Psyllid ID: psy11294
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 111 | ||||||
| 242020688 | 1614 | Agrin precursor, putative [Pediculus hum | 0.693 | 0.047 | 0.554 | 1e-22 | |
| 357602535 | 1088 | putative agrin [Danaus plexippus] | 0.693 | 0.070 | 0.488 | 1e-17 | |
| 383850257 | 1852 | PREDICTED: agrin-like [Megachile rotunda | 0.486 | 0.029 | 0.527 | 5e-17 | |
| 328787536 | 1900 | PREDICTED: agrin-like isoform 1 [Apis me | 0.549 | 0.032 | 0.481 | 2e-16 | |
| 189233617 | 2027 | PREDICTED: similar to agrin [Tribolium c | 0.558 | 0.030 | 0.514 | 1e-15 | |
| 307213744 | 120 | Agrin [Harpegnathos saltator] | 0.702 | 0.65 | 0.461 | 1e-15 | |
| 270014663 | 1796 | hypothetical protein TcasGA2_TC004709 [T | 0.531 | 0.032 | 0.514 | 2e-15 | |
| 345492515 | 720 | PREDICTED: hypothetical protein LOC10067 | 0.540 | 0.083 | 0.515 | 3e-13 | |
| 350425393 | 2243 | PREDICTED: agrin-like [Bombus impatiens] | 0.540 | 0.026 | 0.5 | 4e-13 | |
| 340723263 | 2243 | PREDICTED: agrin-like [Bombus terrestris | 0.540 | 0.026 | 0.5 | 4e-13 |
| >gi|242020688|ref|XP_002430784.1| Agrin precursor, putative [Pediculus humanus corporis] gi|212515981|gb|EEB18046.1| Agrin precursor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 110 bits (275), Expect = 1e-22, Method: Compositional matrix adjust.
Identities = 46/83 (55%), Positives = 62/83 (74%)
Query: 10 IFLILDFLYACYIFPPELTNPCQENTCQYGAKCIPSEDGTSYKCECPQECPNYGDHTGSR 69
+ I +CY+FP E NPC++ CQYGA+C+PS DG S +C+CP+ CPN GDH GSR
Sbjct: 17 LLNISKIALSCYVFPTEQENPCKDKKCQYGARCVPSLDGKSSECKCPENCPNLGDHVGSR 76
Query: 70 PVCGSNGVDYKDLCEFQRASCST 92
PVCGS+G+DY+D CE +R++C T
Sbjct: 77 PVCGSDGLDYRDSCELKRSACLT 99
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|357602535|gb|EHJ63441.1| putative agrin [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|383850257|ref|XP_003700712.1| PREDICTED: agrin-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|328787536|ref|XP_391941.3| PREDICTED: agrin-like isoform 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|189233617|ref|XP_001811978.1| PREDICTED: similar to agrin [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|307213744|gb|EFN89082.1| Agrin [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|270014663|gb|EFA11111.1| hypothetical protein TcasGA2_TC004709 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|345492515|ref|XP_003426866.1| PREDICTED: hypothetical protein LOC100678146 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|350425393|ref|XP_003494108.1| PREDICTED: agrin-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340723263|ref|XP_003400011.1| PREDICTED: agrin-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 111 | ||||||
| ZFIN|ZDB-GENE-030131-1033 | 2028 | agrn "agrin" [Danio rerio (tax | 0.594 | 0.032 | 0.457 | 6.9e-12 | |
| WB|WBGene00018304 | 1473 | agr-1 [Caenorhabditis elegans | 0.630 | 0.047 | 0.416 | 2.1e-11 | |
| MGI|MGI:87961 | 1950 | Agrn "agrin" [Mus musculus (ta | 0.549 | 0.031 | 0.415 | 2.4e-09 | |
| MGI|MGI:1926810 | 372 | Tmeff1 "transmembrane protein | 0.477 | 0.142 | 0.45 | 5.9e-09 | |
| RGD|62005 | 373 | Tmeff1 "transmembrane protein | 0.477 | 0.142 | 0.45 | 5.9e-09 | |
| UNIPROTKB|Q8IYR6 | 380 | TMEFF1 "Tomoregulin-1" [Homo s | 0.477 | 0.139 | 0.45 | 6.1e-09 | |
| RGD|2067 | 1959 | Agrn "agrin" [Rattus norvegicu | 0.549 | 0.031 | 0.4 | 8.1e-09 | |
| UNIPROTKB|F1MSI2 | 2032 | AGRN "Uncharacterized protein" | 0.531 | 0.029 | 0.428 | 8.4e-09 | |
| UNIPROTKB|F1Q2Z6 | 2046 | AGRN "Uncharacterized protein" | 0.531 | 0.028 | 0.412 | 3.7e-08 | |
| UNIPROTKB|F1P3E3 | 1952 | AGRN "Agrin" [Gallus gallus (t | 0.522 | 0.029 | 0.370 | 4.5e-08 |
| ZFIN|ZDB-GENE-030131-1033 agrn "agrin" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 177 (67.4 bits), Expect = 6.9e-12, P = 6.9e-12
Identities = 32/70 (45%), Positives = 41/70 (58%)
Query: 24 PPELTNPCQENTCQYGAKCIPSEDGTSYKCECPQECPNYGDHTGSRPVCGSNGVDYKDLC 83
P L +PC E TC +G+ CI S DG S KC CP C N H VCGS+G+DY+ C
Sbjct: 238 PCALKDPCSEVTCSFGSTCIQSSDGLSAKCMCPLSCENVPKHV----VCGSDGLDYQSEC 293
Query: 84 EFQRASCSTK 93
E +C+T+
Sbjct: 294 ELNMKACATQ 303
|
|
| WB|WBGene00018304 agr-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:87961 Agrn "agrin" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1926810 Tmeff1 "transmembrane protein with EGF-like and two follistatin-like domains 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|62005 Tmeff1 "transmembrane protein with EGF-like and two follistatin-like domains 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8IYR6 TMEFF1 "Tomoregulin-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|2067 Agrn "agrin" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MSI2 AGRN "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1Q2Z6 AGRN "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P3E3 AGRN "Agrin" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 111 | |||
| smart00280 | 46 | smart00280, KAZAL, Kazal type serine protease inhi | 2e-05 | |
| cd01328 | 86 | cd01328, FSL_SPARC, Follistatin-like SPARC (secret | 0.002 | |
| cd00104 | 41 | cd00104, KAZAL_FS, Kazal type serine protease inhi | 0.003 |
| >gnl|CDD|197624 smart00280, KAZAL, Kazal type serine protease inhibitors | Back alignment and domain information |
|---|
Score = 38.8 bits (91), Expect = 2e-05
Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 5/40 (12%)
Query: 54 ECPQECPNYGDHTGSRPVCGSNGVDYKDLCEFQRASCSTK 93
+CP+ CP PVCGS+GV Y + C +A+C +
Sbjct: 1 DCPEACPRE-----YDPVCGSDGVTYSNECHLCKAACESG 35
|
Kazal type serine protease inhibitors and follistatin-like domains. Length = 46 |
| >gnl|CDD|238649 cd01328, FSL_SPARC, Follistatin-like SPARC (secreted protein, acidic, and rich in cysteines) domain; SPARC/BM-40/osteonectin is a multifunctional glycoprotein which modulates cellular interaction with the extracellular matrix by its binding to structural matrix proteins such as collagen and vitronectin | Back alignment and domain information |
|---|
| >gnl|CDD|238052 cd00104, KAZAL_FS, Kazal type serine protease inhibitors and follistatin-like domains | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 111 | |||
| cd01328 | 86 | FSL_SPARC Follistatin-like SPARC (secreted protein | 99.81 | |
| smart00280 | 46 | KAZAL Kazal type serine protease inhibitors. Kazal | 99.53 | |
| cd01327 | 45 | KAZAL_PSTI Kazal-type pancreatic secretory trypsin | 99.48 | |
| PF07648 | 42 | Kazal_2: Kazal-type serine protease inhibitor doma | 99.28 | |
| cd00104 | 41 | KAZAL_FS Kazal type serine protease inhibitors and | 99.24 | |
| PF00050 | 48 | Kazal_1: Kazal-type serine protease inhibitor doma | 99.12 | |
| KOG4004|consensus | 259 | 99.12 | ||
| KOG3555|consensus | 434 | 98.74 | ||
| KOG4578|consensus | 421 | 98.26 | ||
| smart00057 | 69 | FIMAC factor I membrane attack complex. | 98.24 | |
| cd01330 | 54 | KAZAL_SLC21 The kazal-type serine protease inhibit | 97.51 | |
| smart00274 | 26 | FOLN Follistatin-N-terminal domain-like. Follistat | 96.49 | |
| PF09289 | 22 | FOLN: Follistatin/Osteonectin-like EGF domain; Int | 94.88 | |
| TIGR00805 | 633 | oat sodium-independent organic anion transporter. | 93.97 | |
| cd01327 | 45 | KAZAL_PSTI Kazal-type pancreatic secretory trypsin | 93.13 | |
| KOG3626|consensus | 735 | 88.83 |
| >cd01328 FSL_SPARC Follistatin-like SPARC (secreted protein, acidic, and rich in cysteines) domain; SPARC/BM-40/osteonectin is a multifunctional glycoprotein which modulates cellular interaction with the extracellular matrix by its binding to structural matrix proteins such as collagen and vitronectin | Back alignment and domain information |
|---|
Probab=99.81 E-value=2.8e-20 Score=124.06 Aligned_cols=62 Identities=31% Similarity=0.726 Sum_probs=55.2
Q ss_pred CCCCCCCCCCCeeccCCCCCCccCcCCCCCCCCCCCCCCCCeecCCCceecCHhHHHHHHhhcCC
Q psy11294 30 PCQENTCQYGAKCIPSEDGTSYKCECPQECPNYGDHTGSRPVCGSNGVDYKDLCEFQRASCSTKM 94 (111)
Q Consensus 30 pC~~~~C~~g~~C~~~~~g~~~~C~C~~~C~~~~d~~~~~pVCGSDG~TY~n~C~L~~aaC~~~~ 94 (111)
||+++.|+.|++|+++. .++|+|+|+..||...+ +.++||||||+||+|+|+|++++|..++
T Consensus 1 pC~~v~C~~G~~C~~d~-~~~p~CvC~~~Cp~~~~--~~~~VCGsDg~TY~s~C~L~r~~C~~~~ 62 (86)
T cd01328 1 PCENHHCGAGKVCEVDD-ENTPKCVCIDPCPEEVD--DRRKVCTNDNETFDSDCELYRTRCLCKG 62 (86)
T ss_pred CCCCcCCCCCCEeeECC-CCCeEEecCCcCCCCCC--CCCceeCCCCCCcccHhHHhhhHhccCC
Confidence 79999999999999975 45799999999999763 3478999999999999999999998664
|
The protein it composed of an N-terminal acidic region, a follistatin (FS) domain and an EF-hand calcium binding domain. The FS domain consists of an N-terminal beta hairpin (FOLN/EGF-like domain) and a small hydrophobic core of alpha/beta structure (Kazal domain) and has five disulfide bonds and a conserved N-glycosylation site. The FSL_SPARC domain is a member of the superfamily of kazal-like proteinase inhibitors and follistatin-like proteins. |
| >smart00280 KAZAL Kazal type serine protease inhibitors | Back alignment and domain information |
|---|
| >cd01327 KAZAL_PSTI Kazal-type pancreatic secretory trypsin inhibitors (PSTI) and related proteins, including the second domain of the ovomucoid turkey inhibitor and the C-terminal domain of the esophagus cancer-related gene-2 protein (ECRG-2), are members of the superfamily of kazal-type proteinase inhibitors and follistatin-like proteins | Back alignment and domain information |
|---|
| >PF07648 Kazal_2: Kazal-type serine protease inhibitor domain; InterPro: IPR011497 This domain is usually indicative of serine protease inhibitors that belong to Merops inhibitor families: I1, I2, I17 and I31 | Back alignment and domain information |
|---|
| >cd00104 KAZAL_FS Kazal type serine protease inhibitors and follistatin-like domains | Back alignment and domain information |
|---|
| >PF00050 Kazal_1: Kazal-type serine protease inhibitor domain; InterPro: IPR002350 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively | Back alignment and domain information |
|---|
| >KOG4004|consensus | Back alignment and domain information |
|---|
| >KOG3555|consensus | Back alignment and domain information |
|---|
| >KOG4578|consensus | Back alignment and domain information |
|---|
| >smart00057 FIMAC factor I membrane attack complex | Back alignment and domain information |
|---|
| >cd01330 KAZAL_SLC21 The kazal-type serine protease inhibitor domain has been detected in an extracellular loop region of solute carrier 21 (SLC21) family members (organic anion transporters) , which may regulate the specificity of anion uptake | Back alignment and domain information |
|---|
| >smart00274 FOLN Follistatin-N-terminal domain-like | Back alignment and domain information |
|---|
| >PF09289 FOLN: Follistatin/Osteonectin-like EGF domain; InterPro: IPR015369 This domain is predominantly found in osteonectin and follistatin | Back alignment and domain information |
|---|
| >TIGR00805 oat sodium-independent organic anion transporter | Back alignment and domain information |
|---|
| >cd01327 KAZAL_PSTI Kazal-type pancreatic secretory trypsin inhibitors (PSTI) and related proteins, including the second domain of the ovomucoid turkey inhibitor and the C-terminal domain of the esophagus cancer-related gene-2 protein (ECRG-2), are members of the superfamily of kazal-type proteinase inhibitors and follistatin-like proteins | Back alignment and domain information |
|---|
| >KOG3626|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 111 | |||
| 1lr7_A | 74 | Follistatin, FS1; heparin-binding, cystine-rich, s | 6e-11 | |
| 1nub_A | 229 | Basement membrane protein BM-40; extracellular mod | 7e-09 | |
| 3hh2_C | 288 | Follistatin; protein-protein complex, TB domain, c | 4e-07 | |
| 3hh2_C | 288 | Follistatin; protein-protein complex, TB domain, c | 3e-04 | |
| 2arp_F | 152 | Follistatin; cystine knot, disulfide rich, EGF dom | 7e-07 | |
| 2arp_F | 152 | Follistatin; cystine knot, disulfide rich, EGF dom | 3e-05 | |
| 3b4v_C | 237 | Follistatin-like 3; ligand-inhibitor signalling co | 2e-06 | |
| 3b4v_C | 237 | Follistatin-like 3; ligand-inhibitor signalling co | 1e-04 | |
| 1y1b_A | 48 | Elastase inhibitor; non-classical, kazal-type, pro | 3e-06 | |
| 3sek_C | 209 | Follistatin-related protein 3; protein-protein com | 3e-06 | |
| 3sek_C | 209 | Follistatin-related protein 3; protein-protein com | 5e-04 |
| >1lr7_A Follistatin, FS1; heparin-binding, cystine-rich, sucrose octasulphate, hormone/growth factor complex; HET: SO4; 1.50A {Rattus norvegicus} SCOP: g.3.11.3 g.68.1.1 PDB: 1lr8_A* 1lr9_A Length = 74 | Back alignment and structure |
|---|
Score = 53.0 bits (127), Expect = 6e-11
Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 4/65 (6%)
Query: 29 NPCQENTCQYGAKCIPSEDGTSYKCECPQECPNYGDHTGSRPVCGSNGVDYKDLCEFQRA 88
C+ C G KC ++ +C C +C N T PVCG +G Y++ C +A
Sbjct: 2 ETCENVDCGPGKKCRMNKKNKP-RCVCAPDCSNI---TWKGPVCGLDGKTYRNECALLKA 57
Query: 89 SCSTK 93
C +
Sbjct: 58 RCKEQ 62
|
| >1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Length = 229 | Back alignment and structure |
|---|
| >3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D Length = 288 | Back alignment and structure |
|---|
| >3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D Length = 288 | Back alignment and structure |
|---|
| >2arp_F Follistatin; cystine knot, disulfide rich, EGF domain, kazal domain, PROT complex, hormone-growth factor complex; HET: 1PG; 2.00A {Rattus norvegicus} Length = 152 | Back alignment and structure |
|---|
| >2arp_F Follistatin; cystine knot, disulfide rich, EGF domain, kazal domain, PROT complex, hormone-growth factor complex; HET: 1PG; 2.00A {Rattus norvegicus} Length = 152 | Back alignment and structure |
|---|
| >3b4v_C Follistatin-like 3; ligand-inhibitor signalling complex, cleavage on PAIR of BAS residues, glycoprotein, growth factor, hormone, secreted; HET: NAG; 2.48A {Homo sapiens} Length = 237 | Back alignment and structure |
|---|
| >3b4v_C Follistatin-like 3; ligand-inhibitor signalling complex, cleavage on PAIR of BAS residues, glycoprotein, growth factor, hormone, secreted; HET: NAG; 2.48A {Homo sapiens} Length = 237 | Back alignment and structure |
|---|
| >1y1b_A Elastase inhibitor; non-classical, kazal-type, protease inhibitor, CSH motif, hydrolase inhibitor; NMR {Synthetic} PDB: 1y1c_A Length = 48 | Back alignment and structure |
|---|
| >3sek_C Follistatin-related protein 3; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, follistatin domain (FSD); HET: NAG; 2.40A {Homo sapiens} PDB: 2kcx_A Length = 209 | Back alignment and structure |
|---|
| >3sek_C Follistatin-related protein 3; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, follistatin domain (FSD); HET: NAG; 2.40A {Homo sapiens} PDB: 2kcx_A Length = 209 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 111 | |||
| 2arp_F | 152 | Follistatin; cystine knot, disulfide rich, EGF dom | 99.83 | |
| 1lr7_A | 74 | Follistatin, FS1; heparin-binding, cystine-rich, s | 99.83 | |
| 3hh2_C | 288 | Follistatin; protein-protein complex, TB domain, c | 99.79 | |
| 3sek_C | 209 | Follistatin-related protein 3; protein-protein com | 99.78 | |
| 3b4v_C | 237 | Follistatin-like 3; ligand-inhibitor signalling co | 99.77 | |
| 3hh2_C | 288 | Follistatin; protein-protein complex, TB domain, c | 99.76 | |
| 3b4v_C | 237 | Follistatin-like 3; ligand-inhibitor signalling co | 99.73 | |
| 2arp_F | 152 | Follistatin; cystine knot, disulfide rich, EGF dom | 99.71 | |
| 3sek_C | 209 | Follistatin-related protein 3; protein-protein com | 99.68 | |
| 1nub_A | 229 | Basement membrane protein BM-40; extracellular mod | 99.66 | |
| 1tbr_R | 103 | RHODNIIN; complex (serine protease-inhibitor), kaz | 99.57 | |
| 1cgj_I | 56 | Pancreatic secretory trypsin inhibitor (kazal type | 99.48 | |
| 3pis_D | 42 | Kazal-type serine protease inhibitor SPI-1; typica | 99.46 | |
| 3qtl_D | 75 | Kazal-type serine protease inhibitor SPI-1; serine | 99.45 | |
| 1yu6_C | 185 | Ovomucoid; protein proteinase inhibitor, protease, | 99.44 | |
| 2jxd_A | 62 | Serine protease inhibitor kazal-type 2; anti-paral | 99.44 | |
| 1tgs_I | 56 | Pancreatic secretory trypsin inhibitor (kazal type | 99.43 | |
| 1y1b_A | 48 | Elastase inhibitor; non-classical, kazal-type, pro | 99.43 | |
| 1pce_A | 60 | PEC-60; proteinase inhibitor(kazal type); NMR {Sus | 99.4 | |
| 1yu6_C | 185 | Ovomucoid; protein proteinase inhibitor, protease, | 99.33 | |
| 1r0r_I | 51 | Ovomucoid, omtky3; high resolution, serine proteas | 99.32 | |
| 2leo_A | 66 | Serine protease inhibitor kazal-type 7; esophageal | 98.97 | |
| 1bus_A | 57 | Proteinase inhibitor IIA; HET: PCA; NMR {Bos tauru | 99.29 | |
| 1uvf_A | 61 | Serine proteinase inhibitor kazal type 5; trypsin | 99.27 | |
| 2f3c_I | 55 | Thrombin inhibitor infestin; serine protease - inh | 99.26 | |
| 2erw_A | 56 | Serine protease inhibitor infestin; kazal type dom | 99.25 | |
| 1uvg_A | 78 | Serine proteinase inhibitor kazal type 5; trypsin | 99.21 | |
| 4gi3_C | 83 | Greglin; kazal type inhibitor, hydrolase-hydrolase | 99.14 | |
| 3qtl_D | 75 | Kazal-type serine protease inhibitor SPI-1; serine | 99.11 | |
| 1ldt_L | 46 | LDTI, tryptase inhibitor; complex (hydrolase/inhib | 99.11 | |
| 1h0z_A | 68 | Serine protease inhibitor kazal-type 5, contains h | 99.1 | |
| 3tjq_A | 140 | Serine protease HTRA1; hydrolase; 2.00A {Homo sapi | 99.1 | |
| 1tbr_R | 103 | RHODNIIN; complex (serine protease-inhibitor), kaz | 99.09 | |
| 2wcy_A | 155 | Complement component C7; immune system, disulfide | 98.76 | |
| 1hdl_A | 55 | HF6478, serine proteinase inhibitor lekti; putativ | 98.04 | |
| 2wcy_A | 155 | Complement component C7; immune system, disulfide | 97.72 | |
| 2xrc_A | 565 | Human complement factor I; immune system, hydrolas | 96.95 | |
| 2leo_A | 66 | Serine protease inhibitor kazal-type 7; esophageal | 90.63 | |
| 2jxd_A | 62 | Serine protease inhibitor kazal-type 2; anti-paral | 90.33 | |
| 3t5o_A | 913 | Complement component C6; macpf, MAC, membrane atta | 89.51 | |
| 1uvg_A | 78 | Serine proteinase inhibitor kazal type 5; trypsin | 86.77 |
| >2arp_F Follistatin; cystine knot, disulfide rich, EGF domain, kazal domain, PROT complex, hormone-growth factor complex; HET: 1PG; 2.00A {Rattus norvegicus} | Back alignment and structure |
|---|
Probab=99.83 E-value=2.8e-21 Score=138.21 Aligned_cols=85 Identities=20% Similarity=0.559 Sum_probs=71.3
Q ss_pred ecceeCCCcccCC--C------------CCCCCCCCCCCCCCCeeccCCCCCCccCc-CCCCCCC---CCCCCCCCCeec
Q psy11294 12 LILDFLYACYIFP--P------------ELTNPCQENTCQYGAKCIPSEDGTSYKCE-CPQECPN---YGDHTGSRPVCG 73 (111)
Q Consensus 12 ~g~TY~NeC~L~~--c------------~~~~pC~~~~C~~g~~C~~~~~g~~~~C~-C~~~C~~---~~d~~~~~pVCG 73 (111)
+|+||.|+|+|+. | ....+|.++.|+.|.+|+++.. +.+.|+ |+..||. .+ .||||
T Consensus 46 DG~tY~N~C~l~~~~c~~~~~i~~~~~G~C~~~C~~~~C~~g~~C~~~~~-~~~~C~~C~~~C~~~~~~~-----~pVCG 119 (152)
T 2arp_F 46 DGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVFCPGSSTCVVDQT-NNAYCVTCNRICPEPSSSE-----QSLCG 119 (152)
T ss_dssp TSCEESSHHHHHHHHHHTCTTCCEEEESSCCBSSTTCCCCTTCEEEECTT-SBEEEECCCCCCCCCSSST-----TCEEE
T ss_pred CCCEeCCHhHHHHHHhhcCCceEEEeccccccccccccCCCCCccccccc-CccccCcCCCcCCCcccCC-----CceeC
Confidence 6999999999861 1 1134688899999999999754 479999 9999998 55 89999
Q ss_pred CCCceecCHhHHHHHHhhcCC----CccccCCC
Q psy11294 74 SNGVDYKDLCEFQRASCSTKM----LSRGFLLD 102 (111)
Q Consensus 74 SDG~TY~n~C~L~~aaC~~~~----~~~G~C~~ 102 (111)
|||+||.|+|+|++++|+.+. .++|+|.+
T Consensus 120 sDg~TY~n~C~l~~~~C~~~~~i~v~~~G~C~~ 152 (152)
T 2arp_F 120 NDGVTYSSACHLRKATCLLGRSIGLAYEGKCIK 152 (152)
T ss_dssp TTSCEESSHHHHHHHHHHHTSCCCEEEESSCCC
T ss_pred CCCCEecCHhHhhHHhhccCCceEEeecccCCC
Confidence 999999999999999999765 57899864
|
| >1lr7_A Follistatin, FS1; heparin-binding, cystine-rich, sucrose octasulphate, hormone/growth factor complex; HET: SO4; 1.50A {Rattus norvegicus} SCOP: g.3.11.3 g.68.1.1 PDB: 1lr8_A* 1lr9_A | Back alignment and structure |
|---|
| >3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D | Back alignment and structure |
|---|
| >3sek_C Follistatin-related protein 3; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, follistatin domain (FSD); HET: NAG; 2.40A {Homo sapiens} PDB: 2kcx_A | Back alignment and structure |
|---|
| >3b4v_C Follistatin-like 3; ligand-inhibitor signalling complex, cleavage on PAIR of BAS residues, glycoprotein, growth factor, hormone, secreted; HET: NAG; 2.48A {Homo sapiens} | Back alignment and structure |
|---|
| >3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D | Back alignment and structure |
|---|
| >3b4v_C Follistatin-like 3; ligand-inhibitor signalling complex, cleavage on PAIR of BAS residues, glycoprotein, growth factor, hormone, secreted; HET: NAG; 2.48A {Homo sapiens} | Back alignment and structure |
|---|
| >2arp_F Follistatin; cystine knot, disulfide rich, EGF domain, kazal domain, PROT complex, hormone-growth factor complex; HET: 1PG; 2.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3sek_C Follistatin-related protein 3; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, follistatin domain (FSD); HET: NAG; 2.40A {Homo sapiens} PDB: 2kcx_A | Back alignment and structure |
|---|
| >1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* | Back alignment and structure |
|---|
| >1tbr_R RHODNIIN; complex (serine protease-inhibitor), kazal-type inhibitor, T complex (serine protease-inhibitor) complex; 2.60A {Rhodnius prolixus} SCOP: g.68.1.1 g.68.1.1 PDB: 1tbq_R | Back alignment and structure |
|---|
| >1cgj_I Pancreatic secretory trypsin inhibitor (kazal type) variant 4; serine protease/inhibitor complex; 2.30A {Homo sapiens} SCOP: g.68.1.1 | Back alignment and structure |
|---|
| >3pis_D Kazal-type serine protease inhibitor SPI-1; typical non-classical kazal type inhibitor fold; 2.00A {Carcinoscorpius rotundicauda} | Back alignment and structure |
|---|
| >3qtl_D Kazal-type serine protease inhibitor SPI-1; serine protease -kazal type serine protease inhibitor comple hydrolase inhibitor; 2.60A {Carcinoscorpius rotundicauda} | Back alignment and structure |
|---|
| >1yu6_C Ovomucoid; protein proteinase inhibitor, protease, hydrolase; 1.55A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1z7k_B* | Back alignment and structure |
|---|
| >2jxd_A Serine protease inhibitor kazal-type 2; anti-parallel beta sheet, beta-bulge, disulfide bond, alpha helix, pyrrolidone carboxylic acid, secreted; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1tgs_I Pancreatic secretory trypsin inhibitor (kazal type); complex (proteinase/inhibitor); 1.80A {Sus scrofa} SCOP: g.68.1.1 PDB: 1cgi_I 1hpt_A | Back alignment and structure |
|---|
| >1y1b_A Elastase inhibitor; non-classical, kazal-type, protease inhibitor, CSH motif, hydrolase inhibitor; NMR {Synthetic} PDB: 1y1c_A | Back alignment and structure |
|---|
| >1pce_A PEC-60; proteinase inhibitor(kazal type); NMR {Sus scrofa} SCOP: g.68.1.1 | Back alignment and structure |
|---|
| >1yu6_C Ovomucoid; protein proteinase inhibitor, protease, hydrolase; 1.55A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1z7k_B* | Back alignment and structure |
|---|
| >1r0r_I Ovomucoid, omtky3; high resolution, serine protease, protein inhibitor, hydrolase; 1.10A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1sgr_I 2gkr_I 1cho_I 1omt_A 1omu_A 1ppf_I* 1tur_A 1tus_A 3sgb_I 2ovo_A 4ovo_A 1iy5_A 1cso_I 1ct4_I 2sgf_I 2gkt_I 2gkv_A 2nu0_I 1m8b_A 1m8c_A ... | Back alignment and structure |
|---|
| >2leo_A Serine protease inhibitor kazal-type 7; esophageal cancer-related gene 2, hydrol inhibitor; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bus_A Proteinase inhibitor IIA; HET: PCA; NMR {Bos taurus} SCOP: g.68.1.1 PDB: 2bus_A* | Back alignment and structure |
|---|
| >2f3c_I Thrombin inhibitor infestin; serine protease - inhibitor complex, kazal-type domain, hydrolase/hydrolase inhibitor complex; 2.50A {Triatoma infestans} SCOP: g.68.1.1 PDB: 1kma_A | Back alignment and structure |
|---|
| >2erw_A Serine protease inhibitor infestin; kazal type domain, blood clotting, hydrolase inhibitor; 1.40A {Triatoma infestans} SCOP: g.68.1.1 | Back alignment and structure |
|---|
| >4gi3_C Greglin; kazal type inhibitor, hydrolase-hydrolase inhibitor complex; 1.75A {Schistocerca gregaria} | Back alignment and structure |
|---|
| >3qtl_D Kazal-type serine protease inhibitor SPI-1; serine protease -kazal type serine protease inhibitor comple hydrolase inhibitor; 2.60A {Carcinoscorpius rotundicauda} | Back alignment and structure |
|---|
| >1ldt_L LDTI, tryptase inhibitor; complex (hydrolase/inhibitor), hydrolase, inflammation; 1.90A {Hirudo medicinalis} SCOP: g.68.1.1 PDB: 1an1_I 2kmo_A 2kmp_A 2kmq_A 2kmr_A | Back alignment and structure |
|---|
| >1h0z_A Serine protease inhibitor kazal-type 5, contains hemofiltrate peptide HF6478, hemofiltrate...; serine proteinase inhibitor; NMR {Homo sapiens} SCOP: g.68.1.2 | Back alignment and structure |
|---|
| >3tjq_A Serine protease HTRA1; hydrolase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1tbr_R RHODNIIN; complex (serine protease-inhibitor), kazal-type inhibitor, T complex (serine protease-inhibitor) complex; 2.60A {Rhodnius prolixus} SCOP: g.68.1.1 g.68.1.1 PDB: 1tbq_R | Back alignment and structure |
|---|
| >2wcy_A Complement component C7; immune system, disulfide bond, immune response, factor I module, FIM, EGF, MAC, FOLN, sushi, fimac, kazal; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1hdl_A HF6478, serine proteinase inhibitor lekti; putative serine proteinase inhibitor; NMR {Homo sapiens} SCOP: g.68.1.2 PDB: 1uuc_A | Back alignment and structure |
|---|
| >2wcy_A Complement component C7; immune system, disulfide bond, immune response, factor I module, FIM, EGF, MAC, FOLN, sushi, fimac, kazal; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} | Back alignment and structure |
|---|
| >2leo_A Serine protease inhibitor kazal-type 7; esophageal cancer-related gene 2, hydrol inhibitor; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jxd_A Serine protease inhibitor kazal-type 2; anti-parallel beta sheet, beta-bulge, disulfide bond, alpha helix, pyrrolidone carboxylic acid, secreted; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 111 | ||||
| d1nuba3 | 58 | g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonec | 2e-08 | |
| d1pcea_ | 60 | g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [Ta | 4e-06 | |
| d1tbrr2 | 52 | g.68.1.1 (R:52-103) Blood-sucking insect-derived t | 1e-05 | |
| d1lr7a2 | 48 | g.68.1.1 (A:89-136) Domain of follistatin {Rat (Ra | 1e-05 | |
| d1tgsi_ | 56 | g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Su | 7e-05 | |
| d1hpta_ | 56 | g.68.1.1 (A:) Secretory trypsin inhibitor {Human ( | 2e-04 | |
| d1z7kb1 | 62 | g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Melea | 2e-04 | |
| d2f3ci1 | 46 | g.68.1.1 (I:5-50) Blood-sucking insect-derived try | 4e-04 | |
| d2busa_ | 57 | g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (B | 0.001 | |
| d1r0ri_ | 51 | g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris | 0.002 |
| >d1nuba3 g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
class: Small proteins fold: Kazal-type serine protease inhibitors superfamily: Kazal-type serine protease inhibitors family: Ovomucoid domain III-like domain: Domain of BM-40/SPARC/osteonectin species: Human (Homo sapiens) [TaxId: 9606]
Score = 45.0 bits (106), Expect = 2e-08
Identities = 10/46 (21%), Positives = 17/46 (36%), Gaps = 2/46 (4%)
Query: 53 CECPQECPNYGDHTGSRPVCGSNGVDYKDLCEFQRASCSTKMLSRG 98
C+ P CP VC ++ + C F C+ + +G
Sbjct: 1 CQDPTSCPAPIGE--FEKVCSNDNKTFDSSCHFFATKCTLEGTKKG 44
|
| >d1pcea_ g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} Length = 60 | Back information, alignment and structure |
|---|
| >d1tbrr2 g.68.1.1 (R:52-103) Blood-sucking insect-derived tryptase inhibitor {Bug (Rhodnius prolixus), rhodniin [TaxId: 13249]} Length = 52 | Back information, alignment and structure |
|---|
| >d1lr7a2 g.68.1.1 (A:89-136) Domain of follistatin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 48 | Back information, alignment and structure |
|---|
| >d1tgsi_ g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Sus scrofa) [TaxId: 9823]} Length = 56 | Back information, alignment and structure |
|---|
| >d1hpta_ g.68.1.1 (A:) Secretory trypsin inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1z7kb1 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 62 | Back information, alignment and structure |
|---|
| >d2f3ci1 g.68.1.1 (I:5-50) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} Length = 46 | Back information, alignment and structure |
|---|
| >d2busa_ g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (Bos taurus) [TaxId: 9913]} Length = 57 | Back information, alignment and structure |
|---|
| >d1r0ri_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 51 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 111 | |||
| d1hpta_ | 56 | Secretory trypsin inhibitor {Human (Homo sapiens) | 99.65 | |
| d1tbrr2 | 52 | Blood-sucking insect-derived tryptase inhibitor {B | 99.63 | |
| d1tgsi_ | 56 | Secretory trypsin inhibitor {Pig (Sus scrofa) [Tax | 99.62 | |
| d1nuba3 | 58 | Domain of BM-40/SPARC/osteonectin {Human (Homo sap | 99.61 | |
| d1lr7a2 | 48 | Domain of follistatin {Rat (Rattus norvegicus) [Ta | 99.58 | |
| d1z7kb1 | 62 | Ovomucoid domains {Turkey (Meleagris gallopavo) [T | 99.55 | |
| d1pcea_ | 60 | PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} | 99.54 | |
| d1r0ri_ | 51 | Ovomucoid domains {Turkey (Meleagris gallopavo) [T | 99.49 | |
| d2busa_ | 57 | Seminal plasma inhibitor IIa {Cow (Bos taurus) [Ta | 99.49 | |
| d2f3ci1 | 46 | Blood-sucking insect-derived tryptase inhibitor {T | 99.49 | |
| d2erwa1 | 53 | Blood-sucking insect-derived tryptase inhibitor {T | 99.47 | |
| d1h0za_ | 68 | Serine proteinase inhibitor lekti {Human (Homo sap | 99.09 | |
| d1ldtl_ | 46 | Leech derived tryptase inhibitor (LDTI-C) {Medicin | 98.92 | |
| d1hdla_ | 55 | Serine proteinase inhibitor lekti {Human (Homo sap | 98.17 | |
| d1r0ri_ | 51 | Ovomucoid domains {Turkey (Meleagris gallopavo) [T | 93.44 | |
| d2f3ci1 | 46 | Blood-sucking insect-derived tryptase inhibitor {T | 93.41 | |
| d1lr7a2 | 48 | Domain of follistatin {Rat (Rattus norvegicus) [Ta | 93.01 | |
| d1tgsi_ | 56 | Secretory trypsin inhibitor {Pig (Sus scrofa) [Tax | 92.61 | |
| d1lr7a1 | 26 | Domain of follistatin {Rat (Rattus norvegicus) [Ta | 92.52 | |
| d1nuba2 | 26 | Domain of BM-40/SPARC/osteonectin {Human (Homo sap | 92.3 | |
| d2busa_ | 57 | Seminal plasma inhibitor IIa {Cow (Bos taurus) [Ta | 92.12 | |
| d1hpta_ | 56 | Secretory trypsin inhibitor {Human (Homo sapiens) | 92.06 | |
| d1z7kb1 | 62 | Ovomucoid domains {Turkey (Meleagris gallopavo) [T | 91.87 | |
| d1pcea_ | 60 | PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} | 91.49 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 86.05 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 81.66 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 81.01 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 80.76 |
| >d1hpta_ g.68.1.1 (A:) Secretory trypsin inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Kazal-type serine protease inhibitors superfamily: Kazal-type serine protease inhibitors family: Ovomucoid domain III-like domain: Secretory trypsin inhibitor species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.65 E-value=5e-17 Score=97.97 Aligned_cols=49 Identities=27% Similarity=0.453 Sum_probs=42.0
Q ss_pred CCCCccCcCC-CCCCCCCCCCCCCCeecCCCceecCHhHHHHHHhhcCC----CccccC
Q psy11294 47 DGTSYKCECP-QECPNYGDHTGSRPVCGSNGVDYKDLCEFQRASCSTKM----LSRGFL 100 (111)
Q Consensus 47 ~g~~~~C~C~-~~C~~~~d~~~~~pVCGSDG~TY~n~C~L~~aaC~~~~----~~~G~C 100 (111)
.|..+.|+|+ ..||..+ +|||||||+||.|+|+|++++|+.+. +++|+|
T Consensus 3 ~gr~~~C~~~~~~C~~~~-----~PVCGsdG~TY~N~C~l~~~~C~~~~~i~v~~~G~C 56 (56)
T d1hpta_ 3 LGREAKCYNELNGCTYEY-----RPVCGTDGDTYPNECVLCFENRKRQTSILIQKSGPC 56 (56)
T ss_dssp SSBCCCCTTCSSCCCCCC-----BCEEETTSCEESBHHHHHHHHHHHTCCCCEEEESCC
T ss_pred CCcCCcCCCCCCCCCCCC-----CcccCCCCcEeccHhHHHHHHhcCCCceEEeecCCC
Confidence 4556899987 4699987 89999999999999999999999876 467776
|
| >d1tbrr2 g.68.1.1 (R:52-103) Blood-sucking insect-derived tryptase inhibitor {Bug (Rhodnius prolixus), rhodniin [TaxId: 13249]} | Back information, alignment and structure |
|---|
| >d1tgsi_ g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1nuba3 g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lr7a2 g.68.1.1 (A:89-136) Domain of follistatin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1z7kb1 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} | Back information, alignment and structure |
|---|
| >d1pcea_ g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1r0ri_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} | Back information, alignment and structure |
|---|
| >d2busa_ g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2f3ci1 g.68.1.1 (I:5-50) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} | Back information, alignment and structure |
|---|
| >d2erwa1 g.68.1.1 (A:4-56) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} | Back information, alignment and structure |
|---|
| >d1h0za_ g.68.1.2 (A:) Serine proteinase inhibitor lekti {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ldtl_ g.68.1.1 (L:) Leech derived tryptase inhibitor (LDTI-C) {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]} | Back information, alignment and structure |
|---|
| >d1hdla_ g.68.1.2 (A:) Serine proteinase inhibitor lekti {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r0ri_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} | Back information, alignment and structure |
|---|
| >d2f3ci1 g.68.1.1 (I:5-50) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} | Back information, alignment and structure |
|---|
| >d1lr7a2 g.68.1.1 (A:89-136) Domain of follistatin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1tgsi_ g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1lr7a1 g.3.11.3 (A:64-88) Domain of follistatin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1nuba2 g.3.11.3 (A:53-77) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2busa_ g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1hpta_ g.68.1.1 (A:) Secretory trypsin inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7kb1 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} | Back information, alignment and structure |
|---|
| >d1pcea_ g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|