Psyllid ID: psy11242

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------7
MTGPRNCIGGKYALLQMKVFTVSIVREFEILPVEAYKTMAQVEEAIRLNFTLDLDEPCHIRLRERRRKD
ccccccHHHHHHHHHHHHHHHHHHHHHcEEEEccccccHHHHHHHHHHcEEEEccccEEEEEEEccccc
ccccccHHHHHHHHHHHHHHHHHHHHHcEEEcccccccHHHHHHHHEEEEEEEcccccEEEEEEccccc
mtgprnciggkYALLQMKVFTVSIVREFEILPVEAYKTMAQVEEAIRLNftldldepchirlrerrrkd
mtgprnciggkyalLQMKVFTVSIVREFEILPVEAYKTMAQVEEAIRlnftldldepchirlrerrrkd
MTGPRNCIGGKYALLQMKVFTVSIVREFEILPVEAYKTMAQVEEAIRLNFTLDLDEPCHIRLRERRRKD
*****NCIGGKYALLQMKVFTVSIVREFEILPVEAYKTMAQVEEAIRLNFTLDLDEPCHIR********
MTGPRNCIGGKYALLQMKVFTVSIVREFEILPVEAYKTMAQVEEAIRLNFTLDLDEPCHIR*RER****
MTGPRNCIGGKYALLQMKVFTVSIVREFEILPVEAYKTMAQVEEAIRLNFTLDLDEPCHIRLRERRRKD
***PRNCIGGKYALLQMKVFTVSIVREFEILPVEAYKTMAQVEEAIRLNFTLDLDEPCHIRLRER****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTGPRNCIGGKYALLQMKVFTVSIVREFEILPVEAYKTMAQVEEAIRLNFTLDLDEPCHIRLRERRRKD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query69 2.2.26 [Sep-21-2011]
Q9VL92526 Cytochrome P450 4e3 OS=Dr yes N/A 0.927 0.121 0.390 1e-06
Q9VS79463 Cytochrome P450 4d8 OS=Dr no N/A 0.869 0.129 0.402 3e-05
Q9V4T5531 Probable cytochrome P450 no N/A 0.434 0.056 0.6 5e-05
Q9W011510 Probable cytochrome P450 no N/A 0.811 0.109 0.4 5e-05
O46054496 Cytochrome P450 4ae1 OS=D no N/A 0.608 0.084 0.425 5e-05
Q27606526 Cytochrome P450 4e2 OS=Dr no N/A 0.434 0.057 0.6 6e-05
O44221522 Cytochrome P450 4e5, mito N/A N/A 0.434 0.057 0.6 0.0001
O46051507 Probable cytochrome P450 no N/A 0.463 0.063 0.562 0.0002
Q9VLZ7511 Probable cytochrome P450 no N/A 0.492 0.066 0.5 0.0002
Q9VMS8511 Probable cytochrome P450 no N/A 0.463 0.062 0.531 0.0002
>sp|Q9VL92|CP4E3_DROME Cytochrome P450 4e3 OS=Drosophila melanogaster GN=Cyp4e3 PE=2 SV=1 Back     alignment and function desciption
 Score = 52.0 bits (123), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 34/87 (39%), Positives = 43/87 (49%), Gaps = 23/87 (26%)

Query: 3   GPRNCIGGKYALLQMKVFTVSIVREFEILP-----------VEAYKTMAQVE----EAIR 47
           GPRNCIG K+ALL++K     +VR FE+LP           +  Y  +A  E    EA R
Sbjct: 439 GPRNCIGQKFALLELKTVISKVVRSFEVLPAVDELVSTDGRLNTYLGLAPDEKLKREAGR 498

Query: 48  LNF--------TLDLDEPCHIRLRERR 66
             +        TL  D   H+RLRERR
Sbjct: 499 HKYDPILSAVLTLKSDNGLHLRLRERR 525
May be involved in the metabolism of insect hormones and in the breakdown of synthetic insecticides.
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|Q9VS79|CP4D8_DROME Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2 Back     alignment and function description
>sp|Q9V4T5|CP4E1_DROME Probable cytochrome P450 4e1 OS=Drosophila melanogaster GN=Cyp4e1 PE=2 SV=1 Back     alignment and function description
>sp|Q9W011|C4D20_DROME Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 Back     alignment and function description
>sp|O46054|C4AE1_DROME Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1 Back     alignment and function description
>sp|Q27606|CP4E2_DROME Cytochrome P450 4e2 OS=Drosophila melanogaster GN=Cyp4e2 PE=2 SV=2 Back     alignment and function description
>sp|O44221|CP4E5_DROMT Cytochrome P450 4e5, mitochondrial OS=Drosophila mettleri GN=Cyp4e5 PE=2 SV=1 Back     alignment and function description
>sp|O46051|C4D14_DROME Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1 Back     alignment and function description
>sp|Q9VLZ7|C4D21_DROME Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 Back     alignment and function description
>sp|Q9VMS8|C4AC2_DROME Probable cytochrome P450 4ac2 OS=Drosophila melanogaster GN=Cyp4ac2 PE=2 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query69
328712467 452 PREDICTED: cytochrome P450 4C1-like [Acy 0.884 0.134 0.447 8e-06
195339523 526 GM12308 [Drosophila sechellia] gi|194130 0.927 0.121 0.390 4e-05
195577899 526 GD22340 [Drosophila simulans] gi|1941908 0.927 0.121 0.390 4e-05
17647303 526 cytochrome P450-4e3 [Drosophila melanoga 0.927 0.121 0.390 4e-05
195147032 526 GL19213 [Drosophila persimilis] gi|19410 0.927 0.121 0.367 4e-05
198473596 526 GA17961 [Drosophila pseudoobscura pseudo 0.927 0.121 0.367 5e-05
66772683 363 IP02804p [Drosophila melanogaster] 0.942 0.179 0.386 7e-05
195473361 539 GE10369 [Drosophila yakuba] gi|194175065 0.927 0.118 0.379 8e-05
195024818 526 GH21090 [Drosophila grimshawi] gi|193901 0.927 0.121 0.333 9e-05
31217654280 cytochrome P450 family 3 subfamily A pol 0.652 0.562 0.444 0.0001
>gi|328712467|ref|XP_001948906.2| PREDICTED: cytochrome P450 4C1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score = 54.7 bits (130), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 30/67 (44%), Positives = 40/67 (59%), Gaps = 6/67 (8%)

Query: 2   TGPRNCIGGKYALLQMKVFTVSIVREFEILPVEAYKTMAQVEEAIRLNF--TLDLDEPCH 59
           TGPRNCIG KYA+LQMK    ++VR    LP +   T  Q    +RL F  TL L + C+
Sbjct: 388 TGPRNCIGIKYAMLQMKTVASTLVRHHRFLPSDRCPTPDQ----LRLVFLTTLKLADGCY 443

Query: 60  IRLRERR 66
           +++  RR
Sbjct: 444 VKVEPRR 450

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|195339523|ref|XP_002036369.1| GM12308 [Drosophila sechellia] gi|194130249|gb|EDW52292.1| GM12308 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|195577899|ref|XP_002078806.1| GD22340 [Drosophila simulans] gi|194190815|gb|EDX04391.1| GD22340 [Drosophila simulans] Back     alignment and taxonomy information
>gi|17647303|ref|NP_523527.1| cytochrome P450-4e3 [Drosophila melanogaster] gi|12643924|sp|Q9VL92.1|CP4E3_DROME RecName: Full=Cytochrome P450 4e3; AltName: Full=CYPIVE3 gi|7297550|gb|AAF52804.1| cytochrome P450-4e3 [Drosophila melanogaster] gi|157816420|gb|ABV82204.1| IP02904p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195147032|ref|XP_002014484.1| GL19213 [Drosophila persimilis] gi|194106437|gb|EDW28480.1| GL19213 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|198473596|ref|XP_001356361.2| GA17961 [Drosophila pseudoobscura pseudoobscura] gi|198138025|gb|EAL33424.2| GA17961 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|66772683|gb|AAY55653.1| IP02804p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195473361|ref|XP_002088964.1| GE10369 [Drosophila yakuba] gi|194175065|gb|EDW88676.1| GE10369 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195024818|ref|XP_001985942.1| GH21090 [Drosophila grimshawi] gi|193901942|gb|EDW00809.1| GH21090 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|312176542|gb|ADQ39097.1| cytochrome P450 family 3 subfamily A polypeptide 29 [Brachionus ibericus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query69
FB|FBgn0015035526 Cyp4e3 "Cytochrome P450-4e3" [ 0.434 0.057 0.6 1.6e-07
FB|FBgn0014469526 Cyp4e2 "Cytochrome P450-4e2" [ 0.434 0.057 0.6 7e-06
FB|FBgn0015034531 Cyp4e1 "Cytochrome P450-4e1" [ 0.434 0.056 0.6 7.2e-06
FB|FBgn0015033463 Cyp4d8 "Cytochrome P450-4d8" [ 0.826 0.123 0.421 1.2e-05
FB|FBgn0015036496 Cyp4ae1 "Cytochrome P450-4ae1" 0.478 0.066 0.515 5.8e-05
FB|FBgn0035344510 Cyp4d20 "Cyp4d20" [Drosophila 0.811 0.109 0.4 0.0001
FB|FBgn0033304493 Cyp6a13 "Cyp6a13" [Drosophila 0.898 0.125 0.369 0.0002
FB|FBgn0031694511 Cyp4ac2 "Cyp4ac2" [Drosophila 0.449 0.060 0.548 0.00021
FB|FBgn0023541507 Cyp4d14 "Cyp4d14" [Drosophila 0.449 0.061 0.580 0.00027
FB|FBgn0031925511 Cyp4d21 "Cyp4d21" [Drosophila 0.492 0.066 0.5 0.00027
FB|FBgn0015035 Cyp4e3 "Cytochrome P450-4e3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 103 (41.3 bits), Expect = 1.6e-07, Sum P(2) = 1.6e-07
 Identities = 18/30 (60%), Positives = 23/30 (76%)

Query:     3 GPRNCIGGKYALLQMKVFTVSIVREFEILP 32
             GPRNCIG K+ALL++K     +VR FE+LP
Sbjct:   439 GPRNCIGQKFALLELKTVISKVVRSFEVLP 468
GO:0043231 "intracellular membrane-bounded organelle" evidence=NAS
GO:0009055 "electron carrier activity" evidence=IEA;ISS;NAS
GO:0016020 "membrane" evidence=NAS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0005506 "iron ion binding" evidence=IEA
GO:0020037 "heme binding" evidence=IEA
GO:0005811 "lipid particle" evidence=IDA
FB|FBgn0014469 Cyp4e2 "Cytochrome P450-4e2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0015034 Cyp4e1 "Cytochrome P450-4e1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0015033 Cyp4d8 "Cytochrome P450-4d8" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0015036 Cyp4ae1 "Cytochrome P450-4ae1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0035344 Cyp4d20 "Cyp4d20" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0033304 Cyp6a13 "Cyp6a13" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0031694 Cyp4ac2 "Cyp4ac2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0023541 Cyp4d14 "Cyp4d14" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0031925 Cyp4d21 "Cyp4d21" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query69
pfam00067461 pfam00067, p450, Cytochrome P450 8e-06
PLN02169500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 2e-05
PLN02426502 PLN02426, PLN02426, cytochrome P450, family 94, su 8e-04
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 0.001
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information 
 Score = 40.7 bits (96), Expect = 8e-06
 Identities = 12/33 (36%), Positives = 22/33 (66%)

Query: 2   TGPRNCIGGKYALLQMKVFTVSIVREFEILPVE 34
            GPRNC+G + A ++MK+F  ++++ FE+    
Sbjct: 405 AGPRNCLGERLARMEMKLFLATLLQNFEVELPP 437

Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures. Length = 461
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 69
KOG0157|consensus497 99.55
KOG0158|consensus499 99.54
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.52
PLN03195516 fatty acid omega-hydroxylase; Provisional 99.48
PLN02426502 cytochrome P450, family 94, subfamily C protein 99.46
PLN02936489 epsilon-ring hydroxylase 99.46
PLN02738633 carotene beta-ring hydroxylase 99.45
PLN02290516 cytokinin trans-hydroxylase 99.45
PLN00168519 Cytochrome P450; Provisional 99.45
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.41
PLN02655466 ent-kaurene oxidase 99.4
PLN02302490 ent-kaurenoic acid oxidase 99.37
PLN03234499 cytochrome P450 83B1; Provisional 99.35
PLN02774463 brassinosteroid-6-oxidase 99.34
PTZ00404482 cytochrome P450; Provisional 99.34
KOG0159|consensus519 99.34
PLN02394503 trans-cinnamate 4-monooxygenase 99.34
PLN02987472 Cytochrome P450, family 90, subfamily A 99.33
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.32
PLN03112514 cytochrome P450 family protein; Provisional 99.31
PLN02196463 abscisic acid 8'-hydroxylase 99.31
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 99.3
PLN02687517 flavonoid 3'-monooxygenase 99.28
PLN03018534 homomethionine N-hydroxylase 99.28
PLN02500490 cytochrome P450 90B1 99.26
PLN02971543 tryptophan N-hydroxylase 99.25
PLN02966502 cytochrome P450 83A1 99.2
PLN02183516 ferulate 5-hydroxylase 99.19
KOG0684|consensus486 99.13
KOG0156|consensus489 99.06
PLN02648480 allene oxide synthase 98.95
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 98.81
PF09201148 SRX: SRX; InterPro: IPR015284 The signal recogniti 84.89
>KOG0157|consensus Back     alignment and domain information 
Probab=99.55  E-value=2.5e-14  Score=84.38  Aligned_cols=60  Identities=38%  Similarity=0.643  Sum_probs=52.8

Q ss_pred             CCCCccccchHHHHHHHHHHHHHHhHhceeeecccccccccceeeEeeeeEEecCCCeeEEEEEee
Q psy11242          1 MTGPRNCIGGKYALLQMKVFTVSIVREFEILPVEAYKTMAQVEEAIRLNFTLDLDEPCHIRLRERR   66 (69)
Q Consensus         1 g~G~r~C~G~~~a~~~~~~~~~~ll~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   66 (69)
                      |+|+|+|+|++||++|++++++.++++|+|++..+     .. ..+....++.++.++++.+.+|.
T Consensus       437 saGpR~CiG~~fA~lemKv~l~~ll~~f~~~~~~~-----~~-~~~~~~~~l~~~~gl~v~~~~r~  496 (497)
T KOG0157|consen  437 SAGPRNCIGQKFAMLEMKVVLAHLLRRFRIEPVGG-----DK-PKPVPELTLRPKNGLKVKLRPRG  496 (497)
T ss_pred             CCCcccchhHHHHHHHHHHHHHHHHHheEEEecCC-----CC-ceeeeEEEEEecCCeEEEEEeCC
Confidence            67999999999999999999999999999998775     22 55667889999999999999875

>KOG0158|consensus Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>KOG0159|consensus Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>KOG0684|consensus Back     alignment and domain information
>KOG0156|consensus Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF09201 SRX: SRX; InterPro: IPR015284 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query69
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 1e-10
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 1e-10
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 8e-10
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 3e-09
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 2e-08
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 3e-08
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 5e-08
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 6e-08
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 7e-08
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 7e-08
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 8e-08
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 1e-07
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 2e-07
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 2e-07
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 3e-07
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 5e-07
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
 Score = 54.2 bits (131), Expect = 1e-10
 Identities = 16/66 (24%), Positives = 29/66 (43%), Gaps = 6/66 (9%)

Query: 3   GPRNCIGGKYALLQMKVFTVSIVREFEILPVEAYKTMAQVEEAIRLNFTLDLDEPCHIRL 62
           G R+CIG ++A +++KV    +++  E   V            ++   TL   +P    L
Sbjct: 385 GHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQ------RFGLQEQATLKPLDPVLCTL 438

Query: 63  RERRRK 68
           R R  +
Sbjct: 439 RPRGWQ 444
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query69
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.57
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.55
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.53
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.52
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.5
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.49
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 99.47
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.45
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.45
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.43
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 99.43
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.4
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.38
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.38
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.37
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.37
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.36
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.36
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.36
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.35
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.34
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.33
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 99.33
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.33
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.32
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.31
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 99.31
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.3
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.3
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.3
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.3
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.3
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.29
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.29
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.29
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.29
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.28
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.28
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.27
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.26
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.25
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.25
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 99.24
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 99.24
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.22
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.22
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.21
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.21
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.21
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.21
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.2
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.2
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.19
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.19
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 99.18
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.18
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.17
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.17
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 99.17
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.16
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.15
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.15
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.14
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.13
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.13
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.12
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 99.12
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.11
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 99.1
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 99.09
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.06
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 99.04
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 99.03
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 98.97
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 98.95
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 98.87
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 98.77
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=99.57  E-value=4.8e-15  Score=84.77  Aligned_cols=64  Identities=17%  Similarity=0.321  Sum_probs=47.9

Q ss_pred             CCCCccccchHHHHHHHHHHHHHHhHhceeeecccccccccceeeEeeeeEEecCCCeeEEEEEeecC
Q psy11242          1 MTGPRNCIGGKYALLQMKVFTVSIVREFEILPVEAYKTMAQVEEAIRLNFTLDLDEPCHIRLRERRRK   68 (69)
Q Consensus         1 g~G~r~C~G~~~a~~~~~~~~~~ll~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   68 (69)
                      |.|+|.|+|++||.+|++++++.|+++|+|++.++.   ..........++..| .++.+.+++|.+.
T Consensus       415 G~G~R~C~G~~lA~~e~~~~la~ll~~f~~~~~~~~---~~~~~~~~~~~~~~P-~~~~v~~~pRs~~  478 (479)
T 3tbg_A          415 SAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQ---PRPSHHGVFAFLVSP-SPYELCAVPRHHH  478 (479)
T ss_dssp             CCSTTSCTTHHHHHHHHHHHHHHHHHHEEEECCTTS---CCCCSCEEESSSEEE-CCCCBEEEEC---
T ss_pred             CCCCcCChhHHHHHHHHHHHHHHHHHccEEEeCCCC---CCccccccceeeecC-CCeEEEEEECCCC
Confidence            789999999999999999999999999999887651   111222234456666 4899999999763
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 69
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 2e-10
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 8e-10
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 1e-09
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 3e-08
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 2e-07
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 4e-07
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 5e-07
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 1e-05
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 2e-05
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 7e-05
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 8e-05
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 1e-04
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 1e-04
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 1e-04
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 2e-04
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 3e-04
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 3e-04
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 4e-04
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 4e-04
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 4e-04
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 8e-04
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 52.0 bits (123), Expect = 2e-10
 Identities = 18/63 (28%), Positives = 34/63 (53%), Gaps = 4/63 (6%)

Query: 3   GPRNCIGGKYALLQMKVFTVSIVREFEILPVEAYKTMAQVEEAIRLNFTLDLDEPCHIRL 62
           GPRNCIG ++AL+ MK+  + +++ F   P +      Q+   + L   L  ++P  +++
Sbjct: 411 GPRNCIGMRFALMNMKLALIRVLQNFSFKPCKE----TQIPLKLSLGGLLQPEKPVVLKV 466

Query: 63  RER 65
             R
Sbjct: 467 ESR 469
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query69
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.58
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.51
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.49
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.49
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.49
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.45
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.41
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.4
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.4
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.37
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.33
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.32
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.3
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.3
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.29
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.28
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.26
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.17
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.14
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.14
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.14
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.58  E-value=9.6e-16  Score=85.82  Aligned_cols=63  Identities=29%  Similarity=0.606  Sum_probs=51.9

Q ss_pred             CCCCccccchHHHHHHHHHHHHHHhHhceeeecccccccccceeeEeeeeEEecCCCeeEEEEEeec
Q psy11242          1 MTGPRNCIGGKYALLQMKVFTVSIVREFEILPVEAYKTMAQVEEAIRLNFTLDLDEPCHIRLRERRR   67 (69)
Q Consensus         1 g~G~r~C~G~~~a~~~~~~~~~~ll~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   67 (69)
                      |+|+|.|+|++||..+++++++.|+++|+|++.++    ...+.......++.|+.++.+++++|+.
T Consensus       409 G~G~r~C~G~~~A~~~~~~~la~ll~~f~~~~~~~----~~~~~~~~~~~~~~p~~~~~~~~~~R~~  471 (472)
T d1tqna_         409 GSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKE----TQIPLKLSLGGLLQPEKPVVLKVESRDG  471 (472)
T ss_dssp             CCSTTSCTTHHHHHHHHHHHHHHHHTTEEEECCTT----CCSSCCBCSSSSCCBSSCCEEEEEETTC
T ss_pred             CCCCccChhHHHHHHHHHHHHHHHHHhCEEEeCCC----CCCCceeccceEEeeCCCEEEEEEECCC
Confidence            78999999999999999999999999999998765    1223443445567788899999999975
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure