Psyllid ID: psy11185


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310--
MNKRNHKEHAPKGNLKDKVDSGLECAGFLNGLGFNATVMIRSVPLRGFDQQMAKLICEEMAEGGVHFLHKCLPLSVTKLADGKLKVQYKNVAEVRQDNTHKYDYDLLVLGGGSGGLAAAKEAAAHGRKVIVLDYVIPSPQGTTWGLGGTCVNVGCIPKKLMHQAALLGEAIKDAVAYGWEIPNVKSVQHNWANLREAVQNHVKSVNWVTRVMLRDKKVDYLNALGKFIDQHSVEATMKNGEKKTLTAENILIATGGRPNYPDIPGAKEHCISSDDIFSLEKPPGKTLVVGAGYIGKLETWDSNSGCGNVTIH
ccccccccccccEEEEEcccEEEEHHHHHHcccccEEEEEccccccccHHHHHHHHHHHHHHccccccccccccEEEEccccccEEEEEcccEEcccccccccEEEEEEcccccHHHHHHHHHHcccEEEEEEEcccccccccccccccEEEccccHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHcHHHHHHcccccccEEEEEEEEEEcccEEEEEEccccEEEEEccEEEEEcccccccccccccccccccccccccccccccEEEEEcccccHHHHHHHHHccccccccc
cccccccccccccccHcHHHHHHHHHHHHHcccccEEEEEEEEHHccccHHHHHHHHHHHHHccccEEccccccEEEEccccccEEEEEEEEcccccccccccccEEEEcccHHHHHHHHHHHHccccEEEEEEcccccccccccccHHHHHHcHHHHHHHHHHHHHHHHHccccccccEcccccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEcccEEEccEEEEccEEEEcccEEEcccEEEcccccccHHHHcEcHHHHccccccccEEEEEcccHHHHHHHHHHHHccccEEEc
mnkrnhkehapkgnlkdkvdsglecagflnglgfnATVMIrsvplrgfDQQMAKLICEEMAEggvhflhkclplsvtkladgklkVQYKNVAEvrqdnthkydydllvlgggsgGLAAAKEAAAHGRKVIVLDyvipspqgttwglggtcvnvgcipKKLMHQAALLGEAIKDAVAygweipnvksVQHNWANLREAVQNHVKSVNWVTRVMLRDKKVDYLNALGKFIDQHSVEATMkngekktlTAENILIatggrpnypdipgakehcissddifslekppgktlvvgagyigkletwdsnsgcgnvtih
mnkrnhkehapkgnlkdkvdSGLECAGFLNGLGFNATVMIRSVPLRGFDQQMAKLICEEMAEGGVHFLHKCLPLSVTKLADGKLKVQYKNVaevrqdnthkYDYDLLVLGGGSGGLAAAKEAAAHGRKVIVLDYVIPSpqgttwglgGTCVNVGCIPKKLMHQAALLGEAIKDAVAYGWEIPNVKSVQHNWANLREAVQNHVKSVNWVTRVMLRDKKVDYLNALGKFIDQHSVEatmkngekktLTAENILIATGGRPNYPDIPGAKEHCISSDDIFSLEKPPGKTLVVGAGYIGkletwdsnsgcgnvtih
MNKRNHKEHAPKGNLKDKVDSGLECAGFLNGLGFNATVMIRSVPLRGFDQQMAKLICEEMAEGGVHFLHKCLPLSVTKLADGKLKVQYKNVAEVRQDNTHKYDYDllvlgggsgglaaakeaaahgRKVIVLDYVIPSPQGTTWGLGGTCVNVGCIPKKLMHQAALLGEAIKDAVAYGWEIPNVKSVQHNWANLREAVQNHVKSVNWVTRVMLRDKKVDYLNALGKFIDQHSVEATMKNGEKKTLTAENILIATGGRPNYPDIPGAKEHCISSDDIFSLEKPPGKTLVVGAGYIGKLETWDSNSGCGNVTIH
*********************GLECAGFLNGLGFNATVMIRSVPLRGFDQQMAKLICEEMAEGGVHFLHKCLPLSVTKLADGKLKVQYKNVAEVRQDNTHKYDYDLLVLGGGSGGLAAAKEAAAHGRKVIVLDYVIPSPQGTTWGLGGTCVNVGCIPKKLMHQAALLGEAIKDAVAYGWEIPNVKSVQHNWANLREAVQNHVKSVNWVTRVMLRDKKVDYLNALGKFIDQHSVEAT******KTLTAENILIATGGRPNYPDIPGAKEHCISSDDIFSLEKPPGKTLVVGAGYIGKLETWDSNSGC******
*******EHAPKGNLKDKVDSGLECAGFLNGLGFNATVMIRSVPLRGFDQQMAKLICEEMAEGGVHFLHKCLPLSVTKLADGKLKVQYKNVAEVRQDNTHKYDYDLLVLGGGSGGLAAAKEAAAHGRKVIVLDYVIPSPQGTTWGLGGTCVNVGCIPKKLMHQAALLGEAIKDAVAYGWEIPNVKSVQHNWANLREAVQNHVKSVNWVTRVMLRDKKVDYLNALGKFIDQHSVEATMKNGEKKTLTAENILIATGGRPNYPDIPGAKEHCISSDDIFSLEKPPGKTLVVGAGYIGKLETWDSNSGCGNVT**
**************LKDKVDSGLECAGFLNGLGFNATVMIRSVPLRGFDQQMAKLICEEMAEGGVHFLHKCLPLSVTKLADGKLKVQYKNVAEVRQDNTHKYDYDLLVLGGGSGGLAAAKEAAAHGRKVIVLDYVIPSPQGTTWGLGGTCVNVGCIPKKLMHQAALLGEAIKDAVAYGWEIPNVKSVQHNWANLREAVQNHVKSVNWVTRVMLRDKKVDYLNALGKFIDQHSVEATMKNGEKKTLTAENILIATGGRPNYPDIPGAKEHCISSDDIFSLEKPPGKTLVVGAGYIGKLETWDSNSGCGNVTIH
*************NLKDKVDSGLECAGFLNGLGFNATVMIRSVPLRGFDQQMAKLICEEMAEGGVHFLHKCLPLSVTKLADGKLKVQYKNVAEVRQDNTHKYDYDLLVLGGGSGGLAAAKEAAAHGRKVIVLDYVIPSPQGTTWGLGGTCVNVGCIPKKLMHQAALLGEAIKDAVAYGWEIPNVKSVQHNWANLREAVQNHVKSVNWVTRVMLRDKKVDYLNALGKFIDQHSVEATMKNGEKKTLTAENILIATGGRPNYPDIPGAKEHCISSDDIFSLEKPPGKTLVVGAGYIGKLETWDSNSGCGNVTIH
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNKRNHKEHAPKGNLKDKVDSGLECAGFLNGLGFNATVMIRSVPLRGFDQQMAKLICEEMAEGGVHFLHKCLPLSVTKLADGKLKVQYKNVAEVRQDNTHKYDYDLLVLGGGSGGLAAAKEAAAHGRKVIVLDYVIPSPQGTTWGLGGTCVNVGCIPKKLMHQAALLGEAIKDAVAYGWEIPNVKSVQHNWANLREAVQNHVKSVNWVTRVMLRDKKVDYLNALGKFIDQHSVEATMKNGEKKTLTAENILIATGGRPNYPDIPGAKEHCISSDDIFSLEKPPGKTLVVGAGYIGKLETWDSNSGCGNVTIH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query312 2.2.26 [Sep-21-2011]
P91938 596 Thioredoxin reductase 1, no N/A 0.637 0.333 0.624 3e-70
Q9VNT5 516 Thioredoxin reductase 2, no N/A 0.621 0.375 0.622 4e-70
Q9JLT4 524 Thioredoxin reductase 2, yes N/A 0.615 0.366 0.635 3e-66
Q9Z0J5 526 Thioredoxin reductase 2, no N/A 0.615 0.365 0.635 5e-66
Q9N2I8 511 Thioredoxin reductase 2, no N/A 0.602 0.367 0.651 1e-65
B9A1H3 495 Thioredoxin reductase SEP N/A N/A 0.602 0.379 0.617 3e-64
Q16881 649 Thioredoxin reductase 1, yes N/A 0.631 0.303 0.628 2e-61
Q5NVA2 499 Thioredoxin reductase 1, yes N/A 0.631 0.394 0.623 4e-61
Q99MD6 697 Thioredoxin reductase 3 ( no N/A 0.634 0.284 0.603 9e-61
O62768 499 Thioredoxin reductase 1, no N/A 0.631 0.394 0.618 2e-60
>sp|P91938|TRXR1_DROME Thioredoxin reductase 1, mitochondrial OS=Drosophila melanogaster GN=Trxr-1 PE=1 SV=2 Back     alignment and function desciption
 Score =  265 bits (678), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 164/205 (80%), Gaps = 6/205 (2%)

Query: 94  VRQDNTH--KYDYDLLVLGGGSGGLAAAKEAAAHGRKVIVLDYVIPSPQ-GTTWGLGGTC 150
           VR+ +T    YDYDL+V+GGGS GLA AKEA  +G +V  LD+V P+P  GT WG+GGTC
Sbjct: 103 VRKMSTKGGSYDYDLIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTC 162

Query: 151 VNVGCIPKKLMHQAALLGEAIKDAVAYGWEIPNVKSVQHNWANLREAVQNHVKSVNWVTR 210
           VNVGCIPKKLMHQA+LLGEA+ +A AYGW +   + ++ +W  L ++VQNH+KSVNWVTR
Sbjct: 163 VNVGCIPKKLMHQASLLGEAVHEAAAYGWNVD--EKIKPDWHKLVQSVQNHIKSVNWVTR 220

Query: 211 VMLRDKKVDYLNALGKFIDQHSVEATMKNGEKKTLTAENILIATGGRPNYPDIPGAKEHC 270
           V LRDKKV+Y+N LG F+D H++ A +K+GE+ T+TA+  +IA GGRP YPDIPGA E+ 
Sbjct: 221 VDLRDKKVEYINGLGSFVDSHTLLAKLKSGER-TITAQTFVIAVGGRPRYPDIPGAVEYG 279

Query: 271 ISSDDIFSLEKPPGKTLVVGAGYIG 295
           I+SDD+FSL++ PGKTLVVGAGYIG
Sbjct: 280 ITSDDLFSLDREPGKTLVVGAGYIG 304




Thioredoxin system is a major player in glutathione metabolism, due to the demonstrated absence of a glutathione reductase. Functionally interacts with the Sod/Cat reactive oxidation species (ROS) defense system and thereby has a role in preadult development and life span. Lack of a glutathione reductase suggests antioxidant defense in Drosophila, and probably in related insects, differs fundamentally from that in other organisms.
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 8EC: .EC: 1EC: .EC: 9
>sp|Q9VNT5|TRXR2_DROME Thioredoxin reductase 2, mitochondrial OS=Drosophila melanogaster GN=Trxr-2 PE=2 SV=1 Back     alignment and function description
>sp|Q9JLT4|TRXR2_MOUSE Thioredoxin reductase 2, mitochondrial OS=Mus musculus GN=Txnrd2 PE=1 SV=4 Back     alignment and function description
>sp|Q9Z0J5|TRXR2_RAT Thioredoxin reductase 2, mitochondrial OS=Rattus norvegicus GN=Txnrd2 PE=1 SV=3 Back     alignment and function description
>sp|Q9N2I8|TRXR2_BOVIN Thioredoxin reductase 2, mitochondrial OS=Bos taurus GN=TXNRD2 PE=1 SV=2 Back     alignment and function description
>sp|B9A1H3|TRXR1_EMIHU Thioredoxin reductase SEP1 OS=Emiliania huxleyi GN=SEP1 PE=1 SV=1 Back     alignment and function description
>sp|Q16881|TRXR1_HUMAN Thioredoxin reductase 1, cytoplasmic OS=Homo sapiens GN=TXNRD1 PE=1 SV=3 Back     alignment and function description
>sp|Q5NVA2|TRXR1_PONAB Thioredoxin reductase 1, cytoplasmic OS=Pongo abelii GN=TXNRD1 PE=2 SV=3 Back     alignment and function description
>sp|Q99MD6|TRXR3_MOUSE Thioredoxin reductase 3 (Fragment) OS=Mus musculus GN=Txnrd3 PE=1 SV=2 Back     alignment and function description
>sp|O62768|TRXR1_BOVIN Thioredoxin reductase 1, cytoplasmic OS=Bos taurus GN=TXNRD1 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query312
1848294 495 glutathione reductase family member [Mus 0.628 0.395 0.705 4e-79
312378803 510 hypothetical protein AND_09546 [Anophele 0.644 0.394 0.676 9e-77
157132842 497 thioredoxin reductase [Aedes aegypti] gi 0.647 0.406 0.678 9e-76
383854008 514 PREDICTED: thioredoxin reductase 1, mito 0.660 0.400 0.711 1e-75
328702950 492 PREDICTED: thioredoxin reductase 1, mito 0.618 0.392 0.666 2e-75
157132844 521 thioredoxin reductase [Aedes aegypti] gi 0.615 0.368 0.701 2e-75
170039980 536 thioredoxin reductase 1, mitochondrial [ 0.708 0.412 0.606 5e-75
347964059 502 AGAP000565-PC [Anopheles gambiae str. PE 0.634 0.394 0.661 6e-75
119113490 529 AGAP000565-PA [Anopheles gambiae str. PE 0.621 0.366 0.670 1e-74
119113492 505 AGAP000565-PB [Anopheles gambiae str. PE 0.621 0.384 0.670 2e-74
>gi|1848294|gb|AAC69637.1| glutathione reductase family member [Musca domestica] Back     alignment and taxonomy information
 Score =  300 bits (769), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 139/197 (70%), Positives = 166/197 (84%)

Query: 99  THKYDYDLLVLGGGSGGLAAAKEAAAHGRKVIVLDYVIPSPQGTTWGLGGTCVNVGCIPK 158
           +H+YDYDL+V+GGGSGGLA AKEA A+G KV  LDYV P+P GT WG+GGTCVNVGCIPK
Sbjct: 7   SHEYDYDLIVIGGGSGGLACAKEAVANGAKVACLDYVKPTPLGTKWGIGGTCVNVGCIPK 66

Query: 159 KLMHQAALLGEAIKDAVAYGWEIPNVKSVQHNWANLREAVQNHVKSVNWVTRVMLRDKKV 218
           KLMHQA+LLGE+I +A AYGWEIPN ++++  W NL +AVQNH+KSVNWVTRV LRDKKV
Sbjct: 67  KLMHQASLLGESIHEATAYGWEIPNKEAIKPKWENLVQAVQNHIKSVNWVTRVDLRDKKV 126

Query: 219 DYLNALGKFIDQHSVEATMKNGEKKTLTAENILIATGGRPNYPDIPGAKEHCISSDDIFS 278
           +Y+N  G F D H+V A MKNG ++TLT  N++IA GGRP YPDIPGA E+ I+SDD+FS
Sbjct: 127 EYINGAGSFKDPHTVVAKMKNGSERTLTGRNVVIAVGGRPRYPDIPGAVEYGITSDDLFS 186

Query: 279 LEKPPGKTLVVGAGYIG 295
           L+K PGKTLVVGAGYIG
Sbjct: 187 LDKEPGKTLVVGAGYIG 203




Source: Musca domestica

Species: Musca domestica

Genus: Musca

Family: Muscidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|312378803|gb|EFR25272.1| hypothetical protein AND_09546 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|157132842|ref|XP_001662665.1| thioredoxin reductase [Aedes aegypti] gi|108881628|gb|EAT45853.1| AAEL002886-PB [Aedes aegypti] Back     alignment and taxonomy information
>gi|383854008|ref|XP_003702514.1| PREDICTED: thioredoxin reductase 1, mitochondrial-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|328702950|ref|XP_001942650.2| PREDICTED: thioredoxin reductase 1, mitochondrial-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|157132844|ref|XP_001662666.1| thioredoxin reductase [Aedes aegypti] gi|108881629|gb|EAT45854.1| AAEL002886-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170039980|ref|XP_001847793.1| thioredoxin reductase 1, mitochondrial [Culex quinquefasciatus] gi|167863573|gb|EDS26956.1| thioredoxin reductase 1, mitochondrial [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|347964059|ref|XP_003437030.1| AGAP000565-PC [Anopheles gambiae str. PEST] gi|20792390|emb|CAD30858.1| thioredoxin reductase [Anopheles gambiae] gi|333466908|gb|EGK96416.1| AGAP000565-PC [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|119113490|ref|XP_001237264.1| AGAP000565-PA [Anopheles gambiae str. PEST] gi|28865110|emb|CAD70159.1| thioredoxin-disulfide reductase [Anopheles gambiae] gi|116130384|gb|EAU77244.1| AGAP000565-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|119113492|ref|XP_310514.3| AGAP000565-PB [Anopheles gambiae str. PEST] gi|28865108|emb|CAD70158.1| thioredoxin-disulfide reductase [Anopheles gambiae] gi|116130385|gb|EAA06298.3| AGAP000565-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query312
FB|FBgn0020653 596 Trxr-1 "Thioredoxin reductase- 0.673 0.352 0.543 4e-58
UNIPROTKB|F1M0T6 695 Txnrd3 "Protein Txnrd3" [Rattu 0.682 0.306 0.520 9.6e-57
UNIPROTKB|F1NWD6 549 TXNRD1 "Uncharacterized protei 0.830 0.471 0.464 1.6e-56
UNIPROTKB|E2QRB9 541 TXNRD1 "Thioredoxin reductase 0.766 0.441 0.489 1.6e-56
FB|FBgn0037170 516 Trxr-2 "thioredoxin reductase 0.621 0.375 0.540 2.5e-56
UNIPROTKB|G1K1Q2 497 TXNRD1 "Thioredoxin reductase 0.682 0.428 0.525 4.2e-56
UNIPROTKB|G3MWU1 609 TXNRD1 "Thioredoxin reductase 0.682 0.349 0.525 4.2e-56
UNIPROTKB|O62768 499 TXNRD1 "Thioredoxin reductase 0.682 0.426 0.525 4.2e-56
RGD|61959 499 Txnrd1 "thioredoxin reductase 0.682 0.426 0.529 5.3e-56
UNIPROTKB|G3V9V0 611 Txnrd1 "Thioredoxin reductase 0.682 0.348 0.529 5.3e-56
FB|FBgn0020653 Trxr-1 "Thioredoxin reductase-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 597 (215.2 bits), Expect = 4.0e-58, P = 4.0e-58
 Identities = 118/217 (54%), Positives = 151/217 (69%)

Query:    94 VRQDNTH--KYDYDXXXXXXXXXXXXXXXXXXXXXRKVIVLDYVIPSPQ-GTTWGLGGTC 150
             VR+ +T    YDYD                      +V  LD+V P+P  GT WG+GGTC
Sbjct:   103 VRKMSTKGGSYDYDLIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTC 162

Query:   151 VNVGCIPKKLMHQAALLGEAIKDAVAYGWEIPNVKSVQHNWANLREAVQNHVKSVNWVTR 210
             VNVGCIPKKLMHQA+LLGEA+ +A AYGW +   + ++ +W  L ++VQNH+KSVNWVTR
Sbjct:   163 VNVGCIPKKLMHQASLLGEAVHEAAAYGWNVD--EKIKPDWHKLVQSVQNHIKSVNWVTR 220

Query:   211 VMLRDKKVDYLNALGKFIDQHSVEATMKNGEKKTLTAENILIATGGRPNYPDIPGAKEHC 270
             V LRDKKV+Y+N LG F+D H++ A +K+GE+ T+TA+  +IA GGRP YPDIPGA E+ 
Sbjct:   221 VDLRDKKVEYINGLGSFVDSHTLLAKLKSGER-TITAQTFVIAVGGRPRYPDIPGAVEYG 279

Query:   271 ISSDDIFSLEKPPGKTLVVGAGYIGKLETWDSNSGCG 307
             I+SDD+FSL++ PGKTLVVGAGYIG LE      G G
Sbjct:   280 ITSDDLFSLDREPGKTLVVGAGYIG-LECAGFLKGLG 315


GO:0001666 "response to hypoxia" evidence=IMP
GO:0004362 "glutathione-disulfide reductase activity" evidence=IDA;NAS;IMP
GO:0008340 "determination of adult lifespan" evidence=IMP;TAS
GO:0005737 "cytoplasm" evidence=IDA;NAS
GO:0004791 "thioredoxin-disulfide reductase activity" evidence=ISS;IDA
GO:0042803 "protein homodimerization activity" evidence=IDA
GO:0045454 "cell redox homeostasis" evidence=IEA;IC
GO:0005739 "mitochondrion" evidence=IDA
GO:0016209 "antioxidant activity" evidence=NAS;IDA
GO:0050661 "NADP binding" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0006974 "response to DNA damage stimulus" evidence=IMP
GO:0022008 "neurogenesis" evidence=IMP
UNIPROTKB|F1M0T6 Txnrd3 "Protein Txnrd3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NWD6 TXNRD1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2QRB9 TXNRD1 "Thioredoxin reductase 1, cytoplasmic" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0037170 Trxr-2 "thioredoxin reductase 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|G1K1Q2 TXNRD1 "Thioredoxin reductase 1, cytoplasmic" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|G3MWU1 TXNRD1 "Thioredoxin reductase 1, cytoplasmic" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O62768 TXNRD1 "Thioredoxin reductase 1, cytoplasmic" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|61959 Txnrd1 "thioredoxin reductase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3V9V0 Txnrd1 "Thioredoxin reductase 1, isoform CRA_a" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P61076TRXR2_PLAF71, ., 8, ., 1, ., 90.550.61850.3128yesN/A
Q5NVA2TRXR1_PONAB1, ., 8, ., 1, ., 90.62310.63140.3947yesN/A
Q16881TRXR1_HUMAN1, ., 8, ., 1, ., 90.62810.63140.3035yesN/A
Q17745TRXR1_CAEEL1, ., 8, ., 1, ., 90.53870.71790.3358yesN/A
Q9JLT4TRXR2_MOUSE1, ., 8, ., 1, ., 90.63580.61530.3664yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.8.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query312
TIGR01438 484 TIGR01438, TGR, thioredoxin and glutathione reduct 1e-101
PTZ00052 499 PTZ00052, PTZ00052, thioredoxin reductase; Provisi 4e-88
PRK06116 450 PRK06116, PRK06116, glutathione reductase; Validat 5e-64
COG1249 454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas 2e-49
TIGR01424 446 TIGR01424, gluta_reduc_2, glutathione-disulfide re 2e-44
PLN02507 499 PLN02507, PLN02507, glutathione reductase 2e-42
TIGR01421 450 TIGR01421, gluta_reduc_1, glutathione-disulfide re 6e-41
PRK06292 460 PRK06292, PRK06292, dihydrolipoamide dehydrogenase 6e-40
TIGR01423 486 TIGR01423, trypano_reduc, trypanothione-disulfide 2e-37
TIGR01350 460 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrog 6e-36
PTZ00058 561 PTZ00058, PTZ00058, glutathione reductase; Provisi 4e-34
PLN02546 558 PLN02546, PLN02546, glutathione reductase 2e-33
pfam07992 283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 1e-30
PRK06416 462 PRK06416, PRK06416, dihydrolipoamide dehydrogenase 3e-30
PRK05249 461 PRK05249, PRK05249, soluble pyridine nucleotide tr 1e-29
PRK06370 463 PRK06370, PRK06370, mercuric reductase; Validated 5e-29
PRK06467 471 PRK06467, PRK06467, dihydrolipoamide dehydrogenase 2e-27
PRK05976 472 PRK05976, PRK05976, dihydrolipoamide dehydrogenase 4e-27
TIGR02053 463 TIGR02053, MerA, mercuric reductase 7e-27
PRK06912 458 PRK06912, acoL, dihydrolipoamide dehydrogenase; Va 3e-25
PRK07846 451 PRK07846, PRK07846, mycothione reductase; Reviewed 1e-21
PRK06327 475 PRK06327, PRK06327, dihydrolipoamide dehydrogenase 2e-20
PRK07251 438 PRK07251, PRK07251, pyridine nucleotide-disulfide 4e-20
PRK06115 466 PRK06115, PRK06115, dihydrolipoamide dehydrogenase 9e-20
PRK14694 468 PRK14694, PRK14694, putative mercuric reductase; P 2e-19
PRK07818 466 PRK07818, PRK07818, dihydrolipoamide dehydrogenase 7e-19
TIGR03452 452 TIGR03452, mycothione_red, mycothione reductase 1e-18
PTZ00052499 PTZ00052, PTZ00052, thioredoxin reductase; Provisi 3e-17
TIGR01438484 TIGR01438, TGR, thioredoxin and glutathione reduct 6e-17
PRK14727 479 PRK14727, PRK14727, putative mercuric reductase; P 2e-15
PTZ00153 659 PTZ00153, PTZ00153, lipoamide dehydrogenase; Provi 3e-15
PRK13748 561 PRK13748, PRK13748, putative mercuric reductase; P 3e-14
PRK07845 466 PRK07845, PRK07845, flavoprotein disulfide reducta 2e-13
PRK08010 441 PRK08010, PRK08010, pyridine nucleotide-disulfide 4e-12
PRK06116450 PRK06116, PRK06116, glutathione reductase; Validat 2e-10
pfam0007082 pfam00070, Pyr_redox, Pyridine nucleotide-disulphi 7e-08
TIGR01424446 TIGR01424, gluta_reduc_2, glutathione-disulfide re 2e-07
COG1053 562 COG1053, SdhA, Succinate dehydrogenase/fumarate re 1e-06
PRK06134 581 PRK06134, PRK06134, putative FAD-binding dehydroge 2e-06
pfam00890 401 pfam00890, FAD_binding_2, FAD binding domain 5e-06
TIGR01421450 TIGR01421, gluta_reduc_1, glutathione-disulfide re 6e-06
PLN02546558 PLN02546, PLN02546, glutathione reductase 6e-06
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas 1e-05
pfam13738202 pfam13738, Pyr_redox_3, Pyridine nucleotide-disulp 1e-05
PRK12839 572 PRK12839, PRK12839, hypothetical protein; Provisio 1e-05
PRK12834 549 PRK12834, PRK12834, putative FAD-binding dehydroge 8e-05
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 2e-04
pfam12831 415 pfam12831, FAD_oxidored, FAD dependent oxidoreduct 3e-04
PLN02463 447 PLN02463, PLN02463, lycopene beta cyclase 4e-04
pfam03486 405 pfam03486, HI0933_like, HI0933-like protein 4e-04
PRK12842 574 PRK12842, PRK12842, putative succinate dehydrogena 4e-04
COG0665 387 COG0665, DadA, Glycine/D-amino acid oxidases (deam 5e-04
TIGR01372 985 TIGR01372, soxA, sarcosine oxidase, alpha subunit 6e-04
TIGR02730 493 TIGR02730, carot_isom, carotene isomerase 6e-04
COG0492 305 COG0492, TrxB, Thioredoxin reductase [Posttranslat 7e-04
pfam01266234 pfam01266, DAO, FAD dependent oxidoreductase 9e-04
COG2081 408 COG2081, COG2081, Predicted flavoproteins [General 0.001
COG3573 552 COG3573, COG3573, Predicted oxidoreductase [Genera 0.002
COG1252 405 COG1252, Ndh, NADH dehydrogenase, FAD-containing s 0.002
TIGR03140 515 TIGR03140, AhpF, alkyl hydroperoxide reductase sub 0.002
PTZ00367 567 PTZ00367, PTZ00367, squalene epoxidase; Provisiona 0.002
COG2072 443 COG2072, TrkA, Predicted flavoprotein involved in 0.003
TIGR03364 365 TIGR03364, HpnW_proposed, FAD dependent oxidoreduc 0.003
PRK07121 492 PRK07121, PRK07121, hypothetical protein; Validate 0.004
COG0644 396 COG0644, FixC, Dehydrogenases (flavoproteins) [Ene 0.004
PRK08274 466 PRK08274, PRK08274, tricarballylate dehydrogenase; 0.004
COG2303 542 COG2303, BetA, Choline dehydrogenase and related f 0.004
>gnl|CDD|233412 TIGR01438, TGR, thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
 Score =  306 bits (784), Expect = e-101
 Identities = 127/193 (65%), Positives = 157/193 (81%), Gaps = 2/193 (1%)

Query: 102 YDYDLLVLGGGSGGLAAAKEAAAHGRKVIVLDYVIPSPQGTTWGLGGTCVNVGCIPKKLM 161
           YDYDL+V+GGGSGGLAAAKEAAA+G KV++LD+V P+P GT WG+GGTCVNVGCIPKKLM
Sbjct: 1   YDYDLIVIGGGSGGLAAAKEAAAYGAKVMLLDFVTPTPLGTRWGIGGTCVNVGCIPKKLM 60

Query: 162 HQAALLGEAIKDAVAYGWEIPNVKSVQHNWANLREAVQNHVKSVNWVTRVMLRDKKVDYL 221
           HQAALLG+A+KD+  YGW++    +V+H+W  L EAVQNH+ S+NW  RV LR+KKV Y 
Sbjct: 61  HQAALLGQALKDSRNYGWKVEE--TVKHDWKRLVEAVQNHIGSLNWGYRVALREKKVKYE 118

Query: 222 NALGKFIDQHSVEATMKNGEKKTLTAENILIATGGRPNYPDIPGAKEHCISSDDIFSLEK 281
           NA  +F+D+H ++AT K G++K  +AE  LIATG RP YP IPGAKE CI+SDD+FSL  
Sbjct: 119 NAYAEFVDKHRIKATNKKGKEKIYSAERFLIATGERPRYPGIPGAKELCITSDDLFSLPY 178

Query: 282 PPGKTLVVGAGYI 294
            PGKTLVVGA Y+
Sbjct: 179 CPGKTLVVGASYV 191


This homodimeric, FAD-containing member of the pyridine nucleotide disulfide oxidoreductase family contains a C-terminal motif Cys-SeCys-Gly, where SeCys is selenocysteine encoded by TGA (in some sequence reports interpreted as a stop codon). In some members of this subfamily, Cys-SeCys-Gly is replaced by Cys-Cys-Gly. The reach of the selenium atom at the C-term arm of the protein is proposed to allow broad substrate specificity. Length = 484

>gnl|CDD|185416 PTZ00052, PTZ00052, thioredoxin reductase; Provisional Back     alignment and domain information
>gnl|CDD|235701 PRK06116, PRK06116, glutathione reductase; Validated Back     alignment and domain information
>gnl|CDD|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|213618 TIGR01424, gluta_reduc_2, glutathione-disulfide reductase, plant Back     alignment and domain information
>gnl|CDD|215281 PLN02507, PLN02507, glutathione reductase Back     alignment and domain information
>gnl|CDD|130488 TIGR01421, gluta_reduc_1, glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>gnl|CDD|235774 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|200098 TIGR01423, trypano_reduc, trypanothione-disulfide reductase Back     alignment and domain information
>gnl|CDD|233368 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase Back     alignment and domain information
>gnl|CDD|185420 PTZ00058, PTZ00058, glutathione reductase; Provisional Back     alignment and domain information
>gnl|CDD|215301 PLN02546, PLN02546, glutathione reductase Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|235798 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|235373 PRK05249, PRK05249, soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235787 PRK06370, PRK06370, mercuric reductase; Validated Back     alignment and domain information
>gnl|CDD|180579 PRK06467, PRK06467, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|235660 PRK05976, PRK05976, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|233700 TIGR02053, MerA, mercuric reductase Back     alignment and domain information
>gnl|CDD|180743 PRK06912, acoL, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181142 PRK07846, PRK07846, mycothione reductase; Reviewed Back     alignment and domain information
>gnl|CDD|235779 PRK06327, PRK06327, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180907 PRK07251, PRK07251, pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|180409 PRK06115, PRK06115, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|237790 PRK14694, PRK14694, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|236106 PRK07818, PRK07818, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|132493 TIGR03452, mycothione_red, mycothione reductase Back     alignment and domain information
>gnl|CDD|185416 PTZ00052, PTZ00052, thioredoxin reductase; Provisional Back     alignment and domain information
>gnl|CDD|233412 TIGR01438, TGR, thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>gnl|CDD|237806 PRK14727, PRK14727, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|173442 PTZ00153, PTZ00153, lipoamide dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|184298 PRK13748, PRK13748, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|236112 PRK07845, PRK07845, flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|181196 PRK08010, PRK08010, pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|235701 PRK06116, PRK06116, glutathione reductase; Validated Back     alignment and domain information
>gnl|CDD|215691 pfam00070, Pyr_redox, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|213618 TIGR01424, gluta_reduc_2, glutathione-disulfide reductase, plant Back     alignment and domain information
>gnl|CDD|223981 COG1053, SdhA, Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|180419 PRK06134, PRK06134, putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|216176 pfam00890, FAD_binding_2, FAD binding domain Back     alignment and domain information
>gnl|CDD|130488 TIGR01421, gluta_reduc_1, glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>gnl|CDD|215301 PLN02546, PLN02546, glutathione reductase Back     alignment and domain information
>gnl|CDD|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|222355 pfam13738, Pyr_redox_3, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|237223 PRK12839, PRK12839, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|183782 PRK12834, PRK12834, putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|221798 pfam12831, FAD_oxidored, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|178082 PLN02463, PLN02463, lycopene beta cyclase Back     alignment and domain information
>gnl|CDD|217590 pfam03486, HI0933_like, HI0933-like protein Back     alignment and domain information
>gnl|CDD|237224 PRK12842, PRK12842, putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|223737 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|233382 TIGR01372, soxA, sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>gnl|CDD|131777 TIGR02730, carot_isom, carotene isomerase Back     alignment and domain information
>gnl|CDD|223566 COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|216400 pfam01266, DAO, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|224992 COG2081, COG2081, Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|226103 COG3573, COG3573, Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224172 COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|234119 TIGR03140, AhpF, alkyl hydroperoxide reductase subunit F Back     alignment and domain information
>gnl|CDD|240384 PTZ00367, PTZ00367, squalene epoxidase; Provisional Back     alignment and domain information
>gnl|CDD|224983 COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|132407 TIGR03364, HpnW_proposed, FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>gnl|CDD|180854 PRK07121, PRK07121, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|236214 PRK08274, PRK08274, tricarballylate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|225186 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 312
KOG4716|consensus 503 99.96
TIGR01438 484 TGR thioredoxin and glutathione reductase selenopr 99.93
COG1249 454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 99.92
PLN02507 499 glutathione reductase 99.91
PRK06467 471 dihydrolipoamide dehydrogenase; Reviewed 99.91
PLN02546 558 glutathione reductase 99.91
KOG0405|consensus 478 99.9
TIGR01424 446 gluta_reduc_2 glutathione-disulfide reductase, pla 99.9
PTZ00058 561 glutathione reductase; Provisional 99.9
PTZ00052 499 thioredoxin reductase; Provisional 99.9
PRK06370 463 mercuric reductase; Validated 99.9
TIGR01421 450 gluta_reduc_1 glutathione-disulfide reductase, ani 99.9
TIGR01423 486 trypano_reduc trypanothione-disulfide reductase. T 99.89
PRK05976 472 dihydrolipoamide dehydrogenase; Validated 99.89
PRK05249 461 soluble pyridine nucleotide transhydrogenase; Prov 99.89
PRK14694 468 putative mercuric reductase; Provisional 99.89
PRK06116 450 glutathione reductase; Validated 99.89
PRK14727 479 putative mercuric reductase; Provisional 99.88
PRK06416 462 dihydrolipoamide dehydrogenase; Reviewed 99.88
PRK07846 451 mycothione reductase; Reviewed 99.88
PRK13748 561 putative mercuric reductase; Provisional 99.87
PRK06912 458 acoL dihydrolipoamide dehydrogenase; Validated 99.87
PTZ00153 659 lipoamide dehydrogenase; Provisional 99.87
PRK07845 466 flavoprotein disulfide reductase; Reviewed 99.87
PRK06115 466 dihydrolipoamide dehydrogenase; Reviewed 99.87
TIGR02053 463 MerA mercuric reductase. This model represents the 99.86
TIGR01350 461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 99.86
PRK07818 466 dihydrolipoamide dehydrogenase; Reviewed 99.86
PRK06327 475 dihydrolipoamide dehydrogenase; Validated 99.85
PRK06292 460 dihydrolipoamide dehydrogenase; Validated 99.85
TIGR03452 452 mycothione_red mycothione reductase. Mycothiol, a 99.85
PRK07251 438 pyridine nucleotide-disulfide oxidoreductase; Prov 99.84
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 99.83
PRK08010 441 pyridine nucleotide-disulfide oxidoreductase; Prov 99.83
KOG1335|consensus 506 99.82
KOG1335|consensus506 99.81
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 99.75
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 99.74
KOG0405|consensus478 99.73
COG0492 305 TrxB Thioredoxin reductase [Posttranslational modi 99.72
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 99.71
KOG1399|consensus 448 99.71
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 99.7
KOG4716|consensus503 99.66
COG3634 520 AhpF Alkyl hydroperoxide reductase, large subunit 99.65
PRK10262 321 thioredoxin reductase; Provisional 99.65
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 99.64
TIGR01292 300 TRX_reduct thioredoxin-disulfide reductase. This m 99.63
PRK15317 517 alkyl hydroperoxide reductase subunit F; Provision 99.62
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 99.62
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 99.61
PLN02546558 glutathione reductase 99.61
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 99.6
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 99.6
PTZ00058561 glutathione reductase; Provisional 99.59
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 99.59
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 99.59
PLN02507499 glutathione reductase 99.59
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 99.58
PRK07845466 flavoprotein disulfide reductase; Reviewed 99.57
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 99.57
PRK14727479 putative mercuric reductase; Provisional 99.57
PF13434 341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 99.56
PRK07846451 mycothione reductase; Reviewed 99.54
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 99.53
PRK14694468 putative mercuric reductase; Provisional 99.53
PRK06327475 dihydrolipoamide dehydrogenase; Validated 99.53
PRK06370463 mercuric reductase; Validated 99.53
PRK06116450 glutathione reductase; Validated 99.53
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 99.53
PRK13748561 putative mercuric reductase; Provisional 99.53
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 99.53
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 99.52
PTZ00318424 NADH dehydrogenase-like protein; Provisional 99.52
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 99.5
PRK13512438 coenzyme A disulfide reductase; Provisional 99.5
PRK05976472 dihydrolipoamide dehydrogenase; Validated 99.5
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 99.49
TIGR02053463 MerA mercuric reductase. This model represents the 99.48
PTZ00052499 thioredoxin reductase; Provisional 99.48
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 99.48
PRK14989 847 nitrite reductase subunit NirD; Provisional 99.47
PTZ00153659 lipoamide dehydrogenase; Provisional 99.47
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 99.47
PRK09754 396 phenylpropionate dioxygenase ferredoxin reductase 99.46
PRK06292460 dihydrolipoamide dehydrogenase; Validated 99.45
PRK14989 847 nitrite reductase subunit NirD; Provisional 99.45
PRK04965 377 NADH:flavorubredoxin oxidoreductase; Provisional 99.45
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 99.43
PRK12831 464 putative oxidoreductase; Provisional 99.41
TIGR03169 364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 99.41
KOG0404|consensus 322 99.4
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 99.4
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 99.4
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 99.39
PTZ00318 424 NADH dehydrogenase-like protein; Provisional 99.39
PRK09564444 coenzyme A disulfide reductase; Reviewed 99.39
PRK09564 444 coenzyme A disulfide reductase; Reviewed 99.39
PRK12779 944 putative bifunctional glutamate synthase subunit b 99.38
PRK13512 438 coenzyme A disulfide reductase; Provisional 99.37
KOG2495|consensus491 99.36
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 99.36
TIGR01316 449 gltA glutamate synthase (NADPH), homotetrameric. T 99.36
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 99.34
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 99.32
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 99.31
PRK12778 752 putative bifunctional 2-polyprenylphenol hydroxyla 99.31
PRK10262321 thioredoxin reductase; Provisional 99.3
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 99.28
KOG1336|consensus478 99.25
COG3486 436 IucD Lysine/ornithine N-monooxygenase [Secondary m 99.24
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 99.24
KOG1336|consensus 478 99.24
COG2081 408 Predicted flavoproteins [General function predicti 99.23
PRK11749 457 dihydropyrimidine dehydrogenase subunit A; Provisi 99.23
COG1252 405 Ndh NADH dehydrogenase, FAD-containing subunit [En 99.23
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 99.22
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 99.22
PRK12770 352 putative glutamate synthase subunit beta; Provisio 99.2
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 99.17
PRK12810 471 gltD glutamate synthase subunit beta; Reviewed 99.16
PLN02852 491 ferredoxin-NADP+ reductase 99.15
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 99.15
TIGR01317 485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 99.12
PRK12814 652 putative NADPH-dependent glutamate synthase small 99.1
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 99.06
PRK12831464 putative oxidoreductase; Provisional 99.05
PRK13984 604 putative oxidoreductase; Provisional 99.05
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 99.04
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 99.04
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 99.02
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 99.02
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 99.01
PRK09897 534 hypothetical protein; Provisional 99.0
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 98.98
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 98.96
TIGR01318 467 gltD_gamma_fam glutamate synthase small subunit fa 98.92
PRK06567 1028 putative bifunctional glutamate synthase subunit b 98.89
KOG2495|consensus 491 98.89
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 98.86
PRK12770352 putative glutamate synthase subunit beta; Provisio 98.86
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 98.82
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 98.82
PF03486 409 HI0933_like: HI0933-like protein; InterPro: IPR004 98.78
TIGR03385 427 CoA_CoA_reduc CoA-disulfide reductase. Members of 98.77
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 98.77
KOG0404|consensus322 98.76
PRK12814652 putative NADPH-dependent glutamate synthase small 98.75
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 98.7
COG4529 474 Uncharacterized protein conserved in bacteria [Fun 98.68
COG0493 457 GltD NADPH-dependent glutamate synthase beta chain 98.66
PRK12779 944 putative bifunctional glutamate synthase subunit b 98.66
PRK098531019 putative selenate reductase subunit YgfK; Provisio 98.65
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 98.59
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 98.59
PRK13984604 putative oxidoreductase; Provisional 98.57
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 98.57
PLN02463 447 lycopene beta cyclase 98.56
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 98.55
PRK12771564 putative glutamate synthase (NADPH) small subunit; 98.54
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 98.53
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 98.51
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 98.51
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 98.48
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 98.47
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 98.46
KOG0399|consensus 2142 98.46
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 98.44
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 98.43
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 98.43
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 98.4
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 98.39
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 98.39
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 98.39
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 98.37
TIGR02023 388 BchP-ChlP geranylgeranyl reductase. This model rep 98.37
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 98.35
COG0446 415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 98.34
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 98.34
PF05834 374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 98.34
PRK06481 506 fumarate reductase flavoprotein subunit; Validated 98.34
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 98.34
TIGR02028 398 ChlP geranylgeranyl reductase. This model represen 98.33
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 98.33
PLN00093 450 geranylgeranyl diphosphate reductase; Provisional 98.32
PRK07804 541 L-aspartate oxidase; Provisional 98.32
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 98.32
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.31
TIGR00551 488 nadB L-aspartate oxidase. L-aspartate oxidase is t 98.31
KOG1346|consensus 659 98.31
COG0644 396 FixC Dehydrogenases (flavoproteins) [Energy produc 98.3
TIGR01790 388 carotene-cycl lycopene cyclase family protein. Thi 98.3
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 98.29
PLN02815 594 L-aspartate oxidase 98.28
PRK08401 466 L-aspartate oxidase; Provisional 98.26
PRK08275 554 putative oxidoreductase; Provisional 98.26
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 98.22
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 98.21
PRK10157 428 putative oxidoreductase FixC; Provisional 98.2
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 98.2
PRK10015 429 oxidoreductase; Provisional 98.2
PLN02697 529 lycopene epsilon cyclase 98.19
PTZ00188 506 adrenodoxin reductase; Provisional 98.19
PRK08274 466 tricarballylate dehydrogenase; Validated 98.19
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.19
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 98.18
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.18
KOG2755|consensus 334 98.18
PRK06175 433 L-aspartate oxidase; Provisional 98.18
PRK08071 510 L-aspartate oxidase; Provisional 98.17
TIGR01813 439 flavo_cyto_c flavocytochrome c. This model describ 98.16
PF00890 417 FAD_binding_2: FAD binding domain of the Pfam fami 98.16
PRK06834 488 hypothetical protein; Provisional 98.15
PRK06847 375 hypothetical protein; Provisional 98.14
KOG1800|consensus 468 98.13
PRK11445 351 putative oxidoreductase; Provisional 98.12
PRK09077 536 L-aspartate oxidase; Provisional 98.11
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 98.09
TIGR00275 400 flavoprotein, HI0933 family. The model when search 98.09
PLN02172461 flavin-containing monooxygenase FMO GS-OX 98.07
PRK07512 513 L-aspartate oxidase; Provisional 98.07
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 98.07
PF01134 392 GIDA: Glucose inhibited division protein A; InterP 98.06
PRK07190 487 hypothetical protein; Provisional 98.04
PF01266 358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 98.03
PRK07608 388 ubiquinone biosynthesis hydroxylase family protein 98.03
COG0029 518 NadB Aspartate oxidase [Coenzyme metabolism] 98.02
PRK07121 492 hypothetical protein; Validated 98.02
KOG0399|consensus2142 98.02
PRK07395 553 L-aspartate oxidase; Provisional 98.01
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.0
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 98.0
PRK08773 392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.99
PRK06184 502 hypothetical protein; Provisional 97.99
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 97.98
PRK07494 388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.98
PRK11728 393 hydroxyglutarate oxidase; Provisional 97.96
PRK08244 493 hypothetical protein; Provisional 97.94
PRK07364 415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.93
PRK12845 564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.92
PF01494 356 FAD_binding_3: FAD binding domain; InterPro: IPR00 97.91
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 97.88
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 97.88
PRK06126 545 hypothetical protein; Provisional 97.88
PRK09126 392 hypothetical protein; Provisional 97.88
PF12831 428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 97.87
PRK08020 391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 97.87
COG1053 562 SdhA Succinate dehydrogenase/fumarate reductase, f 97.87
TIGR01789 370 lycopene_cycl lycopene cyclase. This model represe 97.82
PLN02661357 Putative thiazole synthesis 97.81
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 97.81
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 97.8
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.79
TIGR01988 385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 97.78
PRK05714 405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.78
PRK08849 384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.77
PRK07333 403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.77
TIGR03364 365 HpnW_proposed FAD dependent oxidoreductase TIGR033 97.74
PLN02852491 ferredoxin-NADP+ reductase 97.74
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 97.74
PRK12842 574 putative succinate dehydrogenase; Reviewed 97.72
TIGR02360 390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 97.71
PRK08243 392 4-hydroxybenzoate 3-monooxygenase; Validated 97.71
PRK08013 400 oxidoreductase; Provisional 97.71
TIGR03329 460 Phn_aa_oxid putative aminophosphonate oxidoreducta 97.7
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 97.67
COG0654 387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 97.67
PRK12837 513 3-ketosteroid-delta-1-dehydrogenase; Provisional 97.67
TIGR01984 382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 97.67
PRK12839 572 hypothetical protein; Provisional 97.66
TIGR01989 437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 97.66
PRK08163 396 salicylate hydroxylase; Provisional 97.65
PRK07588 391 hypothetical protein; Provisional 97.63
PLN02985 514 squalene monooxygenase 97.61
PRK06753 373 hypothetical protein; Provisional 97.61
PRK06617 374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.61
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.58
TIGR01377 380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 97.58
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 97.57
PRK07045 388 putative monooxygenase; Reviewed 97.54
PRK06185 407 hypothetical protein; Provisional 97.53
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 97.53
PRK05732 395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.52
PRK12409 410 D-amino acid dehydrogenase small subunit; Provisio 97.52
PRK08132 547 FAD-dependent oxidoreductase; Provisional 97.52
PRK12844 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.5
KOG2820|consensus 399 97.5
PRK08850 405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 97.49
PRK11259 376 solA N-methyltryptophan oxidase; Provisional 97.48
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 97.47
PTZ00367 567 squalene epoxidase; Provisional 97.46
PRK01747 662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 97.45
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 97.4
COG0665 387 DadA Glycine/D-amino acid oxidases (deaminating) [ 97.38
PRK12843 578 putative FAD-binding dehydrogenase; Reviewed 97.37
PF04820 454 Trp_halogenase: Tryptophan halogenase; InterPro: I 97.37
COG2081408 Predicted flavoproteins [General function predicti 97.35
PRK07236 386 hypothetical protein; Provisional 97.33
PTZ00383 497 malate:quinone oxidoreductase; Provisional 97.3
PRK00711 416 D-amino acid dehydrogenase small subunit; Validate 97.29
PRK08294 634 phenol 2-monooxygenase; Provisional 97.24
TIGR02485 432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 97.23
PRK05868 372 hypothetical protein; Validated 97.2
PRK13369 502 glycerol-3-phosphate dehydrogenase; Provisional 97.2
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 97.19
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 97.16
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 97.16
KOG2311|consensus 679 97.16
PRK06475 400 salicylate hydroxylase; Provisional 97.06
PRK06996 398 hypothetical protein; Provisional 97.01
KOG1346|consensus659 97.01
TIGR01373 407 soxB sarcosine oxidase, beta subunit family, heter 96.97
COG0579 429 Predicted dehydrogenase [General function predicti 96.92
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 96.9
TIGR03219 414 salicylate_mono salicylate 1-monooxygenase. Member 96.9
KOG2404|consensus 477 96.89
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 96.88
TIGR03862 376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 96.84
KOG1298|consensus 509 96.77
PRK13339 497 malate:quinone oxidoreductase; Reviewed 96.76
KOG3851|consensus 446 96.74
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 96.68
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 96.61
PRK06847375 hypothetical protein; Provisional 96.59
KOG2853|consensus 509 96.35
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 96.34
KOG2614|consensus 420 96.33
PRK07236386 hypothetical protein; Provisional 96.14
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 96.13
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 96.08
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 96.0
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 95.99
TIGR00275400 flavoprotein, HI0933 family. The model when search 95.99
COG1233 487 Phytoene dehydrogenase and related proteins [Secon 95.9
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 95.83
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.78
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 95.77
PF01134392 GIDA: Glucose inhibited division protein A; InterP 95.77
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 95.76
PRK12842 574 putative succinate dehydrogenase; Reviewed 95.75
PRK05675 570 sdhA succinate dehydrogenase flavoprotein subunit; 95.37
TIGR02733 492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 95.35
TIGR02730 493 carot_isom carotene isomerase. Members of this fam 95.29
PRK08163396 salicylate hydroxylase; Provisional 95.21
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 95.18
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 95.12
KOG0029|consensus 501 95.04
PRK06834 488 hypothetical protein; Provisional 95.04
PLN02463447 lycopene beta cyclase 94.94
TIGR00031 377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 94.94
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 94.9
COG0579429 Predicted dehydrogenase [General function predicti 94.83
PRK07588391 hypothetical protein; Provisional 94.82
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 94.82
KOG2415|consensus 621 94.8
PLN02576 496 protoporphyrinogen oxidase 94.74
KOG2852|consensus 380 94.72
PRK08244 493 hypothetical protein; Provisional 94.69
TIGR02734 502 crtI_fam phytoene desaturase. Phytoene is converte 94.56
PRK02106 560 choline dehydrogenase; Validated 94.55
COG3573 552 Predicted oxidoreductase [General function predict 94.49
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 94.48
PRK07233 434 hypothetical protein; Provisional 94.47
PRK07538 413 hypothetical protein; Provisional 94.4
PRK06184 502 hypothetical protein; Provisional 94.39
PRK07208 479 hypothetical protein; Provisional 94.31
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 94.27
COG0562 374 Glf UDP-galactopyranose mutase [Cell envelope biog 94.1
PLN02268 435 probable polyamine oxidase 94.07
KOG2844|consensus 856 94.06
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 94.04
PF06039 488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 94.01
PRK11883 451 protoporphyrinogen oxidase; Reviewed 93.91
TIGR00562 462 proto_IX_ox protoporphyrinogen oxidase. This prote 93.89
PRK05868372 hypothetical protein; Validated 93.88
PTZ00363 443 rab-GDP dissociation inhibitor; Provisional 93.81
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 93.7
COG3075 421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 93.66
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 93.51
PRK05335 436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 93.47
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 93.45
PLN02697529 lycopene epsilon cyclase 93.4
COG3380 331 Predicted NAD/FAD-dependent oxidoreductase [Genera 93.38
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 93.37
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 93.32
PRK10157428 putative oxidoreductase FixC; Provisional 93.14
COG2509 486 Uncharacterized FAD-dependent dehydrogenases [Gene 93.1
TIGR01816 565 sdhA_forward succinate dehydrogenase, flavoprotein 92.98
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 92.9
PRK06753373 hypothetical protein; Provisional 92.85
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 92.77
TIGR02462 544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 92.74
PRK05329 422 anaerobic glycerol-3-phosphate dehydrogenase subun 92.71
TIGR00137 433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 92.69
PTZ00188 506 adrenodoxin reductase; Provisional 92.68
PLN02568 539 polyamine oxidase 92.64
PRK07045388 putative monooxygenase; Reviewed 92.58
PRK06475400 salicylate hydroxylase; Provisional 92.54
PRK06567 1028 putative bifunctional glutamate synthase subunit b 92.36
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 92.35
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 92.31
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.2
TIGR00137 433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 92.2
COG1231 450 Monoamine oxidase [Amino acid transport and metabo 92.18
PLN02464 627 glycerol-3-phosphate dehydrogenase 92.13
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 92.1
PLN02676 487 polyamine oxidase 92.05
TIGR01320 483 mal_quin_oxido malate:quinone-oxidoreductase. This 92.01
PRK05257 494 malate:quinone oxidoreductase; Validated 92.0
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 91.83
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 91.82
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 91.81
KOG0685|consensus 498 91.79
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 91.65
PRK13977576 myosin-cross-reactive antigen; Provisional 91.65
PLN02328 808 lysine-specific histone demethylase 1 homolog 91.59
TIGR02730493 carot_isom carotene isomerase. Members of this fam 91.48
TIGR02731 453 phytoene_desat phytoene desaturase. Plants and cya 91.26
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 91.22
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 90.93
PTZ00383497 malate:quinone oxidoreductase; Provisional 90.88
PLN02529 738 lysine-specific histone demethylase 1 90.68
PRK12416 463 protoporphyrinogen oxidase; Provisional 90.63
PRK08132 547 FAD-dependent oxidoreductase; Provisional 90.62
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 90.58
KOG1399|consensus448 90.46
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 90.19
PLN02661357 Putative thiazole synthesis 90.18
COG2303 542 BetA Choline dehydrogenase and related flavoprotei 90.14
TIGR02732 474 zeta_caro_desat carotene 7,8-desaturase. Carotene 90.0
PLN02785 587 Protein HOTHEAD 89.98
PRK07538413 hypothetical protein; Provisional 89.78
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 89.76
TIGR01810 532 betA choline dehydrogenase. This enzyme is a membe 89.59
PRK05257494 malate:quinone oxidoreductase; Validated 89.42
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 89.25
COG3349 485 Uncharacterized conserved protein [Function unknow 89.22
KOG0042|consensus 680 89.16
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 88.85
TIGR03378 419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 88.78
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 88.54
COG1206 439 Gid NAD(FAD)-utilizing enzyme possibly involved in 88.45
PRK11728393 hydroxyglutarate oxidase; Provisional 88.33
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 88.19
COG1232 444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 88.06
PRK13339497 malate:quinone oxidoreductase; Reviewed 88.04
KOG3851|consensus446 87.88
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 87.5
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 87.34
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 87.1
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 87.1
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 87.03
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 86.67
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 86.62
PRK13977 576 myosin-cross-reactive antigen; Provisional 86.49
PLN02612 567 phytoene desaturase 86.47
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 86.41
PLN03000 881 amine oxidase 85.95
TIGR03197 381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 85.09
PLN02612567 phytoene desaturase 85.04
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 85.0
TIGR03377 516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 84.95
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 84.68
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 84.39
KOG1238|consensus 623 84.37
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 84.19
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 83.69
KOG4254|consensus 561 83.6
PLN02487 569 zeta-carotene desaturase 83.6
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 83.48
PRK11445351 putative oxidoreductase; Provisional 83.41
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 83.09
KOG2403|consensus 642 83.06
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 83.01
PRK11259376 solA N-methyltryptophan oxidase; Provisional 82.97
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 82.93
PRK07233434 hypothetical protein; Provisional 81.82
PRK09126392 hypothetical protein; Provisional 81.72
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 81.37
PRK07190 487 hypothetical protein; Provisional 81.34
TIGR03467419 HpnE squalene-associated FAD-dependent desaturase. 81.03
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 80.97
PLN02976 1713 amine oxidase 80.77
PF00996 438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 80.62
PLN02529 738 lysine-specific histone demethylase 1 80.4
COG1233487 Phytoene dehydrogenase and related proteins [Secon 80.24
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 80.2
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 80.11
PLN00093 450 geranylgeranyl diphosphate reductase; Provisional 80.07
PRK06996398 hypothetical protein; Provisional 80.04
>KOG4716|consensus Back     alignment and domain information
Probab=99.96  E-value=2.7e-28  Score=206.49  Aligned_cols=211  Identities=62%  Similarity=1.030  Sum_probs=199.6

Q ss_pred             ccccccEEEEecCcchHHHHHHHHHCCCcEEEEeccCCCCCCcccccCCcccccccchhhHHHHHHHHHHHHHHHHHcCC
Q psy11185        100 HKYDYDLLVLGGGSGGLAAAKEAAAHGRKVIVLDYVIPSPQGTTWGLGGTCVNVGCIPKKLMHQAALLGEAIKDAVAYGW  179 (312)
Q Consensus       100 ~~~~~d~vivg~G~~gl~~a~~~~~~~~~~~~ve~~~~~~~~~v~a~Gd~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~  179 (312)
                      ...++|++|||+|..||++|..+...|.++.++|.-.++..+.-|.+|+.|.+.+|+|.+++|.+...+..+.+...|||
T Consensus        16 ~sydyDLIviGgGSgGLacaKeAa~~G~kV~~lDfV~PtP~GtsWGlGGTCvNVGCIPKKLMHQAallG~al~da~kyGW   95 (503)
T KOG4716|consen   16 SSYDYDLIVIGGGSGGLACAKEAADLGAKVACLDFVKPTPQGTSWGLGGTCVNVGCIPKKLMHQAALLGEALHDARKYGW   95 (503)
T ss_pred             ccCCccEEEEcCCcchhhHHHHHHhcCCcEEEEeecccCCCCCccccCceeeecccccHHHHHHHHHHHHHHHHHHhhCC
Confidence            46789999999999999999999999999999999889999999999999999999999999999999999999999999


Q ss_pred             ccCCccccccCHHHHHHHHHHHHHHhhHHHHHHHhcCCceEEeceeEEeeCCeEEEEecCCCeEEEEcCeEEEccCCCCC
Q psy11185        180 EIPNVKSVQHNWANLREAVQNHVKSVNWVTRVMLRDKKVDYLNALGKFIDQHSVEATMKNGEKKTLTAENILIATGGRPN  259 (312)
Q Consensus       180 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gV~~~~~~~~~~~~~~~~v~~~~G~~~~i~ad~vVlAtG~~p~  259 (312)
                      +..+. ..++||+.+...++.+...+.|...-+++...|+++++...+.+++.+..+...|+.+.++|+.+|||||.+|+
T Consensus        96 ~~~e~-~ikhdW~~l~~sVqnhI~s~NW~yRv~LreKkV~Y~NsygeFv~~h~I~at~~~gk~~~~ta~~fvIatG~RPr  174 (503)
T KOG4716|consen   96 NVDEQ-KIKHDWNKLVKSVQNHIKSLNWGYRVQLREKKVEYINSYGEFVDPHKIKATNKKGKERFLTAENFVIATGLRPR  174 (503)
T ss_pred             CCccc-cccccHHHHHHHHHHHhhhccceEEEEeccceeeeeecceeecccceEEEecCCCceEEeecceEEEEecCCCC
Confidence            87652 58899999999999999999999888899999999999999999999999998888889999999999999999


Q ss_pred             CCCCCCCCcceeccccccCCCCCCCeEEEEcCchhhHHHHHHhhcCceeeee
Q psy11185        260 YPDIPGAKEHCISSDDIFSLEKPPGKTLVVGAGYIGKLETWDSNSGCGNVTI  311 (312)
Q Consensus       260 ~p~~~g~~~~~~~~~~~~~~~~~~~~v~VvG~G~sa~~~a~~l~~~~~~V~~  311 (312)
                      .|.+||..++++++++.+.+...|++-+|||+|+.|.|+|-.|...+.+||+
T Consensus       175 Yp~IpG~~Ey~ITSDDlFsl~~~PGkTLvVGa~YVaLECAgFL~gfg~~vtV  226 (503)
T KOG4716|consen  175 YPDIPGAKEYGITSDDLFSLPYEPGKTLVVGAGYVALECAGFLKGFGYDVTV  226 (503)
T ss_pred             CCCCCCceeeeecccccccccCCCCceEEEccceeeeehhhhHhhcCCCcEE
Confidence            9999999999999999999999999999999999999999999998888875



>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>KOG0405|consensus Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>KOG0405|consensus Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>KOG4716|consensus Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>KOG0404|consensus Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>KOG2495|consensus Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>KOG1336|consensus Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>KOG1336|consensus Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>KOG2495|consensus Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>KOG0404|consensus Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>KOG0399|consensus Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>KOG1346|consensus Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>KOG2755|consensus Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>KOG1800|consensus Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>KOG0399|consensus Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>KOG2820|consensus Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>KOG2311|consensus Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>KOG1346|consensus Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>KOG2404|consensus Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>KOG1298|consensus Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>KOG3851|consensus Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>KOG2853|consensus Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>KOG2614|consensus Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>KOG2415|consensus Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>KOG2852|consensus Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>KOG2844|consensus Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>KOG0685|consensus Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>KOG3851|consensus Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>KOG1238|consensus Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>KOG4254|consensus Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>KOG2403|consensus Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query312
3dgh_A 483 Crystal Structure Of Drosophila Thioredoxin Reducta 4e-61
3dh9_A 482 Crystal Structure Of Drosophila Thioredoxin Reducta 5e-61
2nvk_X 488 Crystal Structure Of Thioredoxin Reductase From Dro 5e-61
1h6v_A 499 Mammalian Thioredoxin Reductase Length = 499 7e-59
3ean_A 499 Crystal Structure Of Recombinant Rat Selenoprotein 9e-59
2cfy_A 521 Crystal Structure Of Human Thioredoxin Reductase 1 1e-58
2zz0_A 513 Crystal Structure Of Human Thioredoxin Reductase I 1e-58
3qfa_A 519 Crystal Structure Of The Human Thioredoxin Reductas 1e-58
2j3n_A 519 X-Ray Structure Of Human Thioredoxin Reductase 1 Le 1e-58
3dgz_A 488 Crystal Structure Of Mouse Mitochondrial Thioredoxi 3e-57
1zdl_A 517 Crystal Structure Of Mouse Thioredoxin Reductase Ty 3e-57
2v6o_A 596 Structure Of Schistosoma Mansoni Thioredoxin-Glutat 3e-55
3h4k_A 598 Crystal Structure Of The Wild Type Thioredoxin Glut 3e-55
2x8c_A 598 Thioredoxin Glutathione Reductase From Schistosoma 3e-55
4b1b_A 542 Crystal Structure Of Plasmodium Falciparum Oxidised 4e-46
1ges_A 450 Anatomy Of An Engineered Nad-Binding Site Length = 1e-24
1ger_A 450 The Structure Of Glutathione Reductase From Escheri 5e-24
2woi_A 495 Trypanothione Reductase From Trypanosoma Brucei Len 1e-23
2wba_A 492 Properties Of Trypanothione Reductase From T. Bruce 1e-23
2r9z_A 463 Glutathione Amide Reductase From Chromatium Gracile 2e-23
1nda_A 491 The Structure Of Trypanosoma Cruzi Trypanothione Re 7e-23
1gxf_A 492 Crystal Structure Of Trypanosoma Cruzi Trypanothion 8e-23
1aog_A 485 Trypanosoma Cruzi Trypanothione Reductase (Oxidized 9e-23
1bzl_A 486 Crystal Structure Of Trypanosoma Cruzi Trypanothion 9e-23
2jk6_A 511 Structure Of Trypanothione Reductase From Leishmani 2e-21
2x50_A 510 Crystal Structure Of Trypanothione Reductase From L 2e-21
2hqm_A 479 Crystal Structure Of Glutathione Reductase Glr1 Fro 1e-20
1tyt_A 487 Crystal And Molecular Structure Of Crithidia Fascic 2e-20
2tpr_A 490 X-ray Structure Of Trypanothione Reductase From Cri 2e-20
1fea_A 490 Unliganded Crithidia Fasciculata Trypanothione Redu 2e-20
1typ_A 487 Substrate Interactions Between Trypanothione Reduct 6e-20
3djg_X 477 Catalytic Cycle Of Human Glutathione Reductase Near 4e-19
1bwc_A 478 Structure Of Human Glutathione Reductase Complexed 4e-19
2aaq_A 479 Crystal Structure Analysis Of The Human Glutahione 4e-19
2grt_A 461 Human Glutathione Reductase A34e, R37w Mutant, Oxid 4e-19
1grt_A 478 Human Glutathione Reductase A34eR37W MUTANT Length 4e-19
1xan_A 461 Human Glutathione Reductase In Complex With A Xanth 4e-19
3o0h_A 484 Crystal Structure Of Glutathione Reductase From Bar 1e-18
1gsn_A 478 Human Glutathione Reductase Modified By Dinitrosogl 7e-18
1grg_A 478 Substrate Binding And Catalysis By Glutathione Redu 7e-18
1dnc_A 478 Human Glutathione Reductase Modified By Diglutathio 7e-18
1onf_A 500 Crystal Structure Of Plasmodium Falciparum Glutathi 2e-17
1k4q_A 463 Human Glutathione Reductase Inactivated By Peroxyni 2e-17
4dna_A 463 Crystal Structure Of Putative Glutathione Reductase 3e-17
1zmc_A 474 Crystal Structure Of Human Dihydrolipoamide Dehydro 7e-15
3rnm_A 495 The Crystal Structure Of The Subunit Binding Of Hum 9e-15
1zy8_A 474 The Crystal Structure Of Dihydrolipoamide Dehydroge 1e-14
1dxl_A 470 Dihydrolipoamide Dehydrogenase Of Glycine Decarboxy 2e-14
2qae_A 468 Crystal Structure Analysis Of Trypanosoma Cruzi Lip 5e-14
3urh_A 491 Crystal Structure Of A Dihydrolipoamide Dehydrogena 2e-13
1lpf_A 477 Three-Dimensional Structure Of Lipoamide Dehydrogen 4e-12
3ic9_A 492 The Structure Of Dihydrolipoamide Dehydrogenase Fro 8e-12
1ebd_A 455 Dihydrolipoamide Dehydrogenase Complexed With The B 4e-11
1jeh_A 478 Crystal Structure Of Yeast E3, Lipoamide Dehydrogen 5e-11
1bhy_A 482 Low Temperature Middle Resolution Structure Of P64k 1e-10
1ojt_A 482 Structure Of Dihydrolipoamide Dehydrogenase Length 1e-10
3lad_A 476 Refined Crystal Structure Of Lipoamide Dehydrogenas 2e-10
1zk7_A 467 Crystal Structure Of Tn501 Mera Length = 467 3e-09
3l8k_A 466 Crystal Structure Of A Dihydrolipoyl Dehydrogenase 3e-09
3ii4_A 466 Structure Of Mycobacterial Lipoamide Dehydrogenase 1e-07
2a8x_A 464 Crystal Structure Of Lipoamide Dehydrogenase From M 3e-07
2eq7_A 455 Crystal Structure Of Lipoamide Dehydrogenase From T 4e-07
1lvl_A 458 The Refined Structure Of Pseudomonas Putida Lipoami 5e-06
2eq6_A 464 Crystal Structure Of Lipoamide Dehydrogenase From T 1e-04
1xdi_A 499 Crystal Structure Of Lpda (Rv3303c) From Mycobacter 1e-04
1mo9_A 523 Nadph Dependent 2-Ketopropyl Coenzyme M Oxidoreduct 3e-04
>pdb|3DGH|A Chain A, Crystal Structure Of Drosophila Thioredoxin Reductase, C-Terminal 8- Residue Truncation Length = 483 Back     alignment and structure

Iteration: 1

Score = 231 bits (589), Expect = 4e-61, Method: Compositional matrix adjust. Identities = 111/195 (56%), Positives = 142/195 (72%), Gaps = 4/195 (2%) Query: 102 YDYDXXXXXXXXXXXXXXXXXXXXXRKVIVLDYVIPSPQ-GTTWGLGGTCVNVGCIPKKL 160 YDYD +V LD+V P+P GT WG+GGTCVNVGCIPKKL Sbjct: 8 YDYDLIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKL 67 Query: 161 MHQAALLGEAIKDAVAYGWEIPNVKSVQHNWANLREAVQNHVKSVNWVTRVMLRDKKVDY 220 MHQA+LLGEA+ +A AYGW + + ++ +W L ++VQNH+KSVNWVTRV LRDKKV+Y Sbjct: 68 MHQASLLGEAVHEAAAYGWNVDD--KIKPDWHKLVQSVQNHIKSVNWVTRVDLRDKKVEY 125 Query: 221 LNALGKFIDQHSVEATMKNGEKKTLTAENILIATGGRPNYPDIPGAKEHCISSDDIFSLE 280 +N LG F+D H++ A +K+GE+ T+TA+ +IA GGRP YPDIPGA E+ I+SDD+FSL+ Sbjct: 126 INGLGSFVDSHTLLAKLKSGER-TITAQTFVIAVGGRPRYPDIPGAVEYGITSDDLFSLD 184 Query: 281 KPPGKTLVVGAGYIG 295 + PGKTLVVGAGYIG Sbjct: 185 REPGKTLVVGAGYIG 199
>pdb|3DH9|A Chain A, Crystal Structure Of Drosophila Thioredoxin Reductase, Wild-Type Length = 482 Back     alignment and structure
>pdb|2NVK|X Chain X, Crystal Structure Of Thioredoxin Reductase From Drosophila Melanogaster Length = 488 Back     alignment and structure
>pdb|1H6V|A Chain A, Mammalian Thioredoxin Reductase Length = 499 Back     alignment and structure
>pdb|3EAN|A Chain A, Crystal Structure Of Recombinant Rat Selenoprotein Thioredoxin Reductase 1 With Reduced C-Terminal Tail Length = 499 Back     alignment and structure
>pdb|2CFY|A Chain A, Crystal Structure Of Human Thioredoxin Reductase 1 Length = 521 Back     alignment and structure
>pdb|2ZZ0|A Chain A, Crystal Structure Of Human Thioredoxin Reductase I (Secys 498 Cys) Length = 513 Back     alignment and structure
>pdb|3QFA|A Chain A, Crystal Structure Of The Human Thioredoxin Reductase-Thioredoxin Complex Length = 519 Back     alignment and structure
>pdb|2J3N|A Chain A, X-Ray Structure Of Human Thioredoxin Reductase 1 Length = 519 Back     alignment and structure
>pdb|3DGZ|A Chain A, Crystal Structure Of Mouse Mitochondrial Thioredoxin Reductase, C- Terminal 3-Residue Truncation Length = 488 Back     alignment and structure
>pdb|1ZDL|A Chain A, Crystal Structure Of Mouse Thioredoxin Reductase Type 2 Length = 517 Back     alignment and structure
>pdb|2V6O|A Chain A, Structure Of Schistosoma Mansoni Thioredoxin-Glutathione Reductase (Smtgr) Length = 596 Back     alignment and structure
>pdb|3H4K|A Chain A, Crystal Structure Of The Wild Type Thioredoxin Glutatione Reductase From Schistosoma Mansoni In Complex With Auranofin Length = 598 Back     alignment and structure
>pdb|2X8C|A Chain A, Thioredoxin Glutathione Reductase From Schistosoma Mansoni With The Reduced C-Terminal End Length = 598 Back     alignment and structure
>pdb|4B1B|A Chain A, Crystal Structure Of Plasmodium Falciparum Oxidised Thioredoxin Reductase At 2.9 Angstrom Length = 542 Back     alignment and structure
>pdb|1GES|A Chain A, Anatomy Of An Engineered Nad-Binding Site Length = 450 Back     alignment and structure
>pdb|1GER|A Chain A, The Structure Of Glutathione Reductase From Escherichia Coli At 1.86 Angstroms Resolution: Comparison With The Enzyme From Human Erythrocytes Length = 450 Back     alignment and structure
>pdb|2WOI|A Chain A, Trypanothione Reductase From Trypanosoma Brucei Length = 495 Back     alignment and structure
>pdb|2WBA|A Chain A, Properties Of Trypanothione Reductase From T. Brucei Length = 492 Back     alignment and structure
>pdb|2R9Z|A Chain A, Glutathione Amide Reductase From Chromatium Gracile Length = 463 Back     alignment and structure
>pdb|1NDA|A Chain A, The Structure Of Trypanosoma Cruzi Trypanothione Reductase In The Oxidized And Nadph Reduced State Length = 491 Back     alignment and structure
>pdb|1GXF|A Chain A, Crystal Structure Of Trypanosoma Cruzi Trypanothione Reductase In Complex With The Inhibitor Quinacrine Mustard Length = 492 Back     alignment and structure
>pdb|1AOG|A Chain A, Trypanosoma Cruzi Trypanothione Reductase (Oxidized Form) Length = 485 Back     alignment and structure
>pdb|1BZL|A Chain A, Crystal Structure Of Trypanosoma Cruzi Trypanothione Reductase In Complex With Trypanothione, And The Structure- Based Discovery Of New Natural Product Inhibitors Length = 486 Back     alignment and structure
>pdb|2JK6|A Chain A, Structure Of Trypanothione Reductase From Leishmania Infantum Length = 511 Back     alignment and structure
>pdb|2X50|A Chain A, Crystal Structure Of Trypanothione Reductase From Leishmania Infantum In Complex With Nadph And Silver Length = 510 Back     alignment and structure
>pdb|2HQM|A Chain A, Crystal Structure Of Glutathione Reductase Glr1 From The Yeast Saccharomyces Cerevisiae Length = 479 Back     alignment and structure
>pdb|1TYT|A Chain A, Crystal And Molecular Structure Of Crithidia Fasciculata Trypanothione Reductase At 2.6 Angstroms Resolution Length = 487 Back     alignment and structure
>pdb|2TPR|A Chain A, X-ray Structure Of Trypanothione Reductase From Crithidia Fasciculata At 2.4 Angstroms Resolution Length = 490 Back     alignment and structure
>pdb|1FEA|A Chain A, Unliganded Crithidia Fasciculata Trypanothione Reductase At 2.2 Angstrom Resolution Length = 490 Back     alignment and structure
>pdb|1TYP|A Chain A, Substrate Interactions Between Trypanothione Reductase And N1-Glutathionylspermidine Disulphide At 0.28-Nm Resolution Length = 487 Back     alignment and structure
>pdb|3DJG|X Chain X, Catalytic Cycle Of Human Glutathione Reductase Near 1 A Resolution Length = 477 Back     alignment and structure
>pdb|1BWC|A Chain A, Structure Of Human Glutathione Reductase Complexed With Ajoene Inhibitor And Subversive Substrate Length = 478 Back     alignment and structure
>pdb|2AAQ|A Chain A, Crystal Structure Analysis Of The Human Glutahione Reductase, Complexed With Gopi Length = 479 Back     alignment and structure
>pdb|2GRT|A Chain A, Human Glutathione Reductase A34e, R37w Mutant, Oxidized Glutathione Complex Length = 461 Back     alignment and structure
>pdb|1GRT|A Chain A, Human Glutathione Reductase A34eR37W MUTANT Length = 478 Back     alignment and structure
>pdb|1XAN|A Chain A, Human Glutathione Reductase In Complex With A Xanthene Inhibitor Length = 461 Back     alignment and structure
>pdb|3O0H|A Chain A, Crystal Structure Of Glutathione Reductase From Bartonella Henselae Length = 484 Back     alignment and structure
>pdb|1GSN|A Chain A, Human Glutathione Reductase Modified By Dinitrosoglutathione Length = 478 Back     alignment and structure
>pdb|1GRG|A Chain A, Substrate Binding And Catalysis By Glutathione Reductase As Derived From Refined Enzyme: Substrate Crystal Structures At 2 Angstroms Resolution Length = 478 Back     alignment and structure
>pdb|1DNC|A Chain A, Human Glutathione Reductase Modified By Diglutathione-Dinitroso-Iron Length = 478 Back     alignment and structure
>pdb|1ONF|A Chain A, Crystal Structure Of Plasmodium Falciparum Glutathione Reductase Length = 500 Back     alignment and structure
>pdb|4DNA|A Chain A, Crystal Structure Of Putative Glutathione Reductase From Sinorhizobium Meliloti 1021 Length = 463 Back     alignment and structure
>pdb|1ZMC|A Chain A, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase Complexed To Nad+ Length = 474 Back     alignment and structure
>pdb|3RNM|A Chain A, The Crystal Structure Of The Subunit Binding Of Human Dihydrolipoamide Transacylase (E2b) Bound To Human Dihydrolipoamide Dehydrogenase (E3) Length = 495 Back     alignment and structure
>pdb|1ZY8|A Chain A, The Crystal Structure Of Dihydrolipoamide Dehydrogenase And Dihydrolipoamide Dehydrogenase-Binding Protein (Didomain) Subcomplex Of Human Pyruvate Dehydrogenase Complex. Length = 474 Back     alignment and structure
>pdb|1DXL|A Chain A, Dihydrolipoamide Dehydrogenase Of Glycine Decarboxylase From Pisum Sativum Length = 470 Back     alignment and structure
>pdb|2QAE|A Chain A, Crystal Structure Analysis Of Trypanosoma Cruzi Lipoamide Dehydrogenase Length = 468 Back     alignment and structure
>pdb|3URH|A Chain A, Crystal Structure Of A Dihydrolipoamide Dehydrogenase From Sinorhizobium Meliloti 1021 Length = 491 Back     alignment and structure
>pdb|1LPF|A Chain A, Three-Dimensional Structure Of Lipoamide Dehydrogenase From Pseudomonas Fluorescens At 2.8 Angstroms Resolution. Analysis Of Redox And Thermostability Properties Length = 477 Back     alignment and structure
>pdb|3IC9|A Chain A, The Structure Of Dihydrolipoamide Dehydrogenase From Colwellia Psychrerythraea 34h. Length = 492 Back     alignment and structure
>pdb|1EBD|A Chain A, Dihydrolipoamide Dehydrogenase Complexed With The Binding Domain Of The Dihydrolipoamide Acetylase Length = 455 Back     alignment and structure
>pdb|1JEH|A Chain A, Crystal Structure Of Yeast E3, Lipoamide Dehydrogenase Length = 478 Back     alignment and structure
>pdb|1BHY|A Chain A, Low Temperature Middle Resolution Structure Of P64k From Masc Data Length = 482 Back     alignment and structure
>pdb|1OJT|A Chain A, Structure Of Dihydrolipoamide Dehydrogenase Length = 482 Back     alignment and structure
>pdb|3LAD|A Chain A, Refined Crystal Structure Of Lipoamide Dehydrogenase From Azotobacter Vinelandii At 2.2 Angstroms Resolution. A Comparison With The Structure Of Glutathione Reductase Length = 476 Back     alignment and structure
>pdb|1ZK7|A Chain A, Crystal Structure Of Tn501 Mera Length = 467 Back     alignment and structure
>pdb|3L8K|A Chain A, Crystal Structure Of A Dihydrolipoyl Dehydrogenase From Sulfolobus Solfataricus Length = 466 Back     alignment and structure
>pdb|3II4|A Chain A, Structure Of Mycobacterial Lipoamide Dehydrogenase Bound To A Triazaspirodimethoxybenzoyl Inhibitor Length = 466 Back     alignment and structure
>pdb|2A8X|A Chain A, Crystal Structure Of Lipoamide Dehydrogenase From Mycobacterium Tuberculosis Length = 464 Back     alignment and structure
>pdb|2EQ7|A Chain A, Crystal Structure Of Lipoamide Dehydrogenase From Thermus Thermophilus Hb8 With Psbdo Length = 455 Back     alignment and structure
>pdb|1LVL|A Chain A, The Refined Structure Of Pseudomonas Putida Lipoamide Dehydrogenase Complexed With Nad+ At 2.45 Angstroms Resolution Length = 458 Back     alignment and structure
>pdb|2EQ6|A Chain A, Crystal Structure Of Lipoamide Dehydrogenase From Thermus Thermophilus Hb8 Length = 464 Back     alignment and structure
>pdb|1XDI|A Chain A, Crystal Structure Of Lpda (Rv3303c) From Mycobacterium Tuberculosis Length = 499 Back     alignment and structure
>pdb|1MO9|A Chain A, Nadph Dependent 2-Ketopropyl Coenzyme M OxidoreductaseCARBOXYLASE Complexed With 2-Ketopropyl Coenzyme M Length = 523 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query312
3qfa_A 519 Thioredoxin reductase 1, cytoplasmic; protein-prot 1e-110
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 2e-20
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 1e-109
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 1e-17
3dgz_A 488 Thioredoxin reductase 2; oxidoreductase, rossmann, 1e-108
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 4e-23
3dgh_A 483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 1e-108
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 4e-24
1fec_A 490 Trypanothione reductase; redox-active center, oxid 1e-103
1fec_A490 Trypanothione reductase; redox-active center, oxid 3e-19
2wpf_A 495 Trypanothione reductase; oxidoreductase, trypanoso 1e-103
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 3e-19
2hqm_A 479 GR, grase, glutathione reductase; glutathione redu 1e-101
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 2e-19
4dna_A 463 Probable glutathione reductase; structural genomic 6e-99
4dna_A463 Probable glutathione reductase; structural genomic 2e-20
2r9z_A 463 Glutathione amide reductase; NAD, FAD, substrate s 1e-98
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 7e-20
3o0h_A 484 Glutathione reductase; ssgcid, structur genomics, 5e-97
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 1e-18
3dk9_A 478 Grase, GR, glutathione reductase; flavoenzyme, nic 3e-96
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 4e-21
1ges_A 450 Glutathione reductase; oxidoreductase(flavoenzyme) 6e-92
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 7e-21
1onf_A 500 GR, grase, glutathione reductase; oxidoreductase; 6e-82
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 8e-17
1zk7_A 467 HGII, reductase, mercuric reductase; mercuric ION 9e-46
1mo9_A 523 ORF3; nucleotide binding motifs, nucleotide bindin 2e-43
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 8e-05
3ic9_A 492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 3e-39
3lad_A 476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 4e-39
2qae_A 468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 1e-36
1dxl_A 470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 3e-36
3urh_A 491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 8e-36
2a8x_A 464 Dihydrolipoyl dehydrogenase, E3 component of alpha 1e-35
1zmd_A 474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 2e-35
1ebd_A 455 E3BD, dihydrolipoamide dehydrogenase; redox-active 1e-34
1v59_A 478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 2e-34
1xdi_A 499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 1e-33
3l8k_A 466 Dihydrolipoyl dehydrogenase; redox-active center, 3e-33
1ojt_A 482 Surface protein; redox-active center, glycolysis, 1e-32
1lvl_A 458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 4e-32
2yqu_A 455 2-oxoglutarate dehydrogenase E3 component; lipoami 6e-32
2eq6_A 464 Pyruvate dehydrogenase complex, dihydrolipoamide d 3e-30
2uzz_A 372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 5e-08
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 2e-07
2oln_A 397 NIKD protein; flavoprotein, rossmann fold, oxidore 2e-07
3s5w_A 463 L-ornithine 5-monooxygenase; class B flavin depend 3e-07
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 1e-06
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 1e-06
2cdu_A 452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 1e-06
2gf3_A 389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 1e-06
1nhp_A 447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 2e-06
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 2e-06
4at0_A 510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 2e-06
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 2e-06
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 2e-06
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 3e-06
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 4e-06
2bc0_A 490 NADH oxidase; flavoprotein, pyridine nucleotide di 6e-06
1qo8_A 566 Flavocytochrome C3 fumarate reductase; oxidoreduct 6e-06
3fbs_A 297 Oxidoreductase; structural genomics, PSI2, MCSG, p 9e-06
3d1c_A 369 Flavin-containing putative monooxygenase; NP_37310 1e-05
3fg2_P 404 Putative rubredoxin reductase; ferredoxin reductas 1e-05
3ef6_A 410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 1e-05
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 2e-05
1o94_A 729 Tmadh, trimethylamine dehydrogenase; electron tran 2e-05
1d4d_A 572 Flavocytochrome C fumarate reductase; oxidoreducta 2e-05
3nix_A 421 Flavoprotein/dehydrogenase; structural genomics, P 2e-05
4fk1_A 304 Putative thioredoxin reductase; structural genomic 3e-05
2gqw_A 408 Ferredoxin reductase; flavoprotein, oxidoreductase 3e-05
3dje_A 438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 3e-05
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 4e-05
1q1r_A 431 Putidaredoxin reductase; glutathione reductase fol 5e-05
3h8l_A 409 NADH oxidase; membrane protein, complete form, ros 6e-05
3atr_A 453 Conserved archaeal protein; saturating double bond 7e-05
1xhc_A 367 NADH oxidase /nitrite reductase; southe collaborat 7e-05
2i0z_A 447 NAD(FAD)-utilizing dehydrogenases; structural geno 9e-05
3cgv_A 397 Geranylgeranyl reductase related protein; NP_39399 1e-04
3lxd_A 415 FAD-dependent pyridine nucleotide-disulphide oxido 1e-04
3v76_A 417 Flavoprotein; structural genomics, PSI-biology, NE 1e-04
1ryi_A 382 Glycine oxidase; flavoprotein, protein-inhibitor c 2e-04
1y0p_A 571 Fumarate reductase flavoprotein subunit; flavocyto 2e-04
2gqf_A 401 Hypothetical protein HI0933; structural genomics, 2e-04
1yqz_A 438 Coenzyme A disulfide reductase; oxidoreductase; HE 2e-04
3hdq_A 397 UDP-galactopyranose mutase; substrate and inhibito 2e-04
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 2e-04
3k7m_X 431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 3e-04
3klj_A 385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 4e-04
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 4e-04
1s3e_A 520 Amine oxidase [flavin-containing] B; human monoami 4e-04
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 5e-04
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 5e-04
1m6i_A 493 Programmed cell death protein 8; apoptosis, AIF, o 6e-04
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 6e-04
1i8t_A 367 UDP-galactopyranose mutase; rossman fold, FAD, con 7e-04
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 7e-04
2bi7_A 384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 7e-04
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 7e-04
2yg5_A 453 Putrescine oxidase; oxidoreductase, flavin; HET: F 9e-04
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Length = 519 Back     alignment and structure
 Score =  329 bits (846), Expect = e-110
 Identities = 126/210 (60%), Positives = 159/210 (75%), Gaps = 2/210 (0%)

Query: 86  VQYKNVAEVRQDNTHKYDYDLLVLGGGSGGLAAAKEAAAHGRKVIVLDYVIPSPQGTTWG 145
           V   +     +D    YDYDL+++GGGSGGLAAAKEAA +G+KV+VLD+V P+P GT WG
Sbjct: 15  VPRGSHMNGPEDLPKSYDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWG 74

Query: 146 LGGTCVNVGCIPKKLMHQAALLGEAIKDAVAYGWEIPNVKSVQHNWANLREAVQNHVKSV 205
           LGGTCVNVGCIPKKLMHQAALLG+A++D+  YGW++   ++V+H+W  + EAVQNH+ S+
Sbjct: 75  LGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKVE--ETVKHDWDRMIEAVQNHIGSL 132

Query: 206 NWVTRVMLRDKKVDYLNALGKFIDQHSVEATMKNGEKKTLTAENILIATGGRPNYPDIPG 265
           NW  RV LR+KKV Y NA G+FI  H ++AT   G++K  +AE  LIATG RP Y  IPG
Sbjct: 133 NWGYRVALREKKVVYENAYGQFIGPHRIKATNNKGKEKIYSAERFLIATGERPRYLGIPG 192

Query: 266 AKEHCISSDDIFSLEKPPGKTLVVGAGYIG 295
            KE+CISSDD+FSL   PGKTLVVGA Y+ 
Sbjct: 193 DKEYCISSDDLFSLPYCPGKTLVVGASYVA 222


>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Length = 519 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Length = 598 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Length = 598 Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Length = 488 Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Length = 488 Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Length = 483 Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Length = 483 Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Length = 490 Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Length = 490 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Length = 495 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Length = 495 Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Length = 479 Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Length = 479 Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Length = 463 Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Length = 463 Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Length = 463 Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Length = 463 Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Length = 484 Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Length = 484 Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Length = 478 Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Length = 478 Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Length = 450 Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Length = 450 Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 500 Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 500 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Length = 467 Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Length = 523 Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Length = 523 Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Length = 492 Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Length = 476 Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Length = 468 Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 470 Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Length = 491 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Length = 464 Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Length = 474 Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 455 Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Length = 478 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Length = 499 Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Length = 466 Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Length = 482 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 458 Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Length = 455 Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Length = 464 Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Length = 372 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Length = 671 Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Length = 397 Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Length = 463 Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Length = 472 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Length = 452 Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Length = 389 Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Length = 447 Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Length = 480 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Length = 510 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Length = 449 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Length = 690 Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Length = 965 Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Length = 490 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Length = 566 Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Length = 297 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Length = 369 Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Length = 404 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} Length = 410 Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Length = 452 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Length = 729 Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421 Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Length = 304 Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Length = 408 Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Length = 438 Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Length = 493 Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Length = 431 Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Length = 409 Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 367 Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Length = 447 Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Length = 415 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Length = 417 Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Length = 382 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571 Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Length = 401 Back     alignment and structure
>1yqz_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.54A {Staphylococcus aureus} Length = 438 Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Length = 397 Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Length = 662 Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Length = 431 Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Length = 385 Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Length = 643 Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Length = 520 Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Length = 623 Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Length = 493 Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Length = 621 Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Length = 367 Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Length = 588 Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Length = 384 Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591 Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Length = 453 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query312
4b1b_A 542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 99.93
3qfa_A 519 Thioredoxin reductase 1, cytoplasmic; protein-prot 99.93
3dgz_A 488 Thioredoxin reductase 2; oxidoreductase, rossmann, 99.92
3dgh_A 483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 99.91
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 99.9
3dk9_A 478 Grase, GR, glutathione reductase; flavoenzyme, nic 99.86
3l8k_A 466 Dihydrolipoyl dehydrogenase; redox-active center, 99.86
1zmd_A 474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 99.86
2r9z_A 463 Glutathione amide reductase; NAD, FAD, substrate s 99.86
1fec_A 490 Trypanothione reductase; redox-active center, oxid 99.86
3lad_A 476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.85
2wpf_A 495 Trypanothione reductase; oxidoreductase, trypanoso 99.85
2hqm_A 479 GR, grase, glutathione reductase; glutathione redu 99.85
2qae_A 468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 99.85
3urh_A 491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 99.85
1ebd_A 455 E3BD, dihydrolipoamide dehydrogenase; redox-active 99.85
1ges_A 450 Glutathione reductase; oxidoreductase(flavoenzyme) 99.85
1onf_A 500 GR, grase, glutathione reductase; oxidoreductase; 99.85
3ic9_A 492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 99.84
1dxl_A 470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 99.84
1zk7_A 467 HGII, reductase, mercuric reductase; mercuric ION 99.84
2yqu_A 455 2-oxoglutarate dehydrogenase E3 component; lipoami 99.84
4dna_A 463 Probable glutathione reductase; structural genomic 99.84
3o0h_A 484 Glutathione reductase; ssgcid, structur genomics, 99.84
2a8x_A 464 Dihydrolipoyl dehydrogenase, E3 component of alpha 99.83
2eq6_A 464 Pyruvate dehydrogenase complex, dihydrolipoamide d 99.83
1lvl_A 458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.83
1ojt_A 482 Surface protein; redox-active center, glycolysis, 99.82
1xdi_A 499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 99.81
1v59_A 478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 99.81
4gcm_A 312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 99.79
1mo9_A 523 ORF3; nucleotide binding motifs, nucleotide bindin 99.74
4a5l_A 314 Thioredoxin reductase; oxidoreductase, redox metab 99.71
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 99.69
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 99.66
4fk1_A 304 Putative thioredoxin reductase; structural genomic 99.64
2q7v_A 325 Thioredoxin reductase; rossman fold, FAD, flavopro 99.64
4b63_A 501 L-ornithine N5 monooxygenase; oxidoreductase, side 99.63
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 99.63
3fbs_A 297 Oxidoreductase; structural genomics, PSI2, MCSG, p 99.63
2gv8_A 447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 99.63
1fl2_A 310 Alkyl hydroperoxide reductase subunit F; reactive 99.63
2q0l_A 311 TRXR, thioredoxin reductase; bacterial thiredoxin 99.62
3f8d_A 323 Thioredoxin reductase (TRXB-3); redox protein, nuc 99.61
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 99.6
3klj_A 385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 99.6
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 99.59
3itj_A 338 Thioredoxin reductase 1; disulfide B flavoprotein, 99.59
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 99.58
4a9w_A 357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 99.58
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 99.58
2a87_A 335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 99.57
3r9u_A 315 Thioredoxin reductase; structural genomics, center 99.56
3cty_A 319 Thioredoxin reductase; FAD, oxidoreductase, flavin 99.56
1vdc_A 333 NTR, NADPH dependent thioredoxin reductase; hypoth 99.55
1xhc_A 367 NADH oxidase /nitrite reductase; southe collaborat 99.55
3s5w_A 463 L-ornithine 5-monooxygenase; class B flavin depend 99.54
1trb_A 320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 99.54
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 99.54
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 99.54
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 99.53
1ojt_A482 Surface protein; redox-active center, glycolysis, 99.53
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 99.52
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 99.52
2zbw_A 335 Thioredoxin reductase; redox protein, oxidoreducta 99.52
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 99.52
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 99.52
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 99.51
1fec_A490 Trypanothione reductase; redox-active center, oxid 99.51
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 99.51
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 99.5
2gqw_A 408 Ferredoxin reductase; flavoprotein, oxidoreductase 99.5
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 99.5
2bc0_A 490 NADH oxidase; flavoprotein, pyridine nucleotide di 99.49
3d1c_A 369 Flavin-containing putative monooxygenase; NP_37310 99.49
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 99.49
3ef6_A 410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 99.49
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 99.49
3lxd_A 415 FAD-dependent pyridine nucleotide-disulphide oxido 99.48
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 99.48
3lzw_A 332 Ferredoxin--NADP reductase 2; ferredoxin reductase 99.48
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 99.48
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 99.47
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 99.47
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 99.47
3ab1_A 360 Ferredoxin--NADP reductase; oxidoreductase, electr 99.47
1q1r_A 431 Putidaredoxin reductase; glutathione reductase fol 99.47
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 99.47
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 99.47
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 99.46
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 99.46
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 99.46
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.46
3fg2_P 404 Putative rubredoxin reductase; ferredoxin reductas 99.46
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 99.46
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 99.46
2cdu_A 452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 99.46
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 99.45
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 99.45
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 99.45
1nhp_A 447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 99.45
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 99.45
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 99.45
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 99.45
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 99.44
4dna_A463 Probable glutathione reductase; structural genomic 99.44
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 99.44
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 99.43
2v3a_A 384 Rubredoxin reductase; alkane degradation, NADH oxi 99.43
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 99.43
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 99.43
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 99.42
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.42
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 99.41
4eqs_A 437 Coenzyme A disulfide reductase; oxidoreductase; HE 99.41
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 99.4
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 99.39
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 99.38
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.38
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 99.37
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.36
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.36
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 99.36
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 99.34
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 99.33
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 99.32
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 99.32
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 99.32
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 99.31
2vdc_G 456 Glutamate synthase [NADPH] small chain; oxidoreduc 99.3
1lqt_A 456 FPRA; NADP+ derivative, oxidoreductase, structural 99.28
1cjc_A 460 Protein (adrenodoxin reductase); flavoenzyme, MAD 99.27
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 99.27
1o94_A 729 Tmadh, trimethylamine dehydrogenase; electron tran 99.26
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 99.26
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 99.25
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 99.25
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 99.24
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 99.23
1m6i_A 493 Programmed cell death protein 8; apoptosis, AIF, o 99.2
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 99.19
4g6h_A 502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 99.18
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 99.18
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 99.18
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 99.15
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 99.14
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 99.14
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 99.13
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 99.13
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 99.13
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 99.12
2gqf_A 401 Hypothetical protein HI0933; structural genomics, 99.09
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 99.09
3h8l_A 409 NADH oxidase; membrane protein, complete form, ros 99.09
3r9u_A315 Thioredoxin reductase; structural genomics, center 99.08
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 99.07
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 99.06
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 99.04
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 99.03
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 99.03
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 99.02
2cul_A232 Glucose-inhibited division protein A-related PROT 99.01
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 99.0
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 98.97
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 98.96
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 98.96
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 98.96
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 98.95
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 98.9
4fk1_A304 Putative thioredoxin reductase; structural genomic 98.89
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 98.88
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.87
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 98.83
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 98.83
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 98.82
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 98.72
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 98.7
3vrd_B 401 FCCB subunit, flavocytochrome C flavin subunit; su 98.69
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 98.63
1y0p_A 571 Fumarate reductase flavoprotein subunit; flavocyto 98.63
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.63
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 98.62
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 98.59
2e5v_A 472 L-aspartate oxidase; archaea, oxidoreductase; HET: 98.59
3v76_A 417 Flavoprotein; structural genomics, PSI-biology, NE 98.57
1qo8_A 566 Flavocytochrome C3 fumarate reductase; oxidoreduct 98.54
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.53
2i0z_A 447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.53
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 98.51
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 98.49
3fpz_A 326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 98.48
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 98.42
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 98.41
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 98.4
2ywl_A180 Thioredoxin reductase related protein; uncharacter 98.4
3dme_A 369 Conserved exported protein; structural genomics, P 98.39
4at0_A 510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 98.39
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.37
1d4d_A 572 Flavocytochrome C fumarate reductase; oxidoreducta 98.37
2cul_A232 Glucose-inhibited division protein A-related PROT 98.37
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 98.34
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 98.31
3nix_A 421 Flavoprotein/dehydrogenase; structural genomics, P 98.29
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 98.25
2bry_A 497 NEDD9 interacting protein with calponin homology a 98.24
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 98.2
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.19
1y56_B 382 Sarcosine oxidase; dehydrogenase, protein-protein 98.14
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.13
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.13
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 98.12
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 98.11
3alj_A 379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.1
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.06
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.06
3atr_A 453 Conserved archaeal protein; saturating double bond 98.03
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.01
3rp8_A 407 Flavoprotein monooxygenase; FAD-binding protein, o 98.0
3dje_A 438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 98.0
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 97.99
2gag_B 405 Heterotetrameric sarcosine oxidase beta-subunit; f 97.99
2uzz_A 372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 97.96
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 97.94
2oln_A 397 NIKD protein; flavoprotein, rossmann fold, oxidore 97.91
3oz2_A 397 Digeranylgeranylglycerophospholipid reductase; str 97.91
2x3n_A 399 Probable FAD-dependent monooxygenase; oxidoreducta 97.9
3nyc_A 381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 97.86
1k0i_A 394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 97.85
1ryi_A 382 Glycine oxidase; flavoprotein, protein-inhibitor c 97.84
2gf3_A 389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 97.83
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 97.82
3c4n_A 405 Uncharacterized protein DR_0571; alpha-beta protei 97.82
3cgv_A 397 Geranylgeranyl reductase related protein; NP_39399 97.79
2xdo_A 398 TETX2 protein; tetracycline degradation, tigecycli 97.79
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 97.77
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 97.75
2vou_A 397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 97.75
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 97.68
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 97.66
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 97.63
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 97.63
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 97.63
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 97.62
3axb_A 448 Putative oxidoreductase; dinucleotide-binding fold 97.61
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 97.59
1yvv_A 336 Amine oxidase, flavin-containing; oxidoreductase, 97.58
3c96_A 410 Flavin-containing monooxygenase; FAD, oxidoreducta 97.57
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 97.54
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 97.53
2bry_A497 NEDD9 interacting protein with calponin homology a 97.48
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 97.44
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 97.37
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 97.33
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 97.29
3qj4_A 342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 97.28
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 97.28
3kkj_A 336 Amine oxidase, flavin-containing; oxidoreductase, 97.27
3g5s_A 443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 97.25
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 97.21
4hb9_A 412 Similarities with probable monooxygenase; flavin, 97.2
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 97.18
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 97.15
2gqf_A401 Hypothetical protein HI0933; structural genomics, 97.03
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 96.96
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 96.95
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 96.91
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 96.89
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 96.77
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 96.65
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 96.64
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 96.55
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 96.45
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 96.42
4gde_A 513 UDP-galactopyranose mutase; flavin adenine dinucle 96.39
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 96.34
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 96.32
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 96.28
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 96.25
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 96.22
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 96.21
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 96.11
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 96.1
3atr_A453 Conserved archaeal protein; saturating double bond 96.06
3k7m_X 431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 96.04
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 96.04
4gut_A 776 Lysine-specific histone demethylase 1B; histone de 95.98
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 95.91
2bcg_G 453 Secretory pathway GDP dissociation inhibitor; RABG 95.87
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 95.73
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 95.67
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 95.65
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 95.61
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 95.61
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 95.45
1c0p_A 363 D-amino acid oxidase; alpha-beta-alpha motif, flav 95.41
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 95.39
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 95.35
2yg5_A 453 Putrescine oxidase; oxidoreductase, flavin; HET: F 95.34
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 95.29
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 95.24
3t37_A 526 Probable dehydrogenase; BET alpha beta fold, ADP b 95.21
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 95.2
3ihm_A 430 Styrene monooxygenase A; rossman fold, anti-parall 95.19
1rsg_A 516 FMS1 protein; FAD binding motif, oxidoreductase; H 95.19
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 95.18
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 95.12
3hdq_A 397 UDP-galactopyranose mutase; substrate and inhibito 95.11
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 95.1
3nrn_A 421 Uncharacterized protein PF1083; alpha-beta protein 95.06
1s3e_A 520 Amine oxidase [flavin-containing] B; human monoami 94.99
2b9w_A 424 Putative aminooxidase; isomerase, conjugated linol 94.95
2ivd_A 478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 94.88
1v0j_A 399 UDP-galactopyranose mutase; flavoprotein, isomeras 94.83
3ka7_A 425 Oxidoreductase; structural genomics, PSI-2, protei 94.68
1i8t_A 367 UDP-galactopyranose mutase; rossman fold, FAD, con 94.59
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 94.58
3c4a_A 381 Probable tryptophan hydroxylase VIOD; alpha-beta p 94.56
3dme_A369 Conserved exported protein; structural genomics, P 94.54
2vvm_A 495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 94.52
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 94.3
3i6d_A 470 Protoporphyrinogen oxidase; protein-inhibitor comp 94.24
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 94.19
1d5t_A 433 Guanine nucleotide dissociation inhibitor; ultra-h 94.17
2e1m_A 376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 94.15
3g3e_A 351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 94.01
3p1w_A 475 Rabgdi protein; GDI RAB, malaria, structural genom 93.96
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 93.82
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 93.68
1ju2_A 536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 93.64
3nks_A 477 Protoporphyrinogen oxidase; FAD containing protein 93.63
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 93.53
4hb9_A412 Similarities with probable monooxygenase; flavin, 93.47
1sez_A 504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 93.42
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 93.35
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 93.12
2bi7_A 384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 93.08
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 93.03
4dsg_A 484 UDP-galactopyranose mutase; rossmann fold, flavin 92.99
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 92.94
3lov_A 475 Protoporphyrinogen oxidase; structural genomics, J 92.9
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 92.63
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 92.63
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 92.38
1b37_A 472 Protein (polyamine oxidase); flavin-dependent amin 92.22
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 91.94
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 91.93
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 91.48
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 91.25
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 90.94
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 90.77
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 90.47
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 90.43
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 90.38
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 90.34
3dfz_A 223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 90.19
1n4w_A 504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 90.09
1coy_A 507 Cholesterol oxidase; oxidoreductase(oxygen recepto 89.77
2e1m_A 376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 89.6
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 89.48
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 89.42
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 89.33
1gpe_A 587 Protein (glucose oxidase); oxidoreductase(flavopro 89.07
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 88.76
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 88.67
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 88.65
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 88.45
2jbv_A 546 Choline oxidase; alcohol oxidation, flavoenyzme ox 88.17
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 87.99
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 86.49
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 86.46
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 85.57
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 85.13
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 84.74
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 84.56
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 84.35
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 84.32
3fpz_A 326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 84.2
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 83.44
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 83.22
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 83.22
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 83.22
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 83.09
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 82.56
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 82.04
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 81.55
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
Probab=99.93  E-value=2.4e-25  Score=209.15  Aligned_cols=209  Identities=53%  Similarity=0.882  Sum_probs=176.0

Q ss_pred             ccccccEEEEecCcchHHHHHHHHHCCCcEEEEeccCCCCCCcccccCCcccccccchhhHHHHHHHHHHHHH-HHHHcC
Q psy11185        100 HKYDYDLLVLGGGSGGLAAAKEAAAHGRKVIVLDYVIPSPQGTTWGLGGTCVNVGCIPKKLMHQAALLGEAIK-DAVAYG  178 (312)
Q Consensus       100 ~~~~~d~vivg~G~~gl~~a~~~~~~~~~~~~ve~~~~~~~~~v~a~Gd~~~~~~~~~~~~~~~a~~~~~~~~-~~~~~~  178 (312)
                      .+++||+||||+||+|+.+|..+.+.|.++.++|+....+...-+..|+.|.+.+|.|++....+......+. ....|+
T Consensus        39 ~~ydYDviVIG~GpaG~~aA~~aa~~G~kValIE~~~~~~~~~k~~lGGtCln~GCIPsK~L~~aa~~~~~~~~~~~~~G  118 (542)
T 4b1b_A           39 HTYDYDYVVIGGGPGGMASAKEAAAHGARVLLFDYVKPSSQGTKWGIGGTCVNVGCVPKKLMHYAGHMGSIFKLDSKAYG  118 (542)
T ss_dssp             CCSSEEEEEECCSHHHHHHHHHHHTTTCCEEEECCCCCCTTCCCCCSSHHHHHHSHHHHHHHHHHHHHHHHHHHTGGGGT
T ss_pred             CCCCCCEEEECCCHHHHHHHHHHHHCCCeEEEEeccccccccccCCCCCcccccchHHHHHHHHHHHHHHHHHhhhHhcC
Confidence            5678999999999999999999999999999999876665556677899999999999998887776665554 234466


Q ss_pred             CccCCccccccCHHHHHHHHHHHHHHhhHHHHHHHhcCCceEEeceeEEeeCCeEEEEec--CCCeEEEEcCeEEEccCC
Q psy11185        179 WEIPNVKSVQHNWANLREAVQNHVKSVNWVTRVMLRDKKVDYLNALGKFIDQHSVEATMK--NGEKKTLTAENILIATGG  256 (312)
Q Consensus       179 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gV~~~~~~~~~~~~~~~~v~~~--~G~~~~i~ad~vVlAtG~  256 (312)
                      +...   ...+||..+..+.....+.+.......++..+|+++.+...+.++..+.+...  .++.+++.+|++|||||+
T Consensus       119 i~~~---~~~~d~~~~~~~~~~~v~~l~~~~~~~l~~~~V~~i~G~a~f~~~~~v~V~~~~~~~~~~~i~a~~iiIATGs  195 (542)
T 4b1b_A          119 WKFD---NLKHDWKKLVTTVQSHIRSLNFSYMTGLRSSKVKYINGLAKLKDKNTVSYYLKGDLSKEETVTGKYILIATGC  195 (542)
T ss_dssp             EEEE---EEEECHHHHHHHHHHHHHHHHHHHHHHHHHTTCEEECEEEEEEETTEEEEEEC--CCCEEEEEEEEEEECCCE
T ss_pred             cccC---cccccHHHHHHHHHHHHHHHHHHHHHHHHhCCCEEEeeeEEEcCCCcceEeecccCCceEEEeeeeEEeccCC
Confidence            5433   36789999999988888887777777888999999999999999998887653  244578999999999999


Q ss_pred             CCCCCCCCCC-CcceeccccccCCCCCCCeEEEEcCchhhHHHHHHhhcCceeeee
Q psy11185        257 RPNYPDIPGA-KEHCISSDDIFSLEKPPGKTLVVGAGYIGKLETWDSNSGCGNVTI  311 (312)
Q Consensus       257 ~p~~p~~~g~-~~~~~~~~~~~~~~~~~~~v~VvG~G~sa~~~a~~l~~~~~~V~~  311 (312)
                      .|..|+.++. ....+++++++.+...|++++|||||++|+|.|..+...+.+||+
T Consensus       196 ~P~~P~~~~~~~~~~~ts~~~l~l~~lP~~lvIIGgG~IGlE~A~~~~~lG~~VTi  251 (542)
T 4b1b_A          196 RPHIPDDVEGAKELSITSDDIFSLKKDPGKTLVVGASYVALECSGFLNSLGYDVTV  251 (542)
T ss_dssp             EECCCSSSBTHHHHCBCHHHHTTCSSCCCSEEEECCSHHHHHHHHHHHHHTCCEEE
T ss_pred             CCCCCCcccCCCccccCchhhhccccCCceEEEECCCHHHHHHHHHHHhcCCeEEE
Confidence            9999865544 455789999999999999999999999999999999999999987



>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 312
d1onfa1259 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase 6e-24
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 3e-21
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 7e-21
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 3e-20
d1h6va1235 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin 4e-19
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 1e-16
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 2e-16
d1feca1240 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas 3e-16
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 4e-16
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 2e-14
d1lvla1220 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd 4e-14
d1aoga1238 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas 1e-13
d1xdia1233 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehyd 3e-13
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 5e-12
d1h6va2122 c.3.1.5 (A:171-292) Mammalian thioredoxin reductas 2e-10
d1h6va2122 c.3.1.5 (A:171-292) Mammalian thioredoxin reductas 3e-07
d2gqfa1253 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H 6e-10
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 4e-09
d1onfa2117 c.3.1.5 (A:154-270) Glutathione reductase {Plasmod 1e-08
d1onfa2117 c.3.1.5 (A:154-270) Glutathione reductase {Plasmod 2e-05
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 2e-08
d1gesa2116 c.3.1.5 (A:147-262) Glutathione reductase {Escheri 2e-08
d1aoga2117 c.3.1.5 (A:170-286) Trypanothione reductase {Trypa 7e-08
d1neka2 330 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase 1e-07
d1feca2117 c.3.1.5 (A:170-286) Trypanothione reductase {Crith 1e-07
d1d5ta1 336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 2e-07
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 9e-07
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 1e-06
d2gf3a1281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 1e-06
d3grsa2125 c.3.1.5 (A:166-290) Glutathione reductase {Human ( 1e-06
d2bs2a2 336 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo 2e-06
d1jnra2 356 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reduct 4e-06
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 4e-06
d1ebda2117 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase 5e-06
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 7e-06
d1xhca2122 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductas 8e-06
d1xhca2122 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductas 0.003
d1ojta2125 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase 9e-06
d1lvla2115 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase 1e-05
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 2e-05
d1kf6a2311 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es 2e-05
d1dxla2123 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase 2e-05
d1chua2305 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E 3e-05
d1b5qa1 347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 3e-05
d1v59a2122 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase 5e-05
d1i8ta1298 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu 6e-05
d2v5za1 383 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H 1e-04
d2ag5a1245 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR fami 2e-04
d3lada2119 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase 2e-04
d1pj5a2305 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine ox 2e-04
d2f5va1 379 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W 4e-04
d1hdca_254 c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydr 6e-04
d2gjca1311 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th 7e-04
d2ivda1 347 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox 8e-04
d2iida1 370 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M 8e-04
d3coxa1 370 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of 8e-04
d1fl2a1184 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide 9e-04
d1djqa2156 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, 0.001
d2dw4a2 449 c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist 0.001
d1seza1 373 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox 0.002
d1n4wa1 367 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of 0.002
d1k0ia1292 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr 0.002
d1trba1190 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase 0.002
d2cula1230 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {T 0.003
d1kdga1 360 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain 0.003
d1w4xa1298 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy 0.003
d1c0pa1268 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida 0.003
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: Glutathione reductase
species: Plasmodium falciparum [TaxId: 5833]
 Score = 96.3 bits (238), Expect = 6e-24
 Identities = 52/202 (25%), Positives = 88/202 (43%), Gaps = 20/202 (9%)

Query: 104 YDLLVLGGGSGGLAAAKEAAAHGRKVIVLDYVIPSPQGTTWGLGGTCVNVGCIPKKLMHQ 163
           YDL+V+GGGSGG+AAA+ AA H  KV +++            LGGTCVNVGC+PKK+M  
Sbjct: 2   YDLIVIGGGSGGMAAARRAARHNAKVALVEK---------SRLGGTCVNVGCVPKKIMFN 52

Query: 164 AALLGEAIKDAVAYGWEIPNVKSVQHNWANLREAVQNHVKSV------NWVTRVMLRDKK 217
           AA + + ++++  YG++     ++        + +Q            + V         
Sbjct: 53  AASVHDILENSRHYGFDTKFSFNLPLLVERRDKYIQRLNNIYRQNLSKDKVDLYEGTASF 112

Query: 218 VDYLNALGKFIDQHSVEATMKNGEKKTLTAENILIATGGRPNYPDIPGAKEHC----ISS 273
           +     L K    ++ +      E + L   NILIA G +P                + +
Sbjct: 113 LSENRILIKGTKDNNNKDNGPLNE-EILEGRNILIAVGNKPVGRSPDTENLKLEKLNVET 171

Query: 274 DDIFSLEKPPGKTLVVGAGYIG 295
           ++ + +     +T V     +G
Sbjct: 172 NNNYIVVDENQRTSVNNIYAVG 193


>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 233 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 122 Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 122 Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 117 Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 117 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 116 Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 117 Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 117 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 356 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 117 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Length = 122 Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Length = 122 Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 125 Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 115 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311 Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 123 Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 122 Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 119 Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Length = 305 Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Length = 254 Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370 Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Length = 156 Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Length = 367 Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Length = 190 Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Length = 230 Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360 Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298 Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query312
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 99.76
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 99.72
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.64
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.63
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 99.62
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.62
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 99.61
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 99.58
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.58
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 99.57
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.57
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 99.55
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.54
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.52
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.5
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.45
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.45
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.45
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 99.41
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.39
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.38
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.38
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 99.37
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 99.36
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 99.35
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.34
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 99.34
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.32
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.31
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.3
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 99.25
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.25
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.22
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.15
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 99.13
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.07
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 98.98
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 98.96
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.95
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.92
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 98.9
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.83
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.83
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 98.82
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 98.78
d2bs2a2 336 Fumarate reductase {Wolinella succinogenes [TaxId: 98.74
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.7
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 98.7
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 98.7
d1neka2 330 Succinate dehydogenase {Escherichia coli [TaxId: 5 98.61
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 98.59
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.55
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 98.54
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.53
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 98.51
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.49
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.47
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 98.47
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 98.46
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.42
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.41
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 98.4
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.4
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.38
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.38
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.38
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.37
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 98.35
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 98.34
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.33
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.31
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 98.3
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 98.29
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.28
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 98.27
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.25
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 98.25
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.25
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 98.25
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.23
d1jnra2 356 Adenylylsulfate reductase A subunit {Archaeon Arch 98.23
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 98.22
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.22
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.19
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 98.17
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.16
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.14
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.14
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.13
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.12
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 98.11
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 98.08
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.05
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.02
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 98.0
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.98
d1ps9a2 162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 97.97
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.93
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 97.93
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.93
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 97.88
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.88
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.86
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 97.86
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.84
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 97.83
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 97.82
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 97.78
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 97.73
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 97.65
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.65
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 97.59
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 97.58
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 97.41
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 97.35
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 97.29
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 97.26
d2gmha1 380 Electron transfer flavoprotein-ubiquinone oxidored 97.25
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 97.25
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 97.2
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 97.11
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 97.1
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 97.08
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 97.08
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 97.01
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 97.01
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 96.82
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 96.81
d2f5va1 379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 96.78
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 96.71
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 96.7
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 96.67
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 96.53
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 96.38
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 96.38
d1w4xa2 235 Phenylacetone monooxygenase {Thermobifida fusca [T 96.3
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 96.27
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 96.14
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 96.03
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 95.86
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 95.86
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 95.7
d1kdga1 360 Flavoprotein domain of flavocytochrome cellobiose 95.67
d3coxa1 370 Cholesterol oxidase of GMC family {Brevibacterium 95.55
d1djqa3 233 Trimethylamine dehydrogenase, middle domain {Methy 95.54
d1n4wa1 367 Cholesterol oxidase of GMC family {Streptomyces sp 95.32
d1cjca1 225 Adrenodoxin reductase of mitochondrial p450 system 95.26
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 95.24
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 95.0
d1gpea1 391 Glucose oxidase {Penicillium amagasakiense [TaxId: 94.92
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 94.92
d1lqta1 216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 94.89
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 94.87
d1fcda2141 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 94.87
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 94.85
d1ju2a1 351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 94.78
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 94.67
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 94.65
d1cf3a1 385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 94.52
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 94.51
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 94.38
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 94.14
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 93.81
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 93.41
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 93.04
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 92.71
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 92.5
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 92.28
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 91.16
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 91.09
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 90.77
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 90.14
d1rp0a1 278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 89.8
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 89.52
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 89.48
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 89.48
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 88.94
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 88.79
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 87.6
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 87.06
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 86.64
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 86.12
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 85.97
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 85.68
d1pjca1 168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 84.41
d1vg0a1 491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 84.09
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 83.69
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 83.61
d2gmha1 380 Electron transfer flavoprotein-ubiquinone oxidored 83.48
d2gjca1 311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 83.41
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 83.3
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 83.21
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 83.04
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 82.4
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: Glutathione reductase
species: Plasmodium falciparum [TaxId: 5833]
Probab=99.76  E-value=1.2e-18  Score=147.35  Aligned_cols=178  Identities=32%  Similarity=0.543  Sum_probs=130.0

Q ss_pred             ccEEEEecCcchHHHHHHHHHCCCcEEEEeccCCCCCCcccccCCcccccccchhhHHHHHHHHHHHHHHHHHcCCccCC
Q psy11185        104 YDLLVLGGGSGGLAAAKEAAAHGRKVIVLDYVIPSPQGTTWGLGGTCVNVGCIPKKLMHQAALLGEAIKDAVAYGWEIPN  183 (312)
Q Consensus       104 ~d~vivg~G~~gl~~a~~~~~~~~~~~~ve~~~~~~~~~v~a~Gd~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~  183 (312)
                      ||++|||+||+|+.+|..+.+.|.++.++|+.         ..|+.|.+.+|.|++....+......+.....|++..  
T Consensus         2 yDviVIG~G~aG~~aA~~aa~~G~~V~liE~~---------~~GGtc~n~gciPsK~l~~~~~~~~~~~~~~~~G~~~--   70 (259)
T d1onfa1           2 YDLIVIGGGSGGMAAARRAARHNAKVALVEKS---------RLGGTCVNVGCVPKKIMFNAASVHDILENSRHYGFDT--   70 (259)
T ss_dssp             BSEEEECCSHHHHHHHHHHHHTTCCEEEEESS---------STTHHHHHTSHHHHHHHHHHHHHHHHHHHGGGGTCCC--
T ss_pred             ceEEEECCCHHHHHHHHHHHHCCCeEEEEecC---------CCCCeEEeeCCcchHHHHhhhhcccchhccccccccc--
Confidence            79999999999999999999999999999964         3688899999999999888888888887777777653  


Q ss_pred             ccccccCHHHHHHHHHHHHHHhhHHHHHHHhcCCceEEeceeEEeeCCeEEEEecC---------CCeEEEEcCeEEEcc
Q psy11185        184 VKSVQHNWANLREAVQNHVKSVNWVTRVMLRDKKVDYLNALGKFIDQHSVEATMKN---------GEKKTLTAENILIAT  254 (312)
Q Consensus       184 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gV~~~~~~~~~~~~~~~~v~~~~---------G~~~~i~ad~vVlAt  254 (312)
                        ...++|..+..........+.......+...+|+++.+...+.+...+.+....         ++.+.+.+|++|+||
T Consensus        71 --~~~~~~~~~~~~~~~~i~~~~~~~~~~l~~~gV~vi~G~a~f~~~~~v~v~~~~~~~~~~~~~~~~~~i~a~~iiIAT  148 (259)
T d1onfa1          71 --KFSFNLPLLVERRDKYIQRLNNIYRQNLSKDKVDLYEGTASFLSENRILIKGTKDNNNKDNGPLNEEILEGRNILIAV  148 (259)
T ss_dssp             --CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHTTCEEEESCCCCC--------------------------CBSSEEECC
T ss_pred             --hhhhhhhhHHhhhheeeeccccchhhhcccccceEEeeecccccccccccccceeccccccCccceEEEeeeeEEEec
Confidence              356889988888877777777777777888999999998777776666554321         123579999999999


Q ss_pred             CCCCC----CCCCCCCCcc-eeccccccCCCCCCCeEEEEcCchhh
Q psy11185        255 GGRPN----YPDIPGAKEH-CISSDDIFSLEKPPGKTLVVGAGYIG  295 (312)
Q Consensus       255 G~~p~----~p~~~g~~~~-~~~~~~~~~~~~~~~~v~VvG~G~sa  295 (312)
                      |++|.    .|+..+++.. +++++.+..+...+ +.+|+|+|.+|
T Consensus       149 Gs~P~~~~~~~~~~~l~~~~i~ts~~~~~~d~~~-~t~Vig~gaiG  193 (259)
T d1onfa1         149 GNKPVGRSPDTENLKLEKLNVETNNNYIVVDENQ-RTSVNNIYAVG  193 (259)
T ss_dssp             CCCBCCBCCTTTTSSCTTTTCCBSSSCEEECTTC-BCSSSSEEECS
T ss_pred             CCCCccccccccccccccceeeecccccccccCC-ceeEeeEEEEE
Confidence            99984    2333344433 56777777776655 55788888776



>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcda2 c.3.1.5 (A:115-255) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure