Psyllid ID: psy1122

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150
MGVVCVGVVTIFQECQPEFLHDLVLKMKAYIFTPGDLICRKGEVAREMFIIADGILEVISESGRVLTTMKAGDFFGEIGILNLDGLNKRTADVRSVGYAELFSLSREDVLSAMKDYPEAQEILQNLGRKRLMEAKNLNKKFKVDAEKSKR
ccccccccccccccccHHHHHHHHHHccEEEEccccEEEEccccccEEEEEEEcEEEEEEcccEEEEEEccccEEEcccEEccccccccEEEEEEccEEEEEEEcHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccccccccHHHccc
cccEEEEEEEEEcccccHHHHHHHHHccccHcccccEEEEccccccEEEEEEccEEEEEEcccEEEEEEcccccEEEEEEEEEccccccEEEEEEcccccHEEccHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccc
MGVVCVGVVTIFQECQPEFLHDLVLKMKAyiftpgdlicrkgeVAREMFIIADGILEVISESGRVlttmkagdffgeigilnldglnkrtadVRSVGYAELFSLSREDVLSAMKDYPEAQEILQNLGRKRLMEAKNLNKKFKvdaekskr
MGVVCVGVVTIFQECQPEFLHDLVLKMKAYIFTPGDLICRKGEVAREMFIIADGILEVISESGRVLTTMKAGDFFGEIGILNLDGLNKRTADVRSVGYAELFSLSREDVLSAMKDYPEAQEILQNLGRKRLMeaknlnkkfkvdaekskr
MGVVCVGVVTIFQECQPEFLHDLVLKMKAYIFTPGDLICRKGEVAREMFIIADGILEVISESGRVLTTMKAGDFFGEIGILNLDGLNKRTADVRSVGYAELFSLSREDVLSAMKDYPEAQEILQNLGRKRLMEAKNLNKKFKVDAEKSKR
**VVCVGVVTIFQECQPEFLHDLVLKMKAYIFTPGDLICRKGEVAREMFIIADGILEVISESGRVLTTMKAGDFFGEIGILNLDGLNKRTADVRSVGYAELFSLSREDVLSA**************************************
*GVVCVGVVTIFQECQPEFLHDLVLKMKAYIFTPGDLICRKGEVAREMFIIADGILEVISESGRVLTTMKAGDFFGEIGILNLDGLNKRTADVRSVGYAELFSLSREDVLSAMKDYPEAQEILQNL************************
MGVVCVGVVTIFQECQPEFLHDLVLKMKAYIFTPGDLICRKGEVAREMFIIADGILEVISESGRVLTTMKAGDFFGEIGILNLDGLNKRTADVRSVGYAELFSLSREDVLSAMKDYPEAQEILQNLGRKRLMEAKNLNKKF*********
*GVVCVGVVTIFQECQPEFLHDLVLKMKAYIFTPGDLICRKGEVAREMFIIADGILEVISESGRVLTTMKAGDFFGEIGILNLDGLNKRTADVRSVGYAELFSLSREDVLSAMKDYPEAQEILQNLGRKRLMEAKNLNKKFKVDA*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGVVCVGVVTIFQECQPEFLHDLVLKMKAYIFTPGDLICRKGEVAREMFIIADGILEVISESGRVLTTMKAGDFFGEIGILNLDGLNKRTADVRSVGYAELFSLSREDVLSAMKDYPEAQEILQNLGRKRLMEAKNLNKKFKVDAEKSKR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query150 2.2.26 [Sep-21-2011]
Q03611733 Cyclic nucleotide-gated c yes N/A 0.853 0.174 0.451 6e-30
Q90805735 Cyclic nucleotide-gated c yes N/A 0.833 0.170 0.465 7e-30
Q29441706 Cyclic nucleotide-gated c yes N/A 0.833 0.177 0.465 1e-29
Q16281694 Cyclic nucleotide-gated c yes N/A 0.833 0.180 0.449 3e-29
Q9JJZ8631 Cyclic nucleotide-gated c yes N/A 0.833 0.198 0.449 4e-29
Q62398664 Cyclic nucleotide-gated o no N/A 0.833 0.188 0.457 5e-29
Q28718664 Cyclic nucleotide-gated o no N/A 0.833 0.188 0.457 6e-29
Q00195664 Cyclic nucleotide-gated o yes N/A 0.833 0.188 0.457 6e-29
Q03041663 Cyclic nucleotide-gated o no N/A 0.833 0.188 0.457 7e-29
P55934682 Cyclic nucleotide-gated c N/A N/A 0.82 0.180 0.456 1e-28
>sp|Q03611|CNG_CAEEL Cyclic nucleotide-gated cation channel OS=Caenorhabditis elegans GN=tax-4 PE=2 SV=3 Back     alignment and function desciption
 Score =  129 bits (324), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 60/133 (45%), Positives = 97/133 (72%), Gaps = 5/133 (3%)

Query: 9   VTIFQECQPEFLHDLVLKMKAYIFTPGDLICRKGEVAREMFIIADGILEVISESG-RVLT 67
           V IFQ+C+   L +LVLK++  +F+PGD IC+KG++ REM+I+  G L+V+ + G +V  
Sbjct: 491 VRIFQDCEAGLLAELVLKLQLQVFSPGDFICKKGDIGREMYIVKRGRLQVVDDDGKKVFV 550

Query: 68  TMKAGDFFGEIGILNLDGL---NKRTADVRSVGYAELFSLSREDVLSAMKDYPEAQEILQ 124
           T++ G  FGE+ ILN+ G    N+RTA+VRSVGY +LF LS+ D+ +A+++YP+A+++L 
Sbjct: 551 TLQEGSVFGELSILNIAGSKNGNRRTANVRSVGYTDLFVLSKTDLWNALREYPDARKLLL 610

Query: 125 NLGRKRLMEAKNL 137
             GR+ +++  NL
Sbjct: 611 AKGRE-ILKKDNL 622
Required for normal thermosensation and chemosensation sensory behavior.
Caenorhabditis elegans (taxid: 6239)
>sp|Q90805|CNG1_CHICK Cyclic nucleotide-gated channel cone photoreceptor subunit alpha OS=Gallus gallus PE=2 SV=1 Back     alignment and function description
>sp|Q29441|CNGA3_BOVIN Cyclic nucleotide-gated cation channel alpha-3 OS=Bos taurus GN=CNGA3 PE=2 SV=1 Back     alignment and function description
>sp|Q16281|CNGA3_HUMAN Cyclic nucleotide-gated cation channel alpha-3 OS=Homo sapiens GN=CNGA3 PE=1 SV=2 Back     alignment and function description
>sp|Q9JJZ8|CNGA3_MOUSE Cyclic nucleotide-gated cation channel alpha-3 OS=Mus musculus GN=Cnga3 PE=1 SV=2 Back     alignment and function description
>sp|Q62398|CNGA2_MOUSE Cyclic nucleotide-gated olfactory channel OS=Mus musculus GN=Cnga2 PE=2 SV=2 Back     alignment and function description
>sp|Q28718|CNGA2_RABIT Cyclic nucleotide-gated olfactory channel OS=Oryctolagus cuniculus GN=CNGA2 PE=2 SV=1 Back     alignment and function description
>sp|Q00195|CNGA2_RAT Cyclic nucleotide-gated olfactory channel OS=Rattus norvegicus GN=Cnga2 PE=2 SV=1 Back     alignment and function description
>sp|Q03041|CNGA2_BOVIN Cyclic nucleotide-gated olfactory channel OS=Bos taurus GN=CNGA2 PE=1 SV=1 Back     alignment and function description
>sp|P55934|CNG_ICTPU Cyclic nucleotide-gated cation channel OS=Ictalurus punctatus PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query150
357618087 1716 cyclic-nucleotide-gated cation channel [ 0.94 0.082 0.879 6e-68
194763459 1807 GF21038 [Drosophila ananassae] gi|190618 0.926 0.076 0.878 2e-67
350425587 1349 PREDICTED: hypothetical protein LOC10074 0.893 0.099 0.917 3e-67
340728893 1378 PREDICTED: hypothetical protein LOC10064 0.873 0.095 0.931 3e-67
347969731 1790 AGAP003349-PB [Anopheles gambiae str. PE 0.88 0.073 0.916 5e-67
347969733 1391 AGAP003349-PA [Anopheles gambiae str. PE 0.88 0.094 0.916 5e-67
312376073 2253 hypothetical protein AND_13191 [Anophele 0.88 0.058 0.916 5e-67
170050110 1338 cyclic-nucleotide-gated cation channel [ 0.88 0.098 0.916 5e-67
157103345 1328 cyclic-nucleotide-gated cation channel [ 0.88 0.099 0.916 5e-67
242025178 1908 Thyroid receptor-interacting protein, pu 0.893 0.070 0.940 6e-67
>gi|357618087|gb|EHJ71181.1| cyclic-nucleotide-gated cation channel [Danaus plexippus] Back     alignment and taxonomy information
 Score =  261 bits (667), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 124/141 (87%), Positives = 134/141 (95%)

Query: 9   VTIFQECQPEFLHDLVLKMKAYIFTPGDLICRKGEVAREMFIIADGILEVISESGRVLTT 68
           VTIFQECQPEFLHDLVLKMKAYIFTPGD ICRKGEVAREMFIIADGILEV+SE+GRVLTT
Sbjct: 390 VTIFQECQPEFLHDLVLKMKAYIFTPGDSICRKGEVAREMFIIADGILEVLSETGRVLTT 449

Query: 69  MKAGDFFGEIGILNLDGLNKRTADVRSVGYAELFSLSREDVLSAMKDYPEAQEILQNLGR 128
           MKAGDFFGEIGILNLDGLNKRTADVRSVGY+ELFSLSREDVL+AMKDYPEAQ+ILQ LGR
Sbjct: 450 MKAGDFFGEIGILNLDGLNKRTADVRSVGYSELFSLSREDVLAAMKDYPEAQDILQTLGR 509

Query: 129 KRLMEAKNLNKKFKVDAEKSK 149
           KRL EA+N+++KFK +A   K
Sbjct: 510 KRLQEARNMSRKFKAEASPDK 530

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|194763459|ref|XP_001963850.1| GF21038 [Drosophila ananassae] gi|190618775|gb|EDV34299.1| GF21038 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|350425587|ref|XP_003494169.1| PREDICTED: hypothetical protein LOC100747068 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340728893|ref|XP_003402747.1| PREDICTED: hypothetical protein LOC100643994 [Bombus terrestris] Back     alignment and taxonomy information
>gi|347969731|ref|XP_003436450.1| AGAP003349-PB [Anopheles gambiae str. PEST] gi|333469246|gb|EGK97223.1| AGAP003349-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|347969733|ref|XP_314248.5| AGAP003349-PA [Anopheles gambiae str. PEST] gi|333469245|gb|EAA09666.5| AGAP003349-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|312376073|gb|EFR23270.1| hypothetical protein AND_13191 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|170050110|ref|XP_001859381.1| cyclic-nucleotide-gated cation channel [Culex quinquefasciatus] gi|167871677|gb|EDS35060.1| cyclic-nucleotide-gated cation channel [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157103345|ref|XP_001647938.1| cyclic-nucleotide-gated cation channel [Aedes aegypti] gi|108884770|gb|EAT48995.1| AAEL000014-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|242025178|ref|XP_002433003.1| Thyroid receptor-interacting protein, putative [Pediculus humanus corporis] gi|212518512|gb|EEB20265.1| Thyroid receptor-interacting protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query150
FB|FBgn0263257 1853 cngl "CNG channel-like" [Droso 0.926 0.075 0.871 2.1e-59
UNIPROTKB|I3LSH4485 LOC100739165 "Uncharacterized 0.92 0.284 0.433 6.2e-29
UNIPROTKB|F1NEW7731 CNGA3 "Uncharacterized protein 0.9 0.184 0.448 3.8e-28
UNIPROTKB|Q90805735 Q90805 "Cyclic nucleotide-gate 0.9 0.183 0.448 3.9e-28
UNIPROTKB|Q29441706 CNGA3 "Cyclic nucleotide-gated 0.92 0.195 0.433 5.8e-28
UNIPROTKB|F1NAI9609 CNGA2 "Uncharacterized protein 0.94 0.231 0.413 1.3e-27
UNIPROTKB|F1S2D4663 CNGA2 "Uncharacterized protein 0.833 0.188 0.457 1.3e-27
UNIPROTKB|E2QWD5664 CNGA2 "Uncharacterized protein 0.833 0.188 0.457 1.3e-27
MGI|MGI:108040664 Cnga2 "cyclic nucleotide gated 0.833 0.188 0.457 1.3e-27
RGD|2367664 Cnga2 "cyclic nucleotide gated 0.833 0.188 0.457 1.3e-27
FB|FBgn0263257 cngl "CNG channel-like" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 623 (224.4 bits), Expect = 2.1e-59, P = 2.1e-59
 Identities = 122/140 (87%), Positives = 133/140 (95%)

Query:     9 VTIFQECQPEFLHDLVLKMKAYIFTPGDLICRKGEVAREMFIIADGILEVISESGRVLTT 68
             VTIFQECQPEFLHDLVLKMKAYIFTPGD ICRKGEVAREMFIIADGILEV+SE+G+VLTT
Sbjct:   437 VTIFQECQPEFLHDLVLKMKAYIFTPGDSICRKGEVAREMFIIADGILEVLSETGKVLTT 496

Query:    69 MKAGDFFGEIGILNLDGLNKRTADVRSVGYAELFSLSREDVLSAMKDYPEAQEILQNLGR 128
             MKAGDFFGEIGILNLDGLNKRTADVRSVGY+ELFSLSREDVL+AMKDYP+AQEILQ LGR
Sbjct:   497 MKAGDFFGEIGILNLDGLNKRTADVRSVGYSELFSLSREDVLAAMKDYPDAQEILQTLGR 556

Query:   129 KRLMEAKNLNKKF-KVDAEK 147
             KRLME + +NKK+ K  ++K
Sbjct:   557 KRLMEVRCVNKKYAKAQSDK 576
GO:0005221 "intracellular cyclic nucleotide activated cation channel activity" evidence=ISS
GO:0006811 "ion transport" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0055085 "transmembrane transport" evidence=IEA
UNIPROTKB|I3LSH4 LOC100739165 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NEW7 CNGA3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q90805 Q90805 "Cyclic nucleotide-gated channel cone photoreceptor subunit alpha" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q29441 CNGA3 "Cyclic nucleotide-gated cation channel alpha-3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NAI9 CNGA2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1S2D4 CNGA2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2QWD5 CNGA2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:108040 Cnga2 "cyclic nucleotide gated channel alpha 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|2367 Cnga2 "cyclic nucleotide gated channel alpha 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
cd00038115 cd00038, CAP_ED, effector domain of the CAP family 4e-22
smart00100120 smart00100, cNMP, Cyclic nucleotide-monophosphate 1e-20
pfam0002791 pfam00027, cNMP_binding, Cyclic nucleotide-binding 4e-16
COG0664214 COG0664, Crp, cAMP-binding proteins - catabolite g 3e-11
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 1e-06
COG2905 610 COG2905, COG2905, Predicted signal-transduction pr 2e-05
PRK11753211 PRK11753, PRK11753, DNA-binding transcriptional du 2e-04
>gnl|CDD|237999 cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information 
 Score = 84.7 bits (210), Expect = 4e-22
 Identities = 36/117 (30%), Positives = 60/117 (51%), Gaps = 7/117 (5%)

Query: 11  IFQECQPEFLHDLVLKMKAYIFTPGDLICRKGEVAREMFIIADGILEVI--SESGR--VL 66
           +F     E L +L   ++   F  G++I R+G+ A  ++I+  G +EV    E GR  ++
Sbjct: 1   LFSGLDDEELEELADALEERRFPAGEVIIRQGDPADSLYIVLSGSVEVYKLDEDGREQIV 60

Query: 67  TTMKAGDFFGEIGILNLDGLNKRTADVRSVGYAELFSLSREDVLSAMKDYPEAQEIL 123
             +  GD FGE+ +L       R+A VR++  +EL  L R D    +++YPE    L
Sbjct: 61  GFLGPGDLFGELALLGNG---PRSATVRALTDSELLVLPRSDFRRLLQEYPELARRL 114

In all cases binding of the effector leads to conformational changes and the ability to activate transcription. Cyclic nucleotide-binding domain similar to CAP are also present in cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) and vertebrate cyclic nucleotide-gated ion-channels. Cyclic nucleotide-monophosphate binding domain; proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues; the best studied is the prokaryotic catabolite gene activator, CAP, where such a domain is known to be composed of three alpha-helices and a distinctive eight-stranded, antiparallel beta-barrel structure; three conserved glycine residues are thought to be essential for maintenance of the structural integrity of the beta-barrel; CooA is a homodimeric transcription factor that belongs to CAP family; cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) contain two tandem copies of the cyclic nucleotide-binding domain; cAPK's are composed of two different subunits, a catalytic chain and a regulatory chain, which contains both copies of the domain; cGPK's are single chain enzymes that include the two copies of the domain in their N-terminal section; also found in vertebrate cyclic nucleotide-gated ion-channels. Length = 115
>gnl|CDD|197516 smart00100, cNMP, Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>gnl|CDD|215664 pfam00027, cNMP_binding, Cyclic nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|223736 COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|225457 COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|236969 PRK11753, PRK11753, DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 150
PRK09392236 ftrB transcriptional activator FtrB; Provisional 99.9
PRK11753211 DNA-binding transcriptional dual regulator Crp; Pr 99.87
PRK11161235 fumarate/nitrate reduction transcriptional regulat 99.85
COG2905 610 Predicted signal-transduction protein containing c 99.83
cd00038115 CAP_ED effector domain of the CAP family of transc 99.83
PRK10402226 DNA-binding transcriptional activator YeiL; Provis 99.83
KOG0500|consensus536 99.81
PF0002791 cNMP_binding: Cyclic nucleotide-binding domain; In 99.8
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.8
COG0664214 Crp cAMP-binding proteins - catabolite gene activa 99.79
smart00100120 cNMP Cyclic nucleotide-monophosphate binding domai 99.79
PRK09391230 fixK transcriptional regulator FixK; Provisional 99.76
TIGR03697193 NtcA_cyano global nitrogen regulator NtcA, cyanoba 99.74
KOG0498|consensus 727 99.73
PLN02868 413 acyl-CoA thioesterase family protein 99.72
KOG0499|consensus 815 99.72
PRK13918202 CRP/FNR family transcriptional regulator; Provisio 99.68
KOG1113|consensus 368 99.61
KOG0614|consensus 732 99.54
KOG0614|consensus 732 99.49
KOG1113|consensus368 99.35
KOG2968|consensus 1158 99.2
KOG0501|consensus 971 99.12
PF04831153 Popeye: Popeye protein conserved region; InterPro: 99.01
PRK11832207 putative DNA-binding transcriptional regulator; Pr 98.93
KOG2968|consensus 1158 98.68
KOG3542|consensus 1283 97.91
KOG3542|consensus 1283 97.23
PF0788371 Cupin_2: Cupin domain; InterPro: IPR013096 This fa 96.45
PF0589974 Cupin_3: Protein of unknown function (DUF861); Int 95.74
PRK13290125 ectC L-ectoine synthase; Reviewed 94.44
COG3718 270 IolB Uncharacterized enzyme involved in inositol m 91.65
TIGR03037159 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase 90.68
COG0662127 {ManC} Mannose-6-phosphate isomerase [Carbohydrate 90.41
smart00835146 Cupin_1 Cupin. This family represents the conserve 89.95
COG1917131 Uncharacterized conserved protein, contains double 89.74
COG3450116 Predicted enzyme of the cupin superfamily [General 88.81
TIGR03404367 bicupin_oxalic bicupin, oxalate decarboxylase fami 88.48
PRK09943185 DNA-binding transcriptional repressor PuuR; Provis 87.01
TIGR03404 367 bicupin_oxalic bicupin, oxalate decarboxylase fami 86.31
PRK04190191 glucose-6-phosphate isomerase; Provisional 85.97
PRK13264177 3-hydroxyanthranilate 3,4-dioxygenase; Provisional 85.08
PF00190144 Cupin_1: Cupin; InterPro: IPR006045 This family re 84.37
PRK11171266 hypothetical protein; Provisional 84.17
PF1297391 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_ 81.9
PRK11171266 hypothetical protein; Provisional 80.96
>PRK09392 ftrB transcriptional activator FtrB; Provisional Back     alignment and domain information 
Probab=99.90  E-value=2.7e-22  Score=139.38  Aligned_cols=130  Identities=16%  Similarity=0.211  Sum_probs=113.0

Q ss_pred             ccccccccccccCCHHHHHHHHHhceEEeecCCceEEecCCccceeEEEeeceEEEEe-cCCc--EEEEecCCCeeeeee
Q psy1122           3 VVCVGVVTIFQECQPEFLHDLVLKMKAYIFTPGDLICRKGEVAREMFIIADGILEVIS-ESGR--VLTTMKAGDFFGEIG   79 (150)
Q Consensus         3 ~~~l~~~~~f~~l~~~~~~~l~~~~~~~~~~~g~~i~~~g~~~~~~y~i~~G~v~~~~-~~g~--~~~~~~~g~~~g~~~   79 (150)
                      .++++.+++|..+++++++.+...+..+.|++|++|+.+|++++++|||++|.++++. .+|+  ++..+.+|++||+.+
T Consensus         6 ~~~l~~~~~f~~L~~~~~~~l~~~~~~~~~~~ge~l~~~g~~~~~~~~v~~G~v~~~~~~~~~~~~i~~~~~g~~~g~~~   85 (236)
T PRK09392          6 LIRLRNLPLFADMADATFERLMRGAFLQRFPPGTMLITEGEPADFLFVVLDGLVELSASSQDRETTLAILRPVSTFILAA   85 (236)
T ss_pred             HHHHhcCccccCCCHHHHHHHHhhcceeecCCCCEEEeCCCccceEEEEEeCEEEEEEcCCCceEEEEEeCCCchhhhHH
Confidence            3578999999999999999999999999999999999999999999999999999953 3333  889999999999998


Q ss_pred             eeccCCCCceeeEEEEcceeEEEEEcHHHHHHHHhhCchHHHHHHHHHHHHHHHHH
Q psy1122          80 ILNLDGLNKRTADVRSVGYAELFSLSREDVLSAMKDYPEAQEILQNLGRKRLMEAK  135 (150)
Q Consensus        80 ~~~~~~~~~~~~~~~a~~~~~~~~i~~~~~~~l~~~~~~~~~~~~~~~~~r~~~~~  135 (150)
                      ++.+   .++.+++.|.++|.++.+|.+.|.+++.++|.+...+......++....
T Consensus        86 ~~~~---~~~~~~~~A~~~~~~~~i~~~~~~~l~~~~p~l~~~~~~~l~~~~~~~~  138 (236)
T PRK09392         86 VVLD---APYLMSARTLTRSRVLMIPAELVREAMSEDPGFMRAVVFELAGCYRGLV  138 (236)
T ss_pred             HhCC---CCCceEEEEcCceEEEEEeHHHHHHHHHHCHHHHHHHHHHHHHHHHHHH
Confidence            8876   7899999999999999999999999999999965554444433444443

>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>cd00038 CAP_ED effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>KOG0500|consensus Back     alignment and domain information
>PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>COG0664 Crp cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>smart00100 cNMP Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial Back     alignment and domain information
>KOG0498|consensus Back     alignment and domain information
>PLN02868 acyl-CoA thioesterase family protein Back     alignment and domain information
>KOG0499|consensus Back     alignment and domain information
>PRK13918 CRP/FNR family transcriptional regulator; Provisional Back     alignment and domain information
>KOG1113|consensus Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>KOG1113|consensus Back     alignment and domain information
>KOG2968|consensus Back     alignment and domain information
>KOG0501|consensus Back     alignment and domain information
>PF04831 Popeye: Popeye protein conserved region; InterPro: IPR006916 The Popeye (POP) family of proteins, is restricted to vertebrates and is preferentially expressed in developing and adult striated muscle Back     alignment and domain information
>PRK11832 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>KOG2968|consensus Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) Back     alignment and domain information
>PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown Back     alignment and domain information
>PRK13290 ectC L-ectoine synthase; Reviewed Back     alignment and domain information
>COG3718 IolB Uncharacterized enzyme involved in inositol metabolism [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase Back     alignment and domain information
>COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>smart00835 Cupin_1 Cupin Back     alignment and domain information
>COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>COG3450 Predicted enzyme of the cupin superfamily [General function prediction only] Back     alignment and domain information
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information
>PRK09943 DNA-binding transcriptional repressor PuuR; Provisional Back     alignment and domain information
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information
>PRK04190 glucose-6-phosphate isomerase; Provisional Back     alignment and domain information
>PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional Back     alignment and domain information
>PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel) Back     alignment and domain information
>PRK11171 hypothetical protein; Provisional Back     alignment and domain information
>PF12973 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_F 2Q1Z_B 3EBR_A Back     alignment and domain information
>PRK11171 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
3etq_A204 X-Ray Structure Of Cysteine-Free Fragment Of Mhcn2 8e-15
3otf_A220 Structural Basis For The Camp-Dependent Gating In H 1e-14
3u11_A210 Tetramerization Dynamics Of The C-Terminus Underlie 1e-14
4hbn_A205 Crystal Structure Of The Human Hcn4 Channel C-termi 2e-14
3u0z_A210 Tetramerization Dynamics Of The C-Terminus Underlie 3e-14
1q3e_A207 Hcn2j 443-645 In The Presence Of Cgmp Length = 207 3e-14
3bpz_A202 Hcn2-I 443-460 E502k In The Presence Of Camp Length 3e-14
2q0a_A200 Structure And Rearrangements In The Carboxy-Termina 3e-14
3ffq_A202 Hcn2i 443-640 Apo-State Length = 202 3e-14
3u10_A210 Tetramerization Dynamics Of The C-Terminus Underlie 3e-14
1q43_A207 Hcn2i 443-640 In The Presence Of Camp, Selenomethio 5e-13
2ptm_A198 Structure And Rearrangements In The Carboxy-Termina 9e-12
1u12_A138 M. Loti Cyclic Nucleotide Binding Domain Mutant Len 6e-09
1vp6_A138 M.Loti Ion Channel Cylic Nucleotide Binding Domain 1e-08
3cl1_A140 M. Loti Cyclic-Nucleotide Binding Domain, Cyclic-Gm 1e-08
2k0g_A142 Solution Structure Of A Bacterial Cyclic Nucleotide 2e-08
3beh_A355 Structure Of A Bacterial Cyclic Nucleotide Regulate 2e-08
3clp_A140 M. Loti Cyclic-Nucleotide Binding Domain Mutant 2 L 9e-08
3co2_A140 Mlotik1 Ion Channel Cyclic-Nucleotide Binding Domai 9e-08
3d0s_A227 Camp Receptor Protein From M.Tuberculosis, Camp-Fre 1e-05
3mzh_A225 Crystal Structure Of Camp Receptor Protein From Myc 1e-05
3h3u_A224 Crystal Structure Of Crp (Camp Receptor Protein) Fr 1e-05
3i54_A249 Crystal Structure Of Mtbcrp In Complex With Camp Le 1e-05
3ukn_A212 Structure Of The C-LinkerCNBHD OF ZELK CHANNELS IN 3e-05
4f8a_A160 Cyclic Nucleotide Binding-Homology Domain From Mous 4e-05
3i59_A249 Crystal Structure Of Mtbcrp In Complex With N6-Camp 7e-05
3of1_A246 Crystal Structure Of Bcy1, The Yeast Regulatory Sub 1e-04
3r6s_A247 Crystal Structure Of Glxr Transcription Factor From 2e-04
4ev0_A216 Crystal Structure Of Thermus Thermophilus Catabolit 6e-04
>pdb|3ETQ|A Chain A, X-Ray Structure Of Cysteine-Free Fragment Of Mhcn2 C- Terminal Region From Amino Acids 443-630 Including C508n, C584s, And C601s Mutations Length = 204 Back     alignment and structure 
Iteration: 1

 Score = 75.9 bits (185), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 71/127 (55%), Gaps = 4/127 (3%)
Query: 5   CVGVVTIFQECQPEFLHDLVLKMKAYIFTPGDLICRKGEVAREMFIIADGILEVISESGR 64
            V  + +F    P F+  ++ K+K  +F PGD I R+G + ++M+ I  G++ V+++  +
Sbjct: 75  LVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNK 134
Query: 65  VLTTMKAGDFFGEIGILNLDGLNKRTADVRSVGYAELFSLSREDVLSAMKDYPEAQEILQ 124
            +  +  G +FGEI +L      +RTA VR+  Y+ L+SLS ++    +++YP  +   +
Sbjct: 135 EM-KLSDGSYFGEISLLT---RGRRTASVRADTYSRLYSLSVDNFNEVLEEYPMMRRAFE 190
Query: 125 NLGRKRL 131
            +   RL
Sbjct: 191 TVAIDRL 197
>pdb|3OTF|A Chain A, Structural Basis For The Camp-Dependent Gating In Human Hcn4 Channel Length = 220 Back     alignment and structure
>pdb|3U11|A Chain A, Tetramerization Dynamics Of The C-Terminus Underlies Isoform-Specific Camp-Gating In Hcn Channels Length = 210 Back     alignment and structure
>pdb|4HBN|A Chain A, Crystal Structure Of The Human Hcn4 Channel C-terminus Carrying The S672r Mutation Length = 205 Back     alignment and structure
>pdb|3U0Z|A Chain A, Tetramerization Dynamics Of The C-Terminus Underlies Isoform-Specific Camp-Gating In Hcn Channels Length = 210 Back     alignment and structure
>pdb|1Q3E|A Chain A, Hcn2j 443-645 In The Presence Of Cgmp Length = 207 Back     alignment and structure
>pdb|3BPZ|A Chain A, Hcn2-I 443-460 E502k In The Presence Of Camp Length = 202 Back     alignment and structure
>pdb|2Q0A|A Chain A, Structure And Rearrangements In The Carboxy-Terminal Region Of Spih Channels Length = 200 Back     alignment and structure
>pdb|3FFQ|A Chain A, Hcn2i 443-640 Apo-State Length = 202 Back     alignment and structure
>pdb|3U10|A Chain A, Tetramerization Dynamics Of The C-Terminus Underlies Isoform-Specific Camp-Gating In Hcn Channels Length = 210 Back     alignment and structure
>pdb|1Q43|A Chain A, Hcn2i 443-640 In The Presence Of Camp, Selenomethionine Derivative Length = 207 Back     alignment and structure
>pdb|2PTM|A Chain A, Structure And Rearrangements In The Carboxy-Terminal Region Of Spih Channels Length = 198 Back     alignment and structure
>pdb|1U12|A Chain A, M. Loti Cyclic Nucleotide Binding Domain Mutant Length = 138 Back     alignment and structure
>pdb|1VP6|A Chain A, M.Loti Ion Channel Cylic Nucleotide Binding Domain Length = 138 Back     alignment and structure
>pdb|3CL1|A Chain A, M. Loti Cyclic-Nucleotide Binding Domain, Cyclic-Gmp Bound Length = 140 Back     alignment and structure
>pdb|2K0G|A Chain A, Solution Structure Of A Bacterial Cyclic Nucleotide- Activated K+ Channel Binding Domain In Complex With Camp Length = 142 Back     alignment and structure
>pdb|3BEH|A Chain A, Structure Of A Bacterial Cyclic Nucleotide Regulated Ion Channel Length = 355 Back     alignment and structure
>pdb|3CLP|A Chain A, M. Loti Cyclic-Nucleotide Binding Domain Mutant 2 Length = 140 Back     alignment and structure
>pdb|3CO2|A Chain A, Mlotik1 Ion Channel Cyclic-Nucleotide Binding Domain Mutant Length = 140 Back     alignment and structure
>pdb|3D0S|A Chain A, Camp Receptor Protein From M.Tuberculosis, Camp-Free Form Length = 227 Back     alignment and structure
>pdb|3MZH|A Chain A, Crystal Structure Of Camp Receptor Protein From Mycobacterium Tuberculosis In Complex With Camp And Its Dna Binding Element Length = 225 Back     alignment and structure
>pdb|3H3U|A Chain A, Crystal Structure Of Crp (Camp Receptor Protein) From Mycoba Tuberculosis Length = 224 Back     alignment and structure
>pdb|3I54|A Chain A, Crystal Structure Of Mtbcrp In Complex With Camp Length = 249 Back     alignment and structure
>pdb|3UKN|A Chain A, Structure Of The C-LinkerCNBHD OF ZELK CHANNELS IN C 2 2 21 SPACE Group Length = 212 Back     alignment and structure
>pdb|4F8A|A Chain A, Cyclic Nucleotide Binding-Homology Domain From Mouse Eag1 Potassium Channel Length = 160 Back     alignment and structure
>pdb|3I59|A Chain A, Crystal Structure Of Mtbcrp In Complex With N6-Camp Length = 249 Back     alignment and structure
>pdb|3OF1|A Chain A, Crystal Structure Of Bcy1, The Yeast Regulatory Subunit Of Pka Length = 246 Back     alignment and structure
>pdb|3R6S|A Chain A, Crystal Structure Of Glxr Transcription Factor From Corynebacterium Glutamicum With Camp Length = 247 Back     alignment and structure
>pdb|4EV0|A Chain A, Crystal Structure Of Thermus Thermophilus Catabolite Activator Protein Length = 216 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 2e-48
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 8e-46
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 3e-45
3ukn_A212 Novel protein similar to vertebrate potassium VOL 3e-43
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 3e-38
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 7e-34
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 8e-23
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 1e-22
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 2e-22
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 3e-22
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 6e-22
2pqq_A149 Putative transcriptional regulator; APC7345, strep 2e-21
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 2e-21
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 6e-17
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 3e-20
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 1e-18
3shr_A 299 CGMP-dependent protein kinase 1; cyclic nucleotide 1e-16
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 2e-18
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 8e-18
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 2e-17
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 3e-17
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 4e-17
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 4e-17
2qcs_B 291 CAMP-dependent protein kinase type I-alpha regula 7e-13
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 8e-17
4din_B381 CAMP-dependent protein kinase type I-beta regulat 1e-16
4din_B 381 CAMP-dependent protein kinase type I-beta regulat 6e-13
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 2e-16
3tnp_B 416 CAMP-dependent protein kinase type II-beta regula 3e-15
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 3e-16
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 5e-16
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 6e-16
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 8e-16
1o7f_A 469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 9e-14
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 8e-16
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 1e-15
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 1e-15
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 2e-15
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 5e-14
3e6c_C250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 1e-13
4ava_A 333 Lysine acetyltransferase; allosteric regulation, d 7e-13
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 7e-13
2bgc_A238 PRFA; bacterial infection, human pathogen, transcr 8e-12
2fmy_A220 COOA, carbon monoxide oxidation system transcripti 8e-12
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 3e-10
1ft9_A222 Carbon monoxide oxidation system transcription reg 3e-10
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 2e-09
3b02_A195 Transcriptional regulator, CRP family; structural 3e-09
2byv_E 999 RAP guanine nucleotide exchange factor 4; EPAC2, C 5e-05
3dn7_A194 Cyclic nucleotide binding regulatory protein; stru 3e-04
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Length = 198 Back     alignment and structure
 Score =  153 bits (389), Expect = 2e-48
 Identities = 34/124 (27%), Positives = 62/124 (50%), Gaps = 3/124 (2%)

Query: 9   VTIFQECQPEFLHDLVLKMKAYIFTPGDLICRKGEVAREMFIIADGILEVISESGRVLTT 68
           V  F      F+  +V  ++  +F P D + ++G     MF I  GI+++I   G + T+
Sbjct: 76  VPFFVGADSNFVTRVVTLLEFEVFQPADYVIQEGTFGDRMFFIQQGIVDIIMSDGVIATS 135

Query: 69  MKAGDFFGEIGILNLDGLNKRTADVRSVGYAELFSLSREDVLSAMKDYPEAQEILQNLGR 128
           +  G +FGEI +L      +R A V+   Y  LFSLS +     + ++P  ++ ++ +  
Sbjct: 136 LSDGSYFGEICLLT---RERRVASVKCETYCTLFSLSVQHFNQVLDEFPAMRKTMEEIAV 192

Query: 129 KRLM 132
           +RL 
Sbjct: 193 RRLT 196
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Length = 202 Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Length = 160 Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Length = 212 Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Length = 137 Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Length = 138 Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Length = 187 Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Length = 161 Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Length = 139 Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Length = 154 Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Length = 142 Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Length = 149 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Length = 154 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Length = 260 Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Length = 210 Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Length = 216 Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Length = 227 Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Length = 355 Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Length = 231 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Length = 227 Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Length = 213 Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Length = 232 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Length = 207 Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Length = 237 Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Length = 243 Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Length = 232 Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Length = 250 Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Length = 333 Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Length = 230 Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Length = 238 Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Length = 220 Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Length = 220 Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Length = 222 Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Length = 202 Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Length = 195 Back     alignment and structure
>2byv_E RAP guanine nucleotide exchange factor 4; EPAC2, CAMP-GEF2, CAMP, cyclic nucleotide, regulation, auto-inhibition, CDC25 homology domain; 2.7A {Mus musculus} Length = 999 Back     alignment and structure
>3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Length = 194 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query150
3dn7_A194 Cyclic nucleotide binding regulatory protein; stru 99.94
2pqq_A149 Putative transcriptional regulator; APC7345, strep 99.94
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 99.93
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 99.93
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 99.92
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 99.92
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 99.92
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 99.92
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 99.92
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 99.92
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 99.92
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 99.91
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 99.91
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 99.91
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 99.91
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 99.91
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 99.91
3ukn_A212 Novel protein similar to vertebrate potassium VOL 99.91
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 99.9
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 99.9
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 99.9
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 99.9
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 99.89
4ava_A 333 Lysine acetyltransferase; allosteric regulation, d 99.89
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 99.89
2fmy_A220 COOA, carbon monoxide oxidation system transcripti 99.89
3e6c_C250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 99.89
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 99.88
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 99.88
1ft9_A222 Carbon monoxide oxidation system transcription reg 99.88
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 99.88
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 99.87
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 99.87
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 99.86
2qcs_B 291 CAMP-dependent protein kinase type I-alpha regula 99.86
3shr_A 299 CGMP-dependent protein kinase 1; cyclic nucleotide 99.85
2bgc_A238 PRFA; bacterial infection, human pathogen, transcr 99.84
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 99.84
4din_B 381 CAMP-dependent protein kinase type I-beta regulat 99.84
3tnp_B 416 CAMP-dependent protein kinase type II-beta regula 99.83
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 99.83
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 99.83
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 99.82
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 99.81
1o7f_A 469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 99.8
4din_B381 CAMP-dependent protein kinase type I-beta regulat 99.79
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 99.79
3cf6_E 694 RAP guanine nucleotide exchange factor (GEF) 4; EP 99.76
3b02_A195 Transcriptional regulator, CRP family; structural 99.74
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 99.73
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 99.68
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 99.68
3rns_A227 Cupin 2 conserved barrel domain protein; structura 95.88
2ozj_A114 Cupin 2, conserved barrel; cupin superfamily prote 95.05
3fjs_A114 Uncharacterized protein with RMLC-like cupin fold; 94.4
2fqp_A97 Hypothetical protein BP2299; double-stranded beta- 94.38
3jzv_A166 Uncharacterized protein RRU_A2000; structural geno 93.65
1dgw_A178 Canavalin; duplicated swiss-roll beta barrels, loo 93.55
3ibm_A167 Cupin 2, conserved barrel domain protein; cupin 2 93.39
3es1_A172 Cupin 2, conserved barrel domain protein; YP_00116 93.13
3kgz_A156 Cupin 2 conserved barrel domain protein; metallopr 92.97
3es4_A116 Uncharacterized protein DUF861 with A RMLC-like C; 92.87
1yhf_A115 Hypothetical protein SPY1581; structural genomics, 92.74
3rns_A227 Cupin 2 conserved barrel domain protein; structura 92.68
3bcw_A123 Uncharacterized protein; structural genomics, join 92.47
3h8u_A125 Uncharacterized conserved protein with double-STR 92.19
2pfw_A116 Cupin 2, conserved barrel domain protein; cupin do 91.97
3lag_A98 Uncharacterized protein RPA4178; functionally unkn 91.65
3lwc_A119 Uncharacterized protein; structural genomics, unkn 91.63
2i45_A107 Hypothetical protein; neisseria meningitidis cupin 91.59
2phl_A 397 Phaseolin; plant SEED storage protein(vicilin); HE 91.57
2bnm_A198 Epoxidase; oxidoreductase, cupin, HTH, cation-depe 91.55
2pyt_A133 Ethanolamine utilization protein EUTQ; structural 91.39
4e2g_A126 Cupin 2 conserved barrel domain protein; MCSG, PSI 90.16
2o1q_A145 Putative acetyl/propionyl-COA carboxylase, alpha; 90.03
1v70_A105 Probable antibiotics synthesis protein; structural 89.64
1j58_A385 YVRK protein; cupin, decarboxyklase, oxalate, mang 89.62
2cav_A 445 Protein (canavalin); vicilin, 7S SEED protein, dom 89.59
2gu9_A113 Tetracenomycin polyketide synthesis protein; X-RAY 89.49
1vj2_A126 Novel manganese-containing cupin TM1459; structura 88.75
2ea7_A 434 7S globulin-1; beta barrel, cupin superfamily, pla 88.7
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 88.64
1sfn_A246 Conserved hypothetical protein; structural genomic 88.53
1uij_A 416 Beta subunit of beta conglycinin; double-stranded 88.46
2qjv_A 270 Uncharacterized IOLB-like protein; structural geno 88.4
1lr5_A163 Auxin binding protein 1; beta jellyroll, double st 88.38
3s7i_A 418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 88.06
1o4t_A133 Putative oxalate decarboxylase; double-stranded be 88.01
2vqa_A 361 SLL1358 protein, MNCA; periplasmic binding protein 87.99
3fz3_A531 Prunin; TREE NUT allergen, allergy, amandin, almon 87.98
1o5u_A101 Novel thermotoga maritima enzyme TM1112; cupin, st 87.83
2vqa_A361 SLL1358 protein, MNCA; periplasmic binding protein 87.79
1j58_A 385 YVRK protein; cupin, decarboxyklase, oxalate, mang 87.6
2b8m_A117 Hypothetical protein MJ0764; structural genomics, 87.51
2vpv_A166 Protein MIF2, MIF2P; nucleus, mitosis, centromere, 87.29
3c3v_A510 Arachin ARAH3 isoform; peanut allergen, allergy, g 87.19
2f4p_A147 Hypothetical protein TM1010; double-stranded beta- 87.02
1fxz_A476 Glycinin G1; proglycinin, legumin, SEED storage pr 86.62
2d5f_A493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 86.17
2opk_A112 Hypothetical protein; putative mannose-6-phosphate 85.82
2e9q_A459 11S globulin subunit beta; cucubitin, pumpkin SEED 85.73
1zvf_A176 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b 85.25
3bu7_A394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 85.12
3d0j_A140 Uncharacterized protein CA_C3497; beta-barrel, str 84.89
4b29_A217 Dimethylsulfoniopropionate lyase; hydrolase, dimet 84.72
3d82_A102 Cupin 2, conserved barrel domain protein; structur 84.64
1yfu_A174 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid 84.53
4e2q_A266 Ureidoglycine aminohydrolase; BI-cupin, manganese 84.27
3l2h_A162 Putative sugar phosphate isomerase; AFE_0303, stru 84.02
2q30_A110 Uncharacterized protein; double-stranded beta-heli 83.74
3bu7_A 394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 83.64
3i7d_A163 Sugar phosphate isomerase; YP_168127.1, structural 83.51
3ebr_A159 Uncharacterized RMLC-like cupin; structural genomi 83.08
2oa2_A148 BH2720 protein; 10175341, structural genomics, joi 83.08
2ozi_A98 Hypothetical protein RPA4178; APC6210, putative pr 83.06
2e9q_A 459 11S globulin subunit beta; cucubitin, pumpkin SEED 82.81
3myx_A238 Uncharacterized protein pspto_0244; protein of unk 82.73
3cew_A125 Uncharacterized cupin protein; all beta-protein, j 82.66
2qnk_A 286 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol 82.62
1fxz_A 476 Glycinin G1; proglycinin, legumin, SEED storage pr 82.5
3ht1_A145 REMF protein; cupin fold, Zn-binding, antibiotic b 82.36
2q1z_B195 Anti-sigma factor CHRR, transcriptional activator; 81.96
3ksc_A496 LEGA class, prolegumin; PEA prolegumin, 11S SEED s 80.95
3kgl_A466 Cruciferin; 11S SEED globulin, rapeseed, SEED stor 80.3
>3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Back     alignment and structure
Probab=99.94  E-value=1.2e-25  Score=150.40  Aligned_cols=133  Identities=14%  Similarity=0.176  Sum_probs=117.0

Q ss_pred             CCccccccccccccCCHHHHHHHHHhceEEeecCCceEEecCCccceeEEEeeceEEEE--ecCCc--EEEEecCCCeee
Q psy1122           1 MGVVCVGVVTIFQECQPEFLHDLVLKMKAYIFTPGDLICRKGEVAREMFIIADGILEVI--SESGR--VLTTMKAGDFFG   76 (150)
Q Consensus         1 M~~~~l~~~~~f~~l~~~~~~~l~~~~~~~~~~~g~~i~~~g~~~~~~y~i~~G~v~~~--~~~g~--~~~~~~~g~~~g   76 (150)
                      |...++++++.|.++++++++.+...++.+.|++|++|+.+|++++++|||++|.++++  +++|+  ++.++.||++||
T Consensus         4 m~~~l~~~~~~f~~l~~~~~~~l~~~~~~~~~~~g~~l~~~G~~~~~~y~i~~G~v~~~~~~~~G~e~~~~~~~~g~~~g   83 (194)
T 3dn7_A            4 MHTALINHIRKFIFLTDEDAGTLSAFFQLKKVRKKETLLKTGEICRINYFVVKGCLRLFFIDEKGIEQTTQFAIENWWLS   83 (194)
T ss_dssp             CCHHHHHHHHTTSCCCHHHHHHHHTTCEEEEECTTCEEECTTSBCCEEEEEEESEEEEEEECTTSCEEEEEEEETTCEEC
T ss_pred             HHHHHHHHHHHhCCCCHHHHHHHHHhCEEEEEcCCCEEECCCCeeeEEEEeecCeEEEEEECCCCCEEEEEEccCCcEEe
Confidence            34567899999999999999999999999999999999999999999999999999995  46777  889999999999


Q ss_pred             ee-eeeccCCCCceeeEEEEcceeEEEEEcHHHHHHHHhhCchHHHHHHHHHHHHHHHHHh
Q psy1122          77 EI-GILNLDGLNKRTADVRSVGYAELFSLSREDVLSAMKDYPEAQEILQNLGRKRLMEAKN  136 (150)
Q Consensus        77 ~~-~~~~~~~~~~~~~~~~a~~~~~~~~i~~~~~~~l~~~~~~~~~~~~~~~~~r~~~~~~  136 (150)
                      +. .++.+   .++.++++|.++|+++.+|.+.|.+++.++|.+...+.....+++.....
T Consensus        84 e~~~~~~~---~~~~~~~~a~~~~~v~~i~~~~~~~l~~~~p~~~~~~~~~~~~~l~~~~~  141 (194)
T 3dn7_A           84 DYMAFQKQ---QPADFYIQSVENCELLSITYTEQENLFERIPALERYFRLVYQKSFAAAQL  141 (194)
T ss_dssp             CHHHHHHT---CBCSSEEEESSCEEEEEEEHHHHHHHHHHCTTHHHHHHHHHHHHHHHHHH
T ss_pred             ehHHHhcC---CCCceEEEEECCEEEEEEeHHHHHHHHHhCHHHHHHHHHHHHHHHHHHHH
Confidence            87 45555   78999999999999999999999999999999777766666656554443
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} Back     alignment and structure
>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Back     alignment and structure
>2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} Back     alignment and structure
>3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Back     alignment and structure
>3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} Back     alignment and structure
>3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} Back     alignment and structure
>3es4_A Uncharacterized protein DUF861 with A RMLC-like C; 17741406, protein of unknown function (DUF861) with A RMLC-L fold; HET: MSE; 1.64A {Agrobacterium tumefaciens str} Back     alignment and structure
>1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} Back     alignment and structure
>3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} Back     alignment and structure
>3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris} Back     alignment and structure
>3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} Back     alignment and structure
>2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Back     alignment and structure
>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A Back     alignment and structure
>2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 Back     alignment and structure
>4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} Back     alignment and structure
>2o1q_A Putative acetyl/propionyl-COA carboxylase, alpha; putative acetylacetone dioxygenase, structural genomics; HET: MSE PG4; 1.50A {Methylibium petroleiphilum} SCOP: b.82.1.21 Back     alignment and structure
>1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Back     alignment and structure
>2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Back     alignment and structure
>1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Back     alignment and structure
>2qjv_A Uncharacterized IOLB-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MLY MSE; 1.90A {Salmonella typhimurium LT2} Back     alignment and structure
>1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Back     alignment and structure
>1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Back     alignment and structure
>1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure
>2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18 Back     alignment and structure
>2vpv_A Protein MIF2, MIF2P; nucleus, mitosis, centromere, cell cycle, DNA-binding, kinetochore, cell division, phosphoprotein, jelly-roll fold; 2.7A {Saccharomyces cerevisiae} Back     alignment and structure
>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Back     alignment and structure
>2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Back     alignment and structure
>2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha} Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Back     alignment and structure
>1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20 Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Back     alignment and structure
>3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} Back     alignment and structure
>3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} Back     alignment and structure
>1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A* Back     alignment and structure
>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A Back     alignment and structure
>3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} Back     alignment and structure
>2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Back     alignment and structure
>3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3ebr_A Uncharacterized RMLC-like cupin; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.60A {Ralstonia eutropha JMP134} Back     alignment and structure
>2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans} Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Back     alignment and structure
>3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} Back     alignment and structure
>3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} Back     alignment and structure
>2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Back     alignment and structure
>3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A Back     alignment and structure
>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Back     alignment and structure
>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 150
d1wgpa_137 b.82.3.2 (A:) Probable cyclic nucleotide-gated ion 9e-14
d1ne6a1136 b.82.3.2 (A:109-244) Regulatory subunit of Protein 2e-13
d1cx4a2147 b.82.3.2 (A:266-412) Regulatory subunit of Protein 2e-13
d1cx4a1136 b.82.3.2 (A:130-265) Regulatory subunit of Protein 4e-13
d1vp6a_133 b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizo 2e-12
d1ne6a2132 b.82.3.2 (A:245-376) Regulatory subunit of Protein 6e-11
d1o7fa3124 b.82.3.2 (A:322-445) Regulatory domain of Epac2, d 1e-10
d1o7fa2155 b.82.3.2 (A:13-167) Regulatory domain of Epac2, do 2e-10
d2gaua2142 b.82.3.2 (A:10-151) Transcriptional regulator PG03 2e-10
d2oz6a2134 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protei 3e-10
d1i5za2132 b.82.3.2 (A:6-137) Catabolite gene activator prote 6e-10
d1q3ea_193 b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus mu 2e-09
d1o5la1129 b.82.3.2 (A:1-129) CRP-like transcriptional regula 1e-06
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 137 Back     information, alignment and structure

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: cAMP-binding domain-like
family: cAMP-binding domain
domain: Probable cyclic nucleotide-gated ion channel 6
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 61.9 bits (149), Expect = 9e-14
 Identities = 26/121 (21%), Positives = 49/121 (40%), Gaps = 11/121 (9%)

Query: 9   VTIFQECQPEFLHDLVLKMKAYIFTPGDLICRKGEVAREMFIIADGILEVISESG----- 63
           V +F+      L  +  ++K  +FT    + R+G+   EM  I  G LE ++  G     
Sbjct: 11  VPLFENMDERLLDAICERLKPCLFTEKSYLVREGDPVNEMLFIIRGRLESVTTDGGRSGF 70

Query: 64  RVLTTMKAGDFFGEIGILN------LDGLNKRTADVRSVGYAELFSLSREDVLSAMKDYP 117
              + +K GDF G+  +           L   T  V+++   E F+L  +++      + 
Sbjct: 71  YNRSLLKEGDFCGDELLTWALDPKSGSNLPSSTRTVKALTEVEAFALIADELKFVASQFR 130

Query: 118 E 118
            
Sbjct: 131 R 131
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 136 Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 147 Back     information, alignment and structure
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Length = 133 Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 132 Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 124 Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 155 Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Length = 142 Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Length = 134 Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Length = 193 Back     information, alignment and structure
>d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 129 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query150
d1zyba2147 Probable transcription regulator BT4300, N-termina 99.94
d1vp6a_133 Putative ion channel CnbD {Mesorhizobium loti [Tax 99.94
d1cx4a2147 Regulatory subunit of Protein kinase A {Rat (Rattu 99.93
d2gaua2142 Transcriptional regulator PG0396, N-terminal domai 99.93
d1ne6a2132 Regulatory subunit of Protein kinase A {Cow (Bos t 99.92
d1cx4a1136 Regulatory subunit of Protein kinase A {Rat (Rattu 99.92
d1i5za2132 Catabolite gene activator protein, N-terminal doma 99.92
d1ne6a1136 Regulatory subunit of Protein kinase A {Cow (Bos t 99.91
d1q3ea_193 HCN pacemaker channel {Mouse (Mus musculus) [TaxId 99.91
d2oz6a2134 Cyclic AMP receptor-like protein Vfr {Pseudomonas 99.91
d3e5ua2139 Chlorophenol reduction protein CprK {Desulfitobact 99.91
d1o7fa3124 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.9
d1ft9a2132 CO-sensing protein CooA, N-terminal domain {Rhodos 99.9
d1wgpa_137 Probable cyclic nucleotide-gated ion channel 6 {Th 99.89
d1o5la1129 CRP-like transcriptional regulator TM1171, N-termi 99.89
d1o7fa2155 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.89
d2zcwa2112 Transcriptional regulator TTHA1359, N-terminal dom 99.81
d2bgca2131 Listeriolysin regulatory protein PrfA, N-terminal 97.76
d1yhfa1112 Hypothetical protein SPy1581 {Streptococcus pyogen 96.74
d1o5ua_88 Hypothetical protein TM1112 {Thermotoga maritima [ 96.62
d2b8ma1108 Hypothetical protein MJ0764 {Archaeon Methanococcu 94.99
d1uija1170 Seed storage 7S protein {Soybean (Glycine max), be 94.15
d1vj2a_114 Hypothetical protein TM1459 {Thermotoga maritima [ 94.12
d1dgwa_178 Seed storage 7S protein {Jack bean (Canavalia ensi 93.98
d1v70a_105 Hypothetical protein TTHA0104 {Thermus thermophilu 93.49
d1uika1203 Seed storage 7S protein {Soybean (Glycine max), be 93.29
d1j58a_ 372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 92.13
d1o4ta_115 Hypothetical protein TM1287 {Thermotoga maritima [ 92.1
d1fxza2174 Seed storage 7S protein {Soybean (Glycine max), pr 91.97
d1od5a2173 Seed storage 7S protein {Soybean (Glycine max), gl 91.56
d2bnma2122 Hydroxypropylphosphonic acid epoxidase Fom4, C-ter 91.15
g1dgw.1168 Seed storage 7S protein {Jack bean (Canavalia ensi 90.73
d2f4pa1134 Hypothetical protein TM1010 {Thermotoga maritima [ 90.41
d1lr5a_160 Auxin binding protein {Maize (Zea mays) [TaxId: 45 89.9
d1x82a_190 Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc 86.51
d1y9qa299 Probable transcriptional regulator VC1968, C-termi 86.04
d2phla1200 Seed storage 7S protein {French bean (Phaseolus vu 85.83
d1sefa_250 Hypothetical protein EF2996 {Enterococcus faecalis 85.24
d1j58a_372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 85.15
d1rc6a_253 Hypothetical protein YlbA {Escherichia coli [TaxId 83.13
d1sq4a_273 Glyoxylate-induced protein PA1140 {Pseudomonas aer 82.82
d1sfna_245 Hypothetical protein DR1152 {Deinococcus radiodura 82.35
d2d40a1308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 82.32
d2et1a1201 Germin {Barley (Hordeum vulgare) [TaxId: 4513]} 81.7
d2pyta1128 Ethanolamine utilization protein EutQ {Salmonella 80.39
d2phla2162 Seed storage 7S protein {French bean (Phaseolus vu 80.32
>d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: cAMP-binding domain-like
family: cAMP-binding domain
domain: Probable transcription regulator BT4300, N-terminal domain
species: Bacteroides thetaiotaomicron [TaxId: 818]

Probab=99.94  E-value=3.6e-26  Score=145.70  Aligned_cols=132  Identities=13%  Similarity=0.176  Sum_probs=113.1

Q ss_pred             ccccccccccccCCHHHHHHHHHhc--eEEeecCCceEEecCCccceeEEEeeceEEEE--ecCCc--EEEEecCCCeee
Q psy1122           3 VVCVGVVTIFQECQPEFLHDLVLKM--KAYIFTPGDLICRKGEVAREMFIIADGILEVI--SESGR--VLTTMKAGDFFG   76 (150)
Q Consensus         3 ~~~l~~~~~f~~l~~~~~~~l~~~~--~~~~~~~g~~i~~~g~~~~~~y~i~~G~v~~~--~~~g~--~~~~~~~g~~~g   76 (150)
                      .+.|.++|+|++++++++..|+..+  ..+.|++|++|+.+|++++++|||++|.++++  +++|+  ++..+.+|++||
T Consensus         5 ~d~L~~~~lF~~l~~~~~~~ll~~~~~~~~~~~~g~~i~~~g~~~~~iy~i~~G~v~v~~~~~~g~~~~~~~~~~g~~fG   84 (147)
T d1zyba2           5 FDTLLQLPLFQGLCHEDFTSILDKVKLHFIKHKAGETIIKSGNPCTQLCFLLKGEISIVTNAKENIYTVIEQIEAPYLIE   84 (147)
T ss_dssp             HTTGGGSGGGTTCCHHHHHHHHHTSCCEEEEECTTCEEECTTSBCCEEEEEEESEEEEEEECGGGSCEEEEEEESSEEEC
T ss_pred             HHHHhCCcccccCCHHHHHHHHhhCceEEEEECCCCEEEeccCCccEEEEEecceEEEEEEcCCCCEEEEEEcCCCCEec
Confidence            4678999999999999999999875  56899999999999999999999999999985  45666  899999999999


Q ss_pred             eeeeeccCCCCceeeEEEEcceeEEEEEcHHHHHHHHhhCchHHHHHHHHHHHHHHHHHh
Q psy1122          77 EIGILNLDGLNKRTADVRSVGYAELFSLSREDVLSAMKDYPEAQEILQNLGRKRLMEAKN  136 (150)
Q Consensus        77 ~~~~~~~~~~~~~~~~~~a~~~~~~~~i~~~~~~~l~~~~~~~~~~~~~~~~~r~~~~~~  136 (150)
                      +.+++..+  .++++++.|.++|.++.+|.+.|.+++.++|.+...+-.+..+|++....
T Consensus        85 e~~~~~~~--~~~~~~v~a~~~~~vl~i~~~~~~~~~~~~p~~~~~~~~~ls~r~~~l~~  142 (147)
T d1zyba2          85 PQSLFGMN--TNYASSYVAHTEVHTVCISKAFVLSDLFRYDIFRLNYMNIVSNRAQNLYS  142 (147)
T ss_dssp             GGGGSSSC--CBCSSEEEESSCEEEEEEEHHHHHHTGGGSHHHHHHHHHHHHHHHHHHHH
T ss_pred             cchhhccc--ccccceeeecceeeeeehhHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHH
Confidence            99988763  56689999999999999999999999999999544444444447666554
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bgca2 b.82.3.3 (A:7-137) Listeriolysin regulatory protein PrfA, N-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]} Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Back     information, alignment and structure
>d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Back     information, alignment and structure
>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure
>d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} Back     information, alignment and structure
>d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure