d1hdmb198 Class II MHC beta chain, C-terminal domain {Human 98.43
d1jhll_108 Immunoglobulin light chain kappa variable domain, 98.43
d2atpb1115 CD8 {Mouse (Mus musculus), beta-chain [TaxId: 1009 98.43
d2gsia1111 Immunoglobulin light chain kappa variable domain, 98.43
d1tjgl1107 Immunoglobulin light chain kappa variable domain, 98.42
d1ymmd196 T-cell antigen receptor {Human (Homo sapiens), alp 98.42
d1fp5a2105 Immunoglobulin heavy chain epsilon constant domain 98.42
d1lk3l1106 Immunoglobulin light chain kappa variable domain, 98.42
d1d5mb198 Class II MHC beta chain, C-terminal domain {Human 98.42
d1ac6a_110 T-cell antigen receptor {Mouse (Mus musculus), alp 98.42
d1dqta_117 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 98.41
d2cdea1114 T-cell antigen receptor {Human (Homo sapiens), bet 98.4
d1ypzf1120 T-cell antigen receptor {Human (Homo sapiens), gam 98.4
d1oaql_110 Immunoglobulin light chain lambda variable domain, 98.4
d1d5mb198 Class II MHC beta chain, C-terminal domain {Human 98.4
d3bp5a1114 Programmed cell death protein 1, PD1, extracellula 98.39
d1fp5a2105 Immunoglobulin heavy chain epsilon constant domain 98.39
d1de4a194 Hemochromatosis protein Hfe, alpha-3 domain {Human 98.39
d1t7va194 Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Hu 98.39
d1n4xl_113 Immunoglobulin light chain kappa variable domain, 98.38
d1q0xl2102 Immunoglobulin light chain lambda constant domain, 98.38
d1op3k1106 Immunoglobulin light chain kappa variable domain, 98.38
d1hxma1120 T-cell antigen receptor {Human (Homo sapiens), gam 98.38
d1ugna298 Ligand binding domain of lir-1 (ilt2) {Human (Homo 98.37
d1tvda_116 T-cell antigen receptor {Human (Homo sapiens), del 98.37
d1fo0b_112 T-cell antigen receptor {Mouse (Mus musculus), bet 98.36
d2cdeb1112 T-cell antigen receptor {Human (Homo sapiens), bet 98.36
d8faba1103 Immunoglobulin light chain lambda variable domain, 98.36
d1d5il1107 Immunoglobulin light chain kappa variable domain, 98.36
d1mexl1107 Immunoglobulin light chain kappa variable domain, 98.36
d1uvqa199 Class II MHC alpha chain, C-terminal domain {Human 98.35
d1uvqa199 Class II MHC alpha chain, C-terminal domain {Human 98.35
d1fnga1101 Class II MHC alpha chain, C-terminal domain {Mouse 98.34
d1xaua_104 B and T lymphocyte attenuator, Btla {Mouse (Mus mu 98.34
d1hxmb2107 T-cell antigen receptor {Human (Homo sapiens), del 98.33
d1neua_119 Myelin membrane adhesion molecule P0 {Rat (Rattus 98.33
d1cd0a_111 Immunoglobulin light chain lambda variable domain, 98.33
d1ow0a2108 Immunoglobulin heavy chain alpha constant domain 3 98.33
d1lp9e1115 T-cell antigen receptor {Mouse (Mus musculus), alp 98.33
d1nfde1108 Immunoglobulin light chain lambda variable domain, 98.32
d1o0va1104 Immunoglobulin heavy chain epsilon constant domain 98.32
d1o0va1104 Immunoglobulin heavy chain epsilon constant domain 98.31
d2bnqd1113 T-cell antigen receptor {Human (Homo sapiens), alp 98.31
d2ak4d1114 T-cell antigen receptor {Human (Homo sapiens), alp 98.31
d1fo0a_115 T-cell antigen receptor {Mouse (Mus musculus), alp 98.31
d1nkra196 Killer cell inhibitory receptor {Human (Homo sapie 98.31
d2rhea_114 Immunoglobulin light chain lambda variable domain, 98.31
d3cx5k1107 Immunoglobulin light chain kappa variable domain, 98.3
d1mjul2107 Immunoglobulin light chain kappa constant domain, 98.3
d2gj6d194 T-cell antigen receptor {Mouse (Mus musculus), bet 98.3
d1u9ka_110 TREM-1 (triggering receptor expressed on myeloid c 98.29
d1f3rb2119 Immunoglobulin light chain kappa variable domain, 98.28
d1hxmb1123 T-cell antigen receptor {Human (Homo sapiens), del 98.28
d2fx7l1108 Immunoglobulin light chain kappa variable domain, 98.28
d1ow0a2108 Immunoglobulin heavy chain alpha constant domain 3 98.27
d2mhaa189 Class I MHC, alpha-3 domain {Mouse (Mus musculus) 98.27
d1bwwa_109 Immunoglobulin light chain kappa variable domain, 98.25
d1uvqb197 Class II MHC beta chain, C-terminal domain {Human 98.25
d1rzfl2102 Immunoglobulin light chain lambda constant domain, 98.25
d1de4a194 Hemochromatosis protein Hfe, alpha-3 domain {Human 98.24
d1j05a_111 Immunoglobulin light chain kappa variable domain, 98.24
d1q0xl2102 Immunoglobulin light chain lambda constant domain, 98.24
d1vesa_113 Novel antigen receptor 12Y-2 {Spotted wobbegong (O 98.23
d1i8lc_118 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 98.23
d1ugna298 Ligand binding domain of lir-1 (ilt2) {Human (Homo 98.23
d1ncwl1112 Immunoglobulin light chain kappa variable domain, 98.23
d1sq2n_112 Novel antigen receptor (against lysozyme) {Nurse s 98.23
d1c5cl2107 Immunoglobulin light chain kappa constant domain, 98.22
d2mhaa189 Class I MHC, alpha-3 domain {Mouse (Mus musculus) 98.21
d1hxmb2107 T-cell antigen receptor {Human (Homo sapiens), del 98.21
d1hdma1103 Class II MHC alpha chain, C-terminal domain {Human 98.21
d1dr9a1105 CD80, N-terminal domain {Human (Homo sapiens) [Tax 98.21
d1ugna196 Ligand binding domain of lir-1 (ilt2) {Human (Homo 98.19
d1q9ra1113 Immunoglobulin light chain kappa variable domain, 98.19
d1oaql_110 Immunoglobulin light chain lambda variable domain, 98.19
d1uvqb197 Class II MHC beta chain, C-terminal domain {Human 98.18
d1rzfl1111 Immunoglobulin light chain lambda variable domain, 98.18
d1yqvl1104 Immunoglobulin light chain kappa variable domain, 98.18
d1mqkl_109 Immunoglobulin light chain kappa variable domain, 98.17
d1i9ea_115 T-cell antigen receptor {Mouse (Mus musculus), alp 98.16
d2ij0c1118 T-cell antigen receptor {Human (Homo sapiens), bet 98.16
d1h5ba_113 T-cell antigen receptor {Mouse (Mus musculus), alp 98.16
d1ymmd196 T-cell antigen receptor {Human (Homo sapiens), alp 98.15
d1igtb4102 Immunoglobulin heavy chain gamma constant domain 3 98.15
d1hdma1103 Class II MHC alpha chain, C-terminal domain {Human 98.15
d1cqka_101 Immunoglobulin heavy chain gamma constant domain 3 98.15
d2gsia1111 Immunoglobulin light chain kappa variable domain, 98.15
d1u3ha1110 T-cell antigen receptor {Mouse (Mus musculus), alp 98.14
d2aq2a1110 T-cell antigen receptor {Mouse (Mus musculus), bet 98.14
d1dqta_117 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 98.14
d1l6xa2102 Immunoglobulin heavy chain gamma constant domain 3 98.13
d1dn0b2105 Immunoglobulin heavy chain mu constant domain 1, C 98.12
d1bd2d1111 T-cell antigen receptor {Human (Homo sapiens), alp 98.12
d1w72l1109 Immunoglobulin light chain lambda variable domain, 98.11
d1i1ca2102 Immunoglobulin heavy chain gamma constant domain 3 98.11
d1j8hd1115 T-cell antigen receptor {Human (Homo sapiens), alp 98.1
d1hyrc194 Class I MHC homolog, alpha-3 domain {Human (Homo s 98.1
d1k5na195 Class I MHC, alpha-3 domain {Human (Homo sapiens) 98.09
d1rzfl2102 Immunoglobulin light chain lambda constant domain, 98.09
d1nfde2104 Immunoglobulin light chain lambda constant domain, 98.08
d1mjul1112 Immunoglobulin light chain kappa variable domain, 98.08
d1kcvh2101 Immunoglobulin heavy chain gamma constant domain 1 98.08
d1lgva1112 Immunoglobulin light chain lambda variable domain, 98.07
d2h26a196 CD1, alpha-3 domain {Human (Homo sapiens), CD1a [T 98.07
d1hyrc194 Class I MHC homolog, alpha-3 domain {Human (Homo s 98.07
d1n4xl_113 Immunoglobulin light chain kappa variable domain, 98.07
d1cd0a_111 Immunoglobulin light chain lambda variable domain, 98.06
d1kcvh2101 Immunoglobulin heavy chain gamma constant domain 1 98.06
d1smoa_113 TREM-1 (triggering receptor expressed on myeloid c 98.05
d3b5ha280 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 98.04
d1k5na195 Class I MHC, alpha-3 domain {Human (Homo sapiens) 98.04
d2g5ra1121 N-terminal domain of sialic acid binding Ig-like l 98.03
d2h26a196 CD1, alpha-3 domain {Human (Homo sapiens), CD1a [T 98.03
d1ogad1115 T-cell antigen receptor {Human (Homo sapiens), alp 98.02
d1kgcd1112 T-cell antigen receptor {Human (Homo sapiens), alp 98.02
d1ogae2127 T-cell antigen receptor {Human (Homo sapiens), bet 98.01
d1mjul2107 Immunoglobulin light chain kappa constant domain, 98.01
d1igtb4102 Immunoglobulin heavy chain gamma constant domain 3 98.01
d3b5ha280 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 98.01
d1ncwl1112 Immunoglobulin light chain kappa variable domain, 98.01
d1xaua_104 B and T lymphocyte attenuator, Btla {Mouse (Mus mu 98.0
d1mjuh2102 Immunoglobulin heavy chain gamma constant domain 1 98.0
d1i8lc_118 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 97.99
d1yjdc1118 CD28 {Human (Homo sapiens) [TaxId: 9606]} 97.99
d2ntsp1113 T-cell antigen receptor {Human (Homo sapiens), bet 97.97
d1ncna_110 CD86 (b7-2), N-terminal domain {Human (Homo sapien 97.97
d1nfde1108 Immunoglobulin light chain lambda variable domain, 97.95
d1ogae1114 T-cell antigen receptor {Human (Homo sapiens), bet 97.94
d1cqka_101 Immunoglobulin heavy chain gamma constant domain 3 97.94
d1mjuh2102 Immunoglobulin heavy chain gamma constant domain 1 97.94
d1c5cl2107 Immunoglobulin light chain kappa constant domain, 97.93
d1fltx_95 Second domain of the Flt-1 receptor {Human (Homo s 97.92
d1dn0b2105 Immunoglobulin heavy chain mu constant domain 1, C 97.89
d1l6xa2102 Immunoglobulin heavy chain gamma constant domain 3 97.89
d1ac6a_110 T-cell antigen receptor {Mouse (Mus musculus), alp 97.89
d1qnzh_119 Immunoglobulin heavy chain variable domain, VH {Mo 97.88
d1i1ca2102 Immunoglobulin heavy chain gamma constant domain 3 97.88
d2agjh1120 Immunoglobulin heavy chain variable domain, VH {En 97.88
d1j8he1113 T-cell antigen receptor {Human (Homo sapiens), bet 97.87
d1nfde2104 Immunoglobulin light chain lambda constant domain, 97.85
d1igtb3119 Immunoglobulin heavy chain gamma constant domain 2 97.85
d1kxvc_119 Camelid IG heavy chain variable domain, VHh {Camel 97.84
d2esve1111 T-cell antigen receptor {Human (Homo sapiens), bet 97.83
d2cdeb1112 T-cell antigen receptor {Human (Homo sapiens), bet 97.8
d1ogae2127 T-cell antigen receptor {Human (Homo sapiens), bet 97.79
d1qfoa_118 N-terminal domain of sialoadhesin {Mouse (Mus musc 97.79
d1u9ka_110 TREM-1 (triggering receptor expressed on myeloid c 97.78
d1nfdb1113 T-cell antigen receptor {Mouse (Mus musculus), bet 97.78
d1kgce1112 T-cell antigen receptor {Human (Homo sapiens), bet 97.77
d1dn0b1120 Immunoglobulin heavy chain variable domain, VH {Hu 97.77
d1f3dh1115 Immunoglobulin heavy chain variable domain, VH {Mo 97.76
d2bnub1112 T-cell antigen receptor {Human (Homo sapiens), bet 97.75
d7fabh1116 Immunoglobulin heavy chain variable domain, VH {Hu 97.75
d1a2yb_116 Immunoglobulin heavy chain variable domain, VH {Mo 97.74
d1c5db1117 Immunoglobulin heavy chain variable domain, VH {Ra 97.74
d1r0ah1123 Immunoglobulin heavy chain variable domain, VH {Mo 97.73
d1fo0b_112 T-cell antigen receptor {Mouse (Mus musculus), bet 97.72
d1hxma1120 T-cell antigen receptor {Human (Homo sapiens), gam 97.72
d1iqdb1117 Immunoglobulin heavy chain variable domain, VH {Hu 97.71
d1etzb1126 Immunoglobulin heavy chain variable domain, VH {Mo 97.71
d1fp5a1103 Immunoglobulin heavy chain epsilon constant domain 97.7
d1c5ch2103 Immunoglobulin heavy chain gamma constant domain 1 97.7
d1u58a198 Immunomodulatory protein m144, alpha-3 domain {Mur 97.7
d1xiwa_91 CD3 epsilon chain ectodomain fragment {Human (Homo 97.69
d1l6xa1105 Immunoglobulin heavy chain gamma constant domain 2 97.69
d1jnhb1117 Immunoglobulin heavy chain variable domain, VH {Mo 97.68
d1nlbh1118 Immunoglobulin heavy chain variable domain, VH {Mo 97.68
d1um5h1117 Immunoglobulin heavy chain variable domain, VH {Mo 97.68
d1jpth1117 Immunoglobulin heavy chain variable domain, VH {En 97.67
d1ai1h1120 Immunoglobulin heavy chain variable domain, VH {Mo 97.67
d1jbja2100 CD3 epsilon chain ectodomain fragment {Mouse (Mus 97.67
d1sjva_107 Camelid IG heavy chain variable domain, VHh {Llama 97.66
d1c5ch2103 Immunoglobulin heavy chain gamma constant domain 1 97.66
d1pg7x1120 Immunoglobulin heavy chain variable domain, VH {Mo 97.65
d2fbjh2102 Immunoglobulin heavy chain alpha constant domain 1 97.65
d1igtb3119 Immunoglobulin heavy chain gamma constant domain 2 97.65
d1zvya1124 Camelid IG heavy chain variable domain, VHh {Camel 97.65
d1ct8b1118 Immunoglobulin heavy chain variable domain, VH {Mo 97.65
d1indh1114 Immunoglobulin heavy chain variable domain, VH {Mo 97.65
d1u58a198 Immunomodulatory protein m144, alpha-3 domain {Mur 97.64
d1mfah1117 Immunoglobulin heavy chain variable domain, VH {Mo 97.64
d1ieha_135 Camelid IG heavy chain variable domain, VHh {Llama 97.63
d1hxmb1123 T-cell antigen receptor {Human (Homo sapiens), del 97.63
d2fbjh1118 Immunoglobulin heavy chain variable domain, VH {Mo 97.63
d2ck0h1109 Immunoglobulin heavy chain variable domain, VH {Mo 97.62
d1ypzf1120 T-cell antigen receptor {Human (Homo sapiens), gam 97.62
d1i1ca1103 Immunoglobulin heavy chain gamma constant domain 2 97.62
d1vgeh1122 Immunoglobulin heavy chain variable domain, VH {Hu 97.61
d2jelh1118 Immunoglobulin heavy chain variable domain, VH {Mo 97.61
d1oari_103 Immunoglobulin heavy chain variable domain, VH {Ra 97.61
d1mqkh_123 Immunoglobulin heavy chain variable domain, VH {Mo 97.59
d1j05b_121 Immunoglobulin heavy chain variable domain, VH {Mo 97.59
d1rhhb1130 Immunoglobulin heavy chain variable domain, VH {Hu 97.59
d1eapb1119 Immunoglobulin heavy chain variable domain, VH {Mo 97.58
d1i1ca1103 Immunoglobulin heavy chain gamma constant domain 2 97.58
d1lo4h1118 Immunoglobulin heavy chain variable domain, VH {Mo 97.57
d1ncwh1119 Immunoglobulin heavy chain variable domain, VH {Mo 97.57
d1rihh1125 Immunoglobulin heavy chain variable domain, VH {Mo 97.57
d2fx7h1127 Immunoglobulin heavy chain variable domain, VH {Hu 97.56
d1i3ua_127 Camelid IG heavy chain variable domain, VHh {Llama 97.56
d1ol0a_121 Immunoglobulin heavy chain variable domain, VH {En 97.55
d1dlfh_120 Immunoglobulin heavy chain variable domain, VH {Mo 97.55
d1rz7h1119 Immunoglobulin heavy chain variable domain, VH {Hu 97.55
d1mjuh1116 Immunoglobulin heavy chain variable domain, VH {Mo 97.54
d1fp5a1103 Immunoglobulin heavy chain epsilon constant domain 97.53
d2p49b1121 Camelid IG heavy chain variable domain, VHh {Camel 97.53
d1tjgh1132 Immunoglobulin heavy chain variable domain, VH {En 97.52
d1xiwa_91 CD3 epsilon chain ectodomain fragment {Human (Homo 97.52
d1rjca1126 Camelid IG heavy chain variable domain, VHh {Camel 97.51
d1lmka1126 Immunoglobulin heavy chain variable domain, VH {Mo 97.49
d1jbja2100 CD3 epsilon chain ectodomain fragment {Mouse (Mus 97.48
d1l6xa1105 Immunoglobulin heavy chain gamma constant domain 2 97.47
d1n0xh1127 Immunoglobulin heavy chain variable domain, VH {Hu 97.46
d1bz7b1122 Immunoglobulin heavy chain variable domain, VH {Mo 97.45
d1ad9b1120 Immunoglobulin heavy chain variable domain, VH {En 97.45
d1dfbh1126 Immunoglobulin heavy chain variable domain, VH {Hu 97.45
d1op3h1125 Immunoglobulin heavy chain variable domain, VH {En 97.45
d2agjh1120 Immunoglobulin heavy chain variable domain, VH {En 97.44
d2fbjh2102 Immunoglobulin heavy chain alpha constant domain 1 97.43
d1q9rb1122 Immunoglobulin heavy chain variable domain, VH {Mo 97.42
d1pfca_111 Immunoglobulin heavy chain gamma constant domain 3 97.42
d1yjdc1118 CD28 {Human (Homo sapiens) [TaxId: 9606]} 97.4
d2fb4h1127 Immunoglobulin heavy chain variable domain, VH {Hu 97.4
d3cx5j1127 Immunoglobulin heavy chain variable domain, VH {Mo 97.4
d2nxyd1128 Immunoglobulin heavy chain variable domain, VH {Hu 97.39
d1yedb1124 Immunoglobulin heavy chain variable domain, VH {Mo 97.38
d2b1hh1124 Immunoglobulin heavy chain variable domain, VH {En 97.37
d1fn4b1116 Immunoglobulin heavy chain variable domain, VH {Ra 97.37
d1nfdf1121 Immunoglobulin heavy chain variable domain, VH {Ha 97.35
d1hxma286 T-cell antigen receptor {Human (Homo sapiens), gam 97.34
d1rzga1130 Immunoglobulin heavy chain variable domain, VH {Hu 97.34
d7fabh1116 Immunoglobulin heavy chain variable domain, VH {Hu 97.33
d1rzfh1133 Immunoglobulin heavy chain variable domain, VH {Hu 97.33
d1hxma286 T-cell antigen receptor {Human (Homo sapiens), gam 97.31
d3c2ah1131 Immunoglobulin heavy chain variable domain, VH {Hu 97.31
d1kxvc_119 Camelid IG heavy chain variable domain, VHh {Camel 97.29
d1zvya1124 Camelid IG heavy chain variable domain, VHh {Camel 97.27
d1qnzh_119 Immunoglobulin heavy chain variable domain, VH {Mo 97.25
d1pfca_111 Immunoglobulin heavy chain gamma constant domain 3 97.23
d1c5db1117 Immunoglobulin heavy chain variable domain, VH {Ra 97.23
d1jpth1117 Immunoglobulin heavy chain variable domain, VH {En 97.21
d1jbja186 CD3 gamma chain ectodomain fragment {Mouse (Mus mu 97.21
d1oari_103 Immunoglobulin heavy chain variable domain, VH {Ra 97.18
d1um5h1117 Immunoglobulin heavy chain variable domain, VH {Mo 97.16
d1pg7x1120 Immunoglobulin heavy chain variable domain, VH {Mo 97.16
d1r0ah1123 Immunoglobulin heavy chain variable domain, VH {Mo 97.16
d1a2yb_116 Immunoglobulin heavy chain variable domain, VH {Mo 97.15
d1dn0b1120 Immunoglobulin heavy chain variable domain, VH {Hu 97.15
d1fn4b1116 Immunoglobulin heavy chain variable domain, VH {Ra 97.15
d2fbjh1118 Immunoglobulin heavy chain variable domain, VH {Mo 97.14
d1i3ua_127 Camelid IG heavy chain variable domain, VHh {Llama 97.14
d3d85d187 The p40 domain of interleukin-12 (IL-12 beta chain 97.14
d3d85d187 The p40 domain of interleukin-12 (IL-12 beta chain 97.13
d1vgeh1122 Immunoglobulin heavy chain variable domain, VH {Hu 97.12
d1sjva_107 Camelid IG heavy chain variable domain, VHh {Llama 97.11
d1bz7b1122 Immunoglobulin heavy chain variable domain, VH {Mo 97.09
d1j05b_121 Immunoglobulin heavy chain variable domain, VH {Mo 97.08
d1jnhb1117 Immunoglobulin heavy chain variable domain, VH {Mo 97.07
d1iqdb1117 Immunoglobulin heavy chain variable domain, VH {Hu 97.04
d1indh1114 Immunoglobulin heavy chain variable domain, VH {Mo 97.04
d1ai1h1120 Immunoglobulin heavy chain variable domain, VH {Mo 97.04
d1rjca1126 Camelid IG heavy chain variable domain, VHh {Camel 97.03
d1mqkh_123 Immunoglobulin heavy chain variable domain, VH {Mo 97.03
d1etzb1126 Immunoglobulin heavy chain variable domain, VH {Mo 97.02
d2ck0h1109 Immunoglobulin heavy chain variable domain, VH {Mo 97.02
d1ct8b1118 Immunoglobulin heavy chain variable domain, VH {Mo 97.01
d3cx5j1127 Immunoglobulin heavy chain variable domain, VH {Mo 97.01
d1mfah1117 Immunoglobulin heavy chain variable domain, VH {Mo 97.0
d1b2wh1117 Immunoglobulin heavy chain variable domain, VH {En 97.0
d1ieha_135 Camelid IG heavy chain variable domain, VHh {Llama 96.99
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Immunoglobulin
family: I set domains
domain: Telokin
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.80  E-value=7e-19  Score=107.75  Aligned_cols=97  Identities=23%  Similarity=0.389  Sum_probs=83.5

Q ss_pred             CCccCCCCCcccccCCeEEEEEEeeCCCCCceeEEEECCeeecCCCceEEEEeeeeceEEEEeecCCCCCeeEEEEEEeC
Q psy11132         10 PKLSPTNPERTLNVGERASLICSITKGDIPLTIKWLKDGRYLDNSAALSITHVDQYNSMLVIDSVSARHSGNYSCTVRNM   89 (243)
Q Consensus        10 p~~~~~~~~~~~~~g~~~~l~C~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~G~Y~C~~~~~   89 (243)
                      |.|...+.+..+.+|+.+.|.|.+. +.|.+.+.|++++..+....++.+.... ..+.|.|.+++.+|+|.|+|.+.|.
T Consensus         1 P~~~~~p~~~~v~~G~~~~l~C~v~-g~p~p~v~W~k~~~~l~~~~~~~~~~~~-~~~~L~I~~~~~~D~G~Y~C~a~N~   78 (101)
T d2cqva1           1 PQIIQFPEDQKVRAGESVELFGKVT-GTQPITCTWMKFRKQIQESEHMKVENSE-NGSKLTILAARQEHCGCYTLLVENK   78 (101)
T ss_dssp             CEESCCCCSEEEETTCCEEEEEEEE-SSSSCEEEEEESSSBCCCSSSEEEEECS-SEEEEEETTCCTTTCEEEEEEEECS
T ss_pred             CeEEeeCCcEEEeCCCcEEEEEEEE-ecCCCEEEEEeCceeeccCCcEEEEEec-ceeEEEEeeCCcccCEEEEEEEEEC
Confidence            5566667788899999999999995 8888899999999999888877765543 3578999999999999999999999


Q ss_pred             CCcceeEEEEEEEcCCCcc
Q psy11132         90 VAEDTQVQRLIVNVPPKIE  108 (243)
Q Consensus        90 ~~~~~~~~~l~v~~~p~~~  108 (243)
                      .|..+..+.|.|.+.|..+
T Consensus        79 ~G~~~~~~~l~V~~~P~pP   97 (101)
T d2cqva1          79 LGSRQAQVNLTVVDKPDPP   97 (101)
T ss_dssp             SCEEECCEEEEEECSCSCC
T ss_pred             CCEEEEEEEEEEEecCCCc
Confidence            9999999999999877543



>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Back     information, alignment and structure
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3bp5a1 b.1.1.1 (A:1-114) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tvda_ b.1.1.1 (A:) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1akjd_ b.1.1.1 (D:) CD8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa1 b.1.1.3 (A:91-199) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cdea1 b.1.1.1 (A:2-115) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa1 b.1.1.3 (A:91-199) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2esvd1 b.1.1.1 (D:4-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bnqd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1olla2 b.1.1.4 (A:96-188) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak4d1 b.1.1.1 (D:1-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d2atpb1 b.1.1.1 (B:1-115) CD8 {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1fo0a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sq2n_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} Back     information, alignment and structure
>d1vesa_ b.1.1.1 (A:) Novel antigen receptor 12Y-2 {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]} Back     information, alignment and structure
>d1i8ka_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ij0c1 b.1.1.1 (C:1-117) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ospl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1lp9e1 b.1.1.1 (E:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1u3ha1 b.1.1.1 (A:2-116) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1lk2b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nkra2 b.1.1.4 (A:102-200) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d1h5ba_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d2rhea_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d1c5cl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1k5nb_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkra1 b.1.1.4 (A:6-101) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d1ucta2 b.1.1.4 (A:101-196) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8hd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d2aq2a1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d2g5ra1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j1pl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1tjgl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1bd2d1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d2fx7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]} Back     information, alignment and structure
>d1muja1 b.1.1.2 (A:84-183) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} Back     information, alignment and structure
>d1kcvl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1jhll_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1op3k1 b.1.1.1 (K:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d2esve1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1muja1 b.1.1.2 (A:84-183) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} Back     information, alignment and structure
>d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lk3l1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dr9a2 b.1.1.3 (A:106-200) CD80, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mexl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1rzfl1 b.1.1.1 (L:2-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d1i9ea_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1lk2b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mqkl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j8he1 b.1.1.1 (E:2-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d3frua1 b.1.1.2 (A:179-269) Fc (IgG) receptor, alpha-3 domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kgce1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d8faba1 b.1.1.1 (A:3-105) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d3cx5k1 b.1.1.1 (K:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1k5nb_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d5il1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2ntsp1 b.1.1.1 (P:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ucta2 b.1.1.4 (A:101-196) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dr9a2 b.1.1.3 (A:106-200) CD80, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yqvl1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3frua1 b.1.1.2 (A:179-269) Fc (IgG) receptor, alpha-3 domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bwwa_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1ncna_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogae1 b.1.1.1 (E:5-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1w72l1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1smoa_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q9ra1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]} Back     information, alignment and structure
>d1qfoa_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nfdb1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d2gj6d1 b.1.1.1 (D:15-114) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1j1pl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1fnga1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]} Back     information, alignment and structure
>d1lgva1 b.1.1.1 (A:1-112) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]} Back     information, alignment and structure
>d1hdmb1 b.1.1.2 (B:88-185) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} Back     information, alignment and structure
>d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kgcd1 b.1.1.1 (D:2-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1j05a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkra2 b.1.1.4 (A:102-200) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d1olla2 b.1.1.4 (A:96-188) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i8ka_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1c5cl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1ogad1 b.1.1.1 (D:3-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1kcvl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1ugna1 b.1.1.4 (A:2-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mjul1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1ospl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2esvd1 b.1.1.1 (D:4-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1akjd_ b.1.1.1 (D:) CD8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnub1 b.1.1.1 (B:2-113) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1t7va1 b.1.1.2 (A:184-277) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdmb1 b.1.1.2 (B:88-185) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} Back     information, alignment and structure
>d1jhll_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2atpb1 b.1.1.1 (B:1-115) CD8 {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d2gsia1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1tjgl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1ymmd1 b.1.1.1 (D:9-104) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1fp5a2 b.1.1.2 (A:439-543) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lk3l1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1d5mb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} Back     information, alignment and structure
>d1ac6a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1dqta_ b.1.1.1 (A:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cdea1 b.1.1.1 (A:2-115) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ypzf1 b.1.1.1 (F:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1oaql_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1d5mb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} Back     information, alignment and structure
>d3bp5a1 b.1.1.1 (A:1-114) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fp5a2 b.1.1.2 (A:439-543) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1de4a1 b.1.1.2 (A:182-275) Hemochromatosis protein Hfe, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t7va1 b.1.1.2 (A:184-277) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n4xl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1q0xl2 b.1.1.2 (L:108-212) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1op3k1 b.1.1.1 (K:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1hxma1 b.1.1.1 (A:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ugna2 b.1.1.4 (A:98-195) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tvda_ b.1.1.1 (A:) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1fo0b_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d2cdeb1 b.1.1.1 (B:5-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d8faba1 b.1.1.1 (A:3-105) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1d5il1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1mexl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1uvqa1 b.1.1.2 (A:85-183) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} Back     information, alignment and structure
>d1uvqa1 b.1.1.2 (A:85-183) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} Back     information, alignment and structure
>d1fnga1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]} Back     information, alignment and structure
>d1xaua_ b.1.1.4 (A:) B and T lymphocyte attenuator, Btla {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxmb2 b.1.1.2 (B:124-230) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cd0a_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1ow0a2 b.1.1.2 (A:343-450) Immunoglobulin heavy chain alpha constant domain 3, CH3-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lp9e1 b.1.1.1 (E:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1nfde1 b.1.1.1 (E:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1o0va1 b.1.1.2 (A:228-330) Immunoglobulin heavy chain epsilon constant domain 2, CH2-epsilon {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0va1 b.1.1.2 (A:228-330) Immunoglobulin heavy chain epsilon constant domain 2, CH2-epsilon {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnqd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d2ak4d1 b.1.1.1 (D:1-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1fo0a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1nkra1 b.1.1.4 (A:6-101) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d2rhea_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d3cx5k1 b.1.1.1 (K:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1mjul2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gj6d1 b.1.1.1 (D:15-114) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1u9ka_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hxmb1 b.1.1.1 (B:1-123) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2fx7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]} Back     information, alignment and structure
>d1ow0a2 b.1.1.2 (A:343-450) Immunoglobulin heavy chain alpha constant domain 3, CH3-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mhaa1 b.1.1.2 (A:182-270) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bwwa_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1uvqb1 b.1.1.2 (B:95-191) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} Back     information, alignment and structure
>d1rzfl2 b.1.1.2 (L:109-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1de4a1 b.1.1.2 (A:182-275) Hemochromatosis protein Hfe, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j05a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1q0xl2 b.1.1.2 (L:108-212) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vesa_ b.1.1.1 (A:) Novel antigen receptor 12Y-2 {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]} Back     information, alignment and structure
>d1i8lc_ b.1.1.1 (C:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugna2 b.1.1.4 (A:98-195) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncwl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1sq2n_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} Back     information, alignment and structure
>d1c5cl2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mhaa1 b.1.1.2 (A:182-270) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxmb2 b.1.1.2 (B:124-230) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1hdma1 b.1.1.2 (A:94-196) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} Back     information, alignment and structure
>d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugna1 b.1.1.4 (A:2-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q9ra1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]} Back     information, alignment and structure
>d1oaql_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uvqb1 b.1.1.2 (B:95-191) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} Back     information, alignment and structure
>d1rzfl1 b.1.1.1 (L:2-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d1yqvl1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1mqkl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1i9ea_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d2ij0c1 b.1.1.1 (C:1-117) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1h5ba_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1ymmd1 b.1.1.1 (D:9-104) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1igtb4 b.1.1.2 (B:363-474) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus), gamma2 [TaxId: 10090]} Back     information, alignment and structure
>d1hdma1 b.1.1.2 (A:94-196) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} Back     information, alignment and structure
>d1cqka_ b.1.1.2 (A:) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gsia1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1u3ha1 b.1.1.1 (A:2-116) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d2aq2a1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1dqta_ b.1.1.1 (A:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l6xa2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dn0b2 b.1.1.2 (B:121-225) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd2d1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1w72l1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1i1ca2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1j8hd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1hyrc1 b.1.1.2 (C:181-274) Class I MHC homolog, alpha-3 domain {Human (Homo sapiens), Mic-a [TaxId: 9606]} Back     information, alignment and structure
>d1k5na1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzfl2 b.1.1.2 (L:109-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nfde2 b.1.1.2 (E:108-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1mjul1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1kcvh2 b.1.1.2 (H:117-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lgva1 b.1.1.1 (A:1-112) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]} Back     information, alignment and structure
>d2h26a1 b.1.1.2 (A:184-279) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]} Back     information, alignment and structure
>d1hyrc1 b.1.1.2 (C:181-274) Class I MHC homolog, alpha-3 domain {Human (Homo sapiens), Mic-a [TaxId: 9606]} Back     information, alignment and structure
>d1n4xl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1cd0a_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1kcvh2 b.1.1.2 (H:117-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1smoa_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b5ha2 b.1.1.4 (A:23-102) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k5na1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g5ra1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h26a1 b.1.1.2 (A:184-279) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]} Back     information, alignment and structure
>d1ogad1 b.1.1.1 (D:3-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1kgcd1 b.1.1.1 (D:2-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ogae2 b.1.1.2 (E:119-245) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1mjul2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1igtb4 b.1.1.2 (B:363-474) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus), gamma2 [TaxId: 10090]} Back     information, alignment and structure
>d3b5ha2 b.1.1.4 (A:23-102) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncwl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1xaua_ b.1.1.4 (A:) B and T lymphocyte attenuator, Btla {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mjuh2 b.1.1.2 (H:114-230) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i8lc_ b.1.1.1 (C:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yjdc1 b.1.1.1 (C:1-118) CD28 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ntsp1 b.1.1.1 (P:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ncna_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nfde1 b.1.1.1 (E:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ogae1 b.1.1.1 (E:5-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1cqka_ b.1.1.2 (A:) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mjuh2 b.1.1.2 (H:114-230) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c5cl2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fltx_ b.1.1.4 (X:) Second domain of the Flt-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dn0b2 b.1.1.2 (B:121-225) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6xa2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ac6a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1qnzh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1i1ca2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2agjh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1j8he1 b.1.1.1 (E:2-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1nfde2 b.1.1.2 (E:108-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1igtb3 b.1.1.2 (B:236-361) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Mouse (Mus musculus), gamma2 [TaxId: 10090]} Back     information, alignment and structure
>d1kxvc_ b.1.1.1 (C:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d2esve1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2cdeb1 b.1.1.1 (B:5-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ogae2 b.1.1.2 (E:119-245) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1qfoa_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u9ka_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nfdb1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1kgce1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1dn0b1 b.1.1.1 (B:1-120) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} Back     information, alignment and structure
>d1f3dh1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d2bnub1 b.1.1.1 (B:2-113) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d7fabh1 b.1.1.1 (H:1-116) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} Back     information, alignment and structure
>d1a2yb_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]} Back     information, alignment and structure
>d1c5db1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r0ah1 b.1.1.1 (H:1-123) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} Back     information, alignment and structure
>d1fo0b_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1hxma1 b.1.1.1 (A:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1iqdb1 b.1.1.1 (B:1-114) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1etzb1 b.1.1.1 (B:1-126) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} Back     information, alignment and structure
>d1fp5a1 b.1.1.2 (A:336-438) Immunoglobulin heavy chain epsilon constant domain 3, CH3-epsilon {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c5ch2 b.1.1.2 (H:114-230) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u58a1 b.1.1.2 (A:145-242) Immunomodulatory protein m144, alpha-3 domain {Murine cytomegalovirus [TaxId: 10366]} Back     information, alignment and structure
>d1xiwa_ b.1.1.4 (A:) CD3 epsilon chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6xa1 b.1.1.2 (A:237-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jnhb1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1nlbh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1um5h1 b.1.1.1 (H:3-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1jpth1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1ai1h1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.3 [TaxId: 10090]} Back     information, alignment and structure
>d1jbja2 b.1.1.4 (A:1-100) CD3 epsilon chain ectodomain fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sjva_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d1c5ch2 b.1.1.2 (H:114-230) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pg7x1 b.1.1.1 (X:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d2fbjh2 b.1.1.2 (H:119-220) Immunoglobulin heavy chain alpha constant domain 1, CH1-alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1igtb3 b.1.1.2 (B:236-361) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Mouse (Mus musculus), gamma2 [TaxId: 10090]} Back     information, alignment and structure
>d1zvya1 b.1.1.1 (A:2-125) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1ct8b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.3 [TaxId: 10090]} Back     information, alignment and structure
>d1indh1 b.1.1.1 (H:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1u58a1 b.1.1.2 (A:145-242) Immunomodulatory protein m144, alpha-3 domain {Murine cytomegalovirus [TaxId: 10366]} Back     information, alignment and structure
>d1mfah1 b.1.1.1 (H:251-367) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1ieha_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d1hxmb1 b.1.1.1 (B:1-123) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2fbjh1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d2ck0h1 b.1.1.1 (H:1-106) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d1ypzf1 b.1.1.1 (F:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1i1ca1 b.1.1.2 (A:239-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vgeh1 b.1.1.1 (H:1-122) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d2jelh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1oari_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mqkh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1j05b_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1rhhb1 b.1.1.1 (B:3-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1eapb1 b.1.1.1 (B:1-124) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1i1ca1 b.1.1.2 (A:239-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lo4h1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1 [TaxId: 10090]} Back     information, alignment and structure
>d1ncwh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]} Back     information, alignment and structure
>d1rihh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d2fx7h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1i3ua_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d1ol0a_ b.1.1.1 (A:) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1dlfh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d1rz7h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1mjuh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1fp5a1 b.1.1.2 (A:336-438) Immunoglobulin heavy chain epsilon constant domain 3, CH3-epsilon {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p49b1 b.1.1.1 (B:1-121) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1tjgh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1xiwa_ b.1.1.4 (A:) CD3 epsilon chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjca1 b.1.1.1 (A:2-127) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1lmka1 b.1.1.1 (A:2-127) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1jbja2 b.1.1.4 (A:1-100) CD3 epsilon chain ectodomain fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l6xa1 b.1.1.2 (A:237-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0xh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1bz7b1 b.1.1.1 (B:1-122) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1ad9b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1dfbh1 b.1.1.1 (H:1-126) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]} Back     information, alignment and structure
>d1op3h1 b.1.1.1 (H:1-115) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d2agjh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d2fbjh2 b.1.1.2 (H:119-220) Immunoglobulin heavy chain alpha constant domain 1, CH1-alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q9rb1 b.1.1.1 (B:1-111) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d1pfca_ b.1.1.2 (A:) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1yjdc1 b.1.1.1 (C:1-118) CD28 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fb4h1 b.1.1.1 (H:1-119) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]} Back     information, alignment and structure
>d3cx5j1 b.1.1.1 (J:1-127) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]} Back     information, alignment and structure
>d2nxyd1 b.1.1.1 (D:3001-3128) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1yedb1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d2b1hh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1fn4b1 b.1.1.1 (B:1-106) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nfdf1 b.1.1.1 (F:1-114) Immunoglobulin heavy chain variable domain, VH {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1hxma2 b.1.1.2 (A:121-206) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1rzga1 b.1.1.1 (A:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d7fabh1 b.1.1.1 (H:1-116) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} Back     information, alignment and structure
>d1rzfh1 b.1.1.1 (H:2-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1hxma2 b.1.1.2 (A:121-206) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d3c2ah1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 4 [TaxId: 9606]} Back     information, alignment and structure
>d1kxvc_ b.1.1.1 (C:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1zvya1 b.1.1.1 (A:2-125) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1qnzh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1pfca_ b.1.1.2 (A:) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1c5db1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jpth1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1jbja1 b.1.1.4 (A:101-186) CD3 gamma chain ectodomain fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oari_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1um5h1 b.1.1.1 (H:3-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1pg7x1 b.1.1.1 (X:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1r0ah1 b.1.1.1 (H:1-123) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} Back     information, alignment and structure
>d1a2yb_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]} Back     information, alignment and structure
>d1dn0b1 b.1.1.1 (B:1-120) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} Back     information, alignment and structure
>d1fn4b1 b.1.1.1 (B:1-106) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fbjh1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1i3ua_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d3d85d1 b.1.1.4 (D:1-87) The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d85d1 b.1.1.4 (D:1-87) The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vgeh1 b.1.1.1 (H:1-122) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1sjva_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d1bz7b1 b.1.1.1 (B:1-122) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1j05b_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1jnhb1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1iqdb1 b.1.1.1 (B:1-114) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1indh1 b.1.1.1 (H:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1ai1h1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.3 [TaxId: 10090]} Back     information, alignment and structure
>d1rjca1 b.1.1.1 (A:2-127) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1mqkh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1etzb1 b.1.1.1 (B:1-126) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} Back     information, alignment and structure
>d2ck0h1 b.1.1.1 (H:1-106) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d1ct8b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.3 [TaxId: 10090]} Back     information, alignment and structure
>d3cx5j1 b.1.1.1 (J:1-127) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]} Back     information, alignment and structure
>d1mfah1 b.1.1.1 (H:251-367) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1b2wh1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1ieha_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure