Psyllid ID: psy11318


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260---
MRYYCNACSKNFSAKDTLNKHMDIHKGVRYQCEECPKDFSTRKYLTQHQNAIHRGIRFQCNKCFRAYKLKKDLLAHTMLEHFGIRHPCSECPKTFASRHSLKNHILKIHKAVLYQCNECSTSKDYLTKRDLRRHMKLHFNGKRYHCTQCSKFYIQESDLMEHMAVHSGVRKLTTGPIKTEQTFGVRELRHVGFPMKTDHWSNQNRTDLRGSGIAPSWISNGIGATTPPSVMGKTKLFRAPDPRFRNALRFRISVPKPKLKPKP
ccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccEccccHHHHHHccccccEEEcccccccEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHccccccccccccccccEEccccHHHHHHHHccccccccccHccccEccccHHHHHHHHcccccccccccccccEccccHHHEHEcHcccccccccHccccEccccHHHHHHHHcccccccccccHccccEccccHHHHHHHHcccccccccccccc
mryycnacsknfsakdtlnkhmdihkgvryqceecpkdfstrKYLTQHQNAIHRGIRFQCNKCFRAYKLKKDLLAHTMLEhfgirhpcsecpktfasRHSLKNHILKIHKAVLYQcnecstskdyltkrdlRRHMklhfngkryhctqcskFYIQESDLMEHMAVHSGvrklttgpikteqtfgvrelrhvgfpmktdhwsnqnrtdlrgsgiapswisngigattppsvmgktklfrapdprfrNALRFrisvpkpklkpkp
mryycnacsknfsakdtlnKHMDIHKGVRYQCEECPKDFSTRKYLTQHQNAIHRGIRFQCNKCFRAYKLKKDLLAHTMLEHFGIRHPCSECPKTFASRHSLKNHILKIHKAVLYQCNECSTSKDYLTKRDLRRHMKLhfngkryhctqCSKFYIQESDLMEHMAVHSGvrklttgpikteqtfgvRELRHVGFpmktdhwsnqnrTDLRGSGIAPSWISNGigattppsvmgKTKLfrapdprfrnalrfrisvpkpklkpkp
MRYYCNACSKNFSAKDTLNKHMDIHKGVRYQCEECPKDFSTRKYLTQHQNAIHRGIRFQCNKCFRAYKLKKDLLAHTMLEHFGIRHPCSECPKTFASRHSLKNHILKIHKAVLYQCNECSTSKDYLTKRDLRRHMKLHFNGKRYHCTQCSKFYIQESDLMEHMAVHSGVRKLTTGPIKTEQTFGVRELRHVGFPMKTDHWSNQNRTDLRGSGIAPSWISNGIGATTPPSVMGKTKLFRAPDPRFRNALRFRISVPKPKLKPKP
**YYCNACSKNFSAKDTLNKHMDIHKGVRYQCEECPKDFSTRKYLTQHQNAIHRGIRFQCNKCFRAYKLKKDLLAHTMLEHFGIRHPCSECPKTFASRHSLKNHILKIHKAVLYQCNECSTSKDYLTKRDLRRHMKLHFNGKRYHCTQCSKFYIQESDLMEHMAVHSGVRKLTTGPIKTEQTFGVRELRHVGFPMKTDHWSN*****LRGSGIAPSWISNGIGA***************************************
MRYYCNACSKNFSAKDTLNKHMDIHKGVRYQCEECPKDFSTRKYLTQHQNAIHRGIRFQCNKCFRAYKLKKDLLAHTMLEHFGIRHPCSECPKTFASRHSLKNHILKIHKAVLYQCNECSTSKDYLTKRDLRRHMKLHFNGKRYHCTQCSKFYIQESDLMEHMAVHSGVRKLTTGPIKTEQTFGVRELRHVGFPMKTDHWSNQNRTDLRGSGIAPSWISNGIGATTPPSVMGKTKLFRAPDPRFRNAL***************
MRYYCNACSKNFSAKDTLNKHMDIHKGVRYQCEECPKDFSTRKYLTQHQNAIHRGIRFQCNKCFRAYKLKKDLLAHTMLEHFGIRHPCSECPKTFASRHSLKNHILKIHKAVLYQCNECSTSKDYLTKRDLRRHMKLHFNGKRYHCTQCSKFYIQESDLMEHMAVHSGVRKLTTGPIKTEQTFGVRELRHVGFPMKTDHWSNQNRTDLRGSGIAPSWISNGIGATTPPSVMGKTKLFRAPDPRFRNALRFRISVPKPKLKPKP
MRYYCNACSKNFSAKDTLNKHMDIHKGVRYQCEECPKDFSTRKYLTQHQNAIHRGIRFQCNKCFRAYKLKKDLLAHTMLEHFGIRHPCSECPKTFASRHSLKNHILKIHKAVLYQCNECSTSKDYLTKRDLRRHMKLHFNGKRYHCTQCSKFYIQESDLMEHMAVHSGVRKLTTGPIKTEQTFGVRELRHVGFPMKTDHWSNQNRTDLRGSGIAPSWISNGIGATTPPSVMGKTKLFRAPDPRFRNALRFRISVPK*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRYYCNACSKNFSAKDTLNKHMDIHKGVRYQCEECPKDFSTRKYLTQHQNAIHRGIRFQCNKCFRAYKLKKDLLAHTMLEHFGIRHPCSECPKTFASRHSLKNHILKIHKAVLYQCNECSTSKDYLTKRDLRRHMKLHFNGKRYHCTQCSKFYIQESDLMEHMAVHSGVRKLTTGPIKTEQTFGVRELRHVGFPMKTDHWSNQNRTDLRGSGIAPSWISNGIGATTPPSVMGKTKLFRAPDPRFRNALRFRISVPKPKLKPKP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query263 2.2.26 [Sep-21-2011]
P08042402 Zinc finger protein 1 OS= yes N/A 0.615 0.402 0.390 1e-22
O75123536 Zinc finger protein 623 O yes N/A 0.619 0.304 0.389 2e-22
Q5RC79407 Zinc finger protein 1 hom no N/A 0.615 0.398 0.390 3e-22
Q6P2D0407 Zinc finger protein 1 hom no N/A 0.623 0.402 0.385 4e-22
Q68DY9489 Zinc finger protein 772 O no N/A 0.612 0.329 0.382 9e-22
Q5R8X1613 Zinc finger protein 665 O no N/A 0.615 0.264 0.366 2e-21
Q7Z340670 Zinc finger protein 551 O no N/A 0.619 0.243 0.372 2e-21
A2T7F4604 Zinc finger and SCAN doma N/A N/A 0.619 0.269 0.374 2e-21
Q9H7R5613 Zinc finger protein 665 O no N/A 0.615 0.264 0.372 2e-21
Q29RZ4425 Zinc finger protein 2 OS= no N/A 0.619 0.383 0.363 3e-21
>sp|P08042|ZFP1_MOUSE Zinc finger protein 1 OS=Mus musculus GN=Zfp1 PE=2 SV=3 Back     alignment and function desciption
 Score =  107 bits (266), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 93/169 (55%), Gaps = 7/169 (4%)

Query: 3   YYCNACSKNFSAKDTLNKHMDIHKGVR-YQCEECPKDFSTRKYLTQHQNAIHRGIR-FQC 60
           + CN C K FS K  L  H  IH G + Y+C+ C K FS +  L +HQ  IH G + F+C
Sbjct: 182 FVCNYCDKTFSFKSLLVSHKRIHTGEKPYECDVCQKTFSHKANLIKHQR-IHTGEKPFEC 240

Query: 61  NKCFRAYKLKKDLLAHTMLEHFGIRHPCSECPKTFASRHSLKNHILKIHKAVL-YQCNEC 119
            +C +A+  + +L+ H         + CSEC KTFA +  L  H  +IH     Y+CNEC
Sbjct: 241 PECGKAFTHQSNLIVHQRAHMEKKPYGCSECGKTFAQKFELTTH-QRIHTGERPYECNEC 299

Query: 120 STSKDYLTKRDLRRHMKLHFNGKRYHCTQCSKFYIQESDLMEHMAVHSG 168
           +  K +  K +L  H K+H   KRY C++C K +IQ S L+ H   H+G
Sbjct: 300 A--KTFFKKSNLIIHQKIHTGEKRYECSECGKSFIQNSQLIIHRRTHTG 346




May be involved in transcriptional regulation.
Mus musculus (taxid: 10090)
>sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 Back     alignment and function description
>sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 Back     alignment and function description
>sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=2 SV=2 Back     alignment and function description
>sp|Q68DY9|ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens GN=ZNF772 PE=2 SV=2 Back     alignment and function description
>sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 Back     alignment and function description
>sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 Back     alignment and function description
>sp|A2T7F4|ZSC12_PONPY Zinc finger and SCAN domain-containing protein 12 OS=Pongo pygmaeus GN=ZSCAN12 PE=3 SV=1 Back     alignment and function description
>sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 Back     alignment and function description
>sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query263
256085594357 zinc finger protein [Schistosoma mansoni 0.638 0.470 0.366 4e-25
353233176 486 putative zinc finger protein [Schistosom 0.692 0.374 0.342 3e-23
256085592 486 zinc finger protein [Schistosoma mansoni 0.692 0.374 0.342 5e-23
395514016 571 PREDICTED: zinc finger protein 79-like [ 0.615 0.283 0.360 2e-22
344269595 834 PREDICTED: zinc finger protein 160-like 0.619 0.195 0.375 2e-22
334350391 495 PREDICTED: zinc finger protein 3 homolog 0.623 0.331 0.374 2e-22
395546223 465 PREDICTED: zinc finger protein 3 homolog 0.623 0.352 0.374 2e-22
281338871 1634 hypothetical protein PANDA_014165 [Ailur 0.619 0.099 0.386 3e-22
432092616 610 Zinc finger protein 300 [Myotis davidii] 0.623 0.268 0.380 3e-22
338710406 873 PREDICTED: zinc finger protein 850-like 0.623 0.187 0.397 7e-22
>gi|256085594|ref|XP_002579002.1| zinc finger protein [Schistosoma mansoni] gi|353233177|emb|CCD80532.1| putative zinc finger protein [Schistosoma mansoni] Back     alignment and taxonomy information
 Score =  120 bits (302), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 63/172 (36%), Positives = 102/172 (59%), Gaps = 4/172 (2%)

Query: 1   MRYYCNACSKNFSAKDTLNKHM-DIHKGVRYQCEECPKDFSTRKYLTQHQNAIHRGIRFQ 59
           ++Y C  C K F+ K  LNKH+  IH+ ++Y C++C  +F+++ YL +H   IH G ++ 
Sbjct: 156 IKYSCVQCYKTFTTKSHLNKHVKSIHEKLKYACDQCSAEFTSKFYLIEHMKVIHEGKKYP 215

Query: 60  CNKCFRAYKLKKDLLAHTMLEHFGIRHPCSECPKTFASRHSLKNHILKIHKAVLYQCNEC 119
           C +C + +  K +L  H  + H GIR  C+ C K FA + +L  H   IH+ + Y CN C
Sbjct: 216 CYQCDKNFSSKCNLNIHVKVIHQGIRFICNVCNKQFAFKGNLDRHHKNIHEGIRYACNRC 275

Query: 120 STSKDYLTKRDLRRHMKLHFNGKRYHCTQCSKFYIQESDLMEHM-AVHSGVR 170
              + + TK DL  H+K+   G  Y C QC++ +  +++L EH+ +VH+GVR
Sbjct: 276 --DRKFTTKYDLIGHIKVIHEGTEYRCDQCNRKFTSKANLNEHLRSVHTGVR 325




Source: Schistosoma mansoni

Species: Schistosoma mansoni

Genus: Schistosoma

Family: Schistosomatidae

Order: Strigeidida

Class: Trematoda

Phylum: Platyhelminthes

Superkingdom: Eukaryota

>gi|353233176|emb|CCD80531.1| putative zinc finger protein [Schistosoma mansoni] Back     alignment and taxonomy information
>gi|256085592|ref|XP_002579001.1| zinc finger protein [Schistosoma mansoni] Back     alignment and taxonomy information
>gi|395514016|ref|XP_003761217.1| PREDICTED: zinc finger protein 79-like [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|344269595|ref|XP_003406635.1| PREDICTED: zinc finger protein 160-like [Loxodonta africana] Back     alignment and taxonomy information
>gi|334350391|ref|XP_003342344.1| PREDICTED: zinc finger protein 3 homolog [Monodelphis domestica] Back     alignment and taxonomy information
>gi|395546223|ref|XP_003774989.1| PREDICTED: zinc finger protein 3 homolog [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|281338871|gb|EFB14455.1| hypothetical protein PANDA_014165 [Ailuropoda melanoleuca] Back     alignment and taxonomy information
>gi|432092616|gb|ELK25154.1| Zinc finger protein 300 [Myotis davidii] Back     alignment and taxonomy information
>gi|338710406|ref|XP_001502610.3| PREDICTED: zinc finger protein 850-like [Equus caballus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query263
UNIPROTKB|I3LIM1411 ZFP1 "Uncharacterized protein" 0.615 0.394 0.396 1.2e-28
UNIPROTKB|F1MTX5415 ZFP1 "Uncharacterized protein" 0.615 0.390 0.396 1.2e-28
UNIPROTKB|J9NWH3660 ZNF304 "Uncharacterized protei 0.612 0.243 0.394 1.4e-28
UNIPROTKB|J9NVG4409 J9NVG4 "Uncharacterized protei 0.612 0.393 0.4 1.9e-28
MGI|MGI:99154402 Zfp1 "zinc finger protein 1" [ 0.615 0.402 0.390 1.9e-28
UNIPROTKB|F1MB05465 F1MB05 "Uncharacterized protei 0.619 0.350 0.377 2e-28
UNIPROTKB|E2RSM6405 ZFP1 "Uncharacterized protein" 0.615 0.4 0.390 2.4e-28
UNIPROTKB|E7ENV5496 ZNF623 "Zinc finger protein 62 0.619 0.328 0.389 2.8e-28
UNIPROTKB|F1N691253 ZNF184 "Zinc finger protein 18 0.612 0.636 0.385 3.9e-28
UNIPROTKB|J3KNQ1374 ZFP1 "Zinc finger protein 1 ho 0.615 0.433 0.390 3.9e-28
UNIPROTKB|I3LIM1 ZFP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 319 (117.4 bits), Expect = 1.2e-28, P = 1.2e-28
 Identities = 67/169 (39%), Positives = 93/169 (55%)

Query:     3 YYCNACSKNFSAKDTLNKHMDIHKGVR-YQCEECPKDFSTRKYLTQHQNAIHRGIR-FQC 60
             + CN C K FS K  L  H  IH G + Y+C  C K FS +  L +HQ  IH G + F+C
Sbjct:   188 FICNYCDKAFSFKSLLISHKRIHTGEKPYECNVCKKTFSHKANLIKHQR-IHTGEKPFEC 246

Query:    61 NKCFRAYKLKKDLLAHTMLEHFGIRHPCSECPKTFASRHSLKNHILKIHKAVL-YQCNEC 119
              +C +A+  + +L+ H         + CSEC KTFA +  L  H  +IH     Y+CNEC
Sbjct:   247 LECGKAFTHQSNLIVHQRAHMEKKPYECSECGKTFAQKFELTTH-QRIHTGERPYECNEC 305

Query:   120 STSKDYLTKRDLRRHMKLHFNGKRYHCTQCSKFYIQESDLMEHMAVHSG 168
             +  K +  K +L  H K+H   KRY C++C K +IQ S L+ HM  H+G
Sbjct:   306 A--KTFFKKSNLIIHQKIHTGEKRYECSECGKSFIQNSQLIIHMRTHTG 352


GO:0008270 "zinc ion binding" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
UNIPROTKB|F1MTX5 ZFP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9NWH3 ZNF304 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NVG4 J9NVG4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:99154 Zfp1 "zinc finger protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MB05 F1MB05 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RSM6 ZFP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E7ENV5 ZNF623 "Zinc finger protein 623" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1N691 ZNF184 "Zinc finger protein 184" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J3KNQ1 ZFP1 "Zinc finger protein 1 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 263
KOG2462|consensus279 99.97
KOG2462|consensus279 99.96
KOG1074|consensus958 99.95
KOG3608|consensus467 99.9
KOG3623|consensus1007 99.9
KOG3608|consensus467 99.88
KOG1074|consensus958 99.88
KOG3623|consensus1007 99.84
KOG3576|consensus267 99.77
KOG3576|consensus267 99.74
PLN03086567 PRLI-interacting factor K; Provisional 99.44
PLN03086567 PRLI-interacting factor K; Provisional 99.31
PHA00733128 hypothetical protein 99.15
PHA00733128 hypothetical protein 99.12
KOG3993|consensus500 99.09
PHA0276855 hypothetical protein; Provisional 99.08
PHA0276855 hypothetical protein; Provisional 98.98
KOG3993|consensus500 98.64
PHA0073279 hypothetical protein 98.63
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.55
PHA0061644 hypothetical protein 98.52
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.52
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.41
PHA0061644 hypothetical protein 98.41
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.35
PHA0073279 hypothetical protein 98.28
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.18
KOG2231|consensus 669 98.13
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.99
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.94
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.94
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.9
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.73
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.72
COG5236493 Uncharacterized conserved protein, contains RING Z 97.57
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.57
COG5189423 SFP1 Putative transcriptional repressor regulating 97.56
KOG1146|consensus 1406 97.56
COG5189423 SFP1 Putative transcriptional repressor regulating 97.54
smart0035526 ZnF_C2H2 zinc finger. 97.36
KOG2231|consensus 669 97.19
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 97.14
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.07
KOG1146|consensus 1406 97.06
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 97.04
smart0035526 ZnF_C2H2 zinc finger. 96.97
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.95
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.93
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.78
COG5236493 Uncharacterized conserved protein, contains RING Z 96.7
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.53
KOG2785|consensus390 96.45
PRK04860160 hypothetical protein; Provisional 96.31
KOG2785|consensus390 96.15
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.1
PRK04860160 hypothetical protein; Provisional 95.94
COG5048467 FOG: Zn-finger [General function prediction only] 95.53
KOG2482|consensus423 95.46
KOG2893|consensus 341 95.43
KOG2482|consensus423 95.33
KOG4173|consensus253 95.13
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 94.97
COG5048467 FOG: Zn-finger [General function prediction only] 94.78
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 94.21
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 94.2
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 94.19
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 94.07
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 94.04
KOG2893|consensus341 94.01
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 93.22
KOG2186|consensus276 92.78
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 92.73
PF1371736 zinc_ribbon_4: zinc-ribbon domain 92.59
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 92.44
PF09986214 DUF2225: Uncharacterized protein conserved in bact 92.07
COG404965 Uncharacterized protein containing archaeal-type C 91.92
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 91.69
KOG4173|consensus253 91.54
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 90.51
COG404965 Uncharacterized protein containing archaeal-type C 90.07
PF1371937 zinc_ribbon_5: zinc-ribbon domain 89.6
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 87.74
PF06524314 NOA36: NOA36 protein; InterPro: IPR010531 This fam 87.71
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 86.26
PF06524314 NOA36: NOA36 protein; InterPro: IPR010531 This fam 85.73
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 85.15
smart00531147 TFIIE Transcription initiation factor IIE. 85.14
COG1592166 Rubrerythrin [Energy production and conversion] 83.19
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 82.52
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 82.14
PF1526954 zf-C2H2_7: Zinc-finger 82.11
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 82.0
PRK00464154 nrdR transcriptional regulator NrdR; Validated 81.95
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 81.66
PF09986214 DUF2225: Uncharacterized protein conserved in bact 81.35
smart0073426 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18 81.24
>KOG2462|consensus Back     alignment and domain information
Probab=99.97  E-value=5e-31  Score=202.11  Aligned_cols=134  Identities=28%  Similarity=0.554  Sum_probs=99.3

Q ss_pred             ccccCCCccccCChhHHHHHHHHhcCC---CceecccccccccchHHHHHHHHHhcCCCcccCCcCCCcCCCHHHHHHHH
Q psy11318         29 RYQCEECPKDFSTRKYLTQHQNAIHRG---IRFQCNKCFRAYKLKKDLLAHTMLEHFGIRHPCSECPKTFASRHSLKNHI  105 (263)
Q Consensus        29 ~~~C~~C~~~f~~~~~l~~H~~~~~~~---~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~  105 (263)
                      .|+|..||+.|.+..+|-+|..+|...   +.+.|..|++.|.+...|..|++.|.  .+.+|.+||+.|.+.+.|+.|+
T Consensus       130 r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHi  207 (279)
T KOG2462|consen  130 RYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHI  207 (279)
T ss_pred             ceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhccc
Confidence            567777777777777777777665432   23666666666666666666665555  4577888888888888888888


Q ss_pred             HHhcCCccccCCCCCCCcccCCHHHHHHHHHHhCCCCCccCCcchhhhcChHHHHHHHhhc
Q psy11318        106 LKIHKAVLYQCNECSTSKDYLTKRDLRRHMKLHFNGKRYHCTQCSKFYIQESDLMEHMAVH  166 (263)
Q Consensus       106 ~~~~~~~~~~C~~C~~~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h  166 (263)
                      |.|+|||||.|+.|+  ++|...++|+.|+.+|.+.|+|.|..|++.|++.+-|.+|...-
T Consensus       208 RTHTGEKPF~C~hC~--kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES~  266 (279)
T KOG2462|consen  208 RTHTGEKPFSCPHCG--KAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSESA  266 (279)
T ss_pred             ccccCCCCccCCccc--chhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhhc
Confidence            888888888888888  88888888888888888888888888888888888888886543



>KOG2462|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PF15269 zf-C2H2_7: Zinc-finger Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query263
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 7e-17
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 1e-07
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 1e-05
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 7e-05
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 5e-05
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 1e-04
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 6e-05
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 4e-04
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 6e-05
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 1e-04
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 3e-04
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 3e-04
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 3e-04
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 4e-04
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 4e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 84.0 bits (206), Expect = 7e-17, Method: Compositional matrix adjust. Identities = 54/170 (31%), Positives = 83/170 (48%), Gaps = 5/170 (2%) Query: 3 YYCNACSKNFSAKDTLNKHMDIHKGVR-YQCEECPKDFSTRKYLTQHQNAIHRGIR-FQC 60 Y C C K+FS D L +H H G + Y+C EC K FS +K LT+HQ H G + ++C Sbjct: 22 YACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQR-THTGEKPYKC 80 Query: 61 NKCFRAYKLKKDLLAHTMLEHFGIRHPCSECPKTFASRHSLKNHILKIHKAVLYQCNECS 120 +C +++ + +L AH + C EC K+F+ L+ H Y+C EC Sbjct: 81 PECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPEC- 139 Query: 121 TSKDYLTKRDLRRHMKLHFNGKRYHCTQCSKFYIQESDLMEHMAVHSGVR 170 K + + +L H + H K Y C +C K + + L H H+G + Sbjct: 140 -GKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTHTGKK 188
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query263
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-23
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-19
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 7e-18
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-14
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-11
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-16
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-16
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-11
1tf6_A190 Protein (transcription factor IIIA); complex (tran 8e-15
1tf6_A190 Protein (transcription factor IIIA); complex (tran 6e-09
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-13
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 8e-08
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 7e-07
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 8e-05
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-12
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 7e-11
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 8e-10
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-08
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-06
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-12
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-10
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-07
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-06
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 5e-12
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 7e-10
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-09
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-06
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-11
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 6e-05
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-11
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-09
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-09
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-08
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 9e-06
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-11
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-10
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-08
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-05
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 4e-11
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 7e-10
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 9e-10
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-05
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 6e-11
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-10
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 9e-10
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 6e-11
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 8e-08
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-06
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-10
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 8e-08
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 8e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-10
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-05
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-04
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 7e-10
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 4e-06
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 4e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 8e-10
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-08
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 8e-10
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-08
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 8e-07
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-06
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-06
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 8e-04
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-09
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-05
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 6e-05
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 8e-09
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-06
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 9e-09
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-04
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 5e-07
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-05
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 8e-07
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-06
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-05
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 8e-07
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 7e-06
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-06
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-05
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-06
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-06
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 9e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 8e-06
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-04
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-05
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 9e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-05
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-05
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-05
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-05
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-05
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-05
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-05
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-05
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-05
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-05
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-05
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 1e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 5e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 1e-04
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-04
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-04
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 3e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-04
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-04
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 4e-04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-04
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-04
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-04
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-04
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 5e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-04
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 6e-04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-04
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-04
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-04
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-04
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-04
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-04
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-04
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-04
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
 Score = 93.7 bits (234), Expect = 1e-23
 Identities = 58/172 (33%), Positives = 88/172 (51%), Gaps = 13/172 (7%)

Query: 3   YYCNACSKNFSAKDTLNKHMDIHKGVR-YQCEECPKDFSTRKYLTQHQNAIHRGIR-FQC 60
           Y C  C K+FS  D L +H   H G + Y+C EC K FS +K LT+HQ   H G + ++C
Sbjct: 22  YACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQR-THTGEKPYKC 80

Query: 61  NKCFRAYKLKKDLLAHTMLEHFGIR-HPCSECPKTFASRHSLKNHILKIH---KAVLYQC 116
            +C +++  + +L AH    H G + + C EC K+F+    L+ H  + H   K   Y+C
Sbjct: 81  PECGKSFSQRANLRAHQRT-HTGEKPYACPECGKSFSQLAHLRAH-QRTHTGEKP--YKC 136

Query: 117 NECSTSKDYLTKRDLRRHMKLHFNGKRYHCTQCSKFYIQESDLMEHMAVHSG 168
            EC   K +  + +L  H + H   K Y C +C K + +   L  H   H+G
Sbjct: 137 PEC--GKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTHTG 186


>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query263
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 100.0
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.95
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.95
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.92
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.91
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.91
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.91
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.91
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.91
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.91
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.9
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.89
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.89
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.82
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.8
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.8
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.8
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.79
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.79
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.79
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.78
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.77
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.77
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.76
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.76
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.75
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.75
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.74
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.73
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.72
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.72
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.7
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.7
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.7
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.7
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.69
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.67
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.67
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.66
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.62
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.62
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.6
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.59
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.59
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.58
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.57
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.56
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.54
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.54
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.54
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.52
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.51
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.51
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.5
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.5
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.49
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.48
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.48
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.48
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.47
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.47
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.44
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.44
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.43
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.43
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.42
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.42
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.41
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.41
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.38
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.38
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.36
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.35
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.35
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.35
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.32
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.28
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.28
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.25
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.25
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.24
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.23
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.23
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.23
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.23
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.22
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.22
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.22
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.22
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.22
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.22
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.22
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.22
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.22
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.21
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.21
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.21
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.21
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.21
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.21
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.21
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.2
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.2
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.2
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.2
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.2
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.2
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.19
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.19
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.19
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.19
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.18
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.18
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.18
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.18
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.18
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.18
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.16
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.16
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.15
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.14
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.14
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.13
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.13
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.12
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.11
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.1
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.1
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.09
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.09
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.09
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.08
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.08
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.07
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.07
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.07
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.07
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.07
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.06
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.06
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.06
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.06
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.06
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.06
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.05
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.05
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.05
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.05
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.05
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.05
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.04
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.04
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.04
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.04
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.04
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.04
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.04
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.04
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.03
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.03
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.03
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.03
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.01
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.01
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.01
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.01
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.01
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.0
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.0
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.0
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.99
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.98
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.98
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.97
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.97
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.96
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.94
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.93
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.92
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.92
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.91
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.9
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.9
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.9
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.89
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.89
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.89
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.89
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.89
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.88
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.88
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.88
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.88
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.88
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.88
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.88
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.88
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.87
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.87
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.87
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.87
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.87
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.87
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.86
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.86
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.86
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.86
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.85
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.85
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.84
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.83
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.83
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.83
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.83
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.82
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.82
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.82
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.82
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.82
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.8
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.79
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.79
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.79
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.77
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.76
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.75
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.75
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.74
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.74
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.73
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.72
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.72
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.71
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.69
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.67
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.67
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.67
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.62
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.62
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.61
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.58
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.53
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.51
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.5
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.5
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.49
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.49
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.46
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.45
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.45
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.45
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.43
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.43
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.41
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.4
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.39
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.39
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.39
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.39
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.39
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.39
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.38
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.37
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.36
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.35
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.32
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.32
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.65
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.29
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.29
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.29
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.28
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.28
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.28
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.28
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.59
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.26
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.26
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.25
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.24
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.22
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.22
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.21
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.21
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.19
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.19
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.18
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.18
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.18
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.17
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.16
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.46
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.16
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.16
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.15
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.45
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.13
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.42
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.11
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.1
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.1
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.09
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.05
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.05
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.31
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.03
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.02
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.92
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.9
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.87
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.81
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.76
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.66
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 97.51
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.66
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.31
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.11
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.96
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.62
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.53
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 94.95
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 94.47
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 93.9
2k5c_A95 Uncharacterized protein PF0385; structural genomic 93.85
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 91.54
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 90.54
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 90.32
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 89.74
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 88.82
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 87.82
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 86.5
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 86.45
2k9h_A57 Glycoprotein; hantavirus, zinc finger, CCHC, metal 86.07
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 86.03
3h0g_L63 DNA-directed RNA polymerases I, II, and III subuni 85.49
2czr_A226 TBP-interacting protein; tata-binding protein (TBP 85.16
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 84.86
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 84.37
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 83.21
2djr_A76 Zinc finger BED domain-containing protein 2; C2H2 83.08
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 82.37
1twf_L70 ABC10-alpha, DNA-directed RNA polymerases I, II, a 81.48
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 80.88
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=8.7e-40  Score=251.19  Aligned_cols=179  Identities=26%  Similarity=0.440  Sum_probs=103.3

Q ss_pred             HHHHHHHHhhCC-cccccCCCccccCChhHHHHHHHHhcCCCceecccccccccchHHHHHHHHHhcCCCcccCCcCCCc
Q psy11318         16 DTLNKHMDIHKG-VRYQCEECPKDFSTRKYLTQHQNAIHRGIRFQCNKCFRAYKLKKDLLAHTMLEHFGIRHPCSECPKT   94 (263)
Q Consensus        16 ~~L~~H~~~h~~-~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~   94 (263)
                      ..|..|++.+.+ .+|.|++|++.|.+...|..|++.|+++.+|.|..|++.|.+...|..|++.|+++++|.|+.|++.
T Consensus         7 ~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~   86 (190)
T 2i13_A            7 SSSVAQAALEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKS   86 (190)
T ss_dssp             ------------------------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCE
T ss_pred             ccchhhhhhcCCCCCCcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHHHHhcCCCCCccCcccCCc
Confidence            456666666655 3666666666666666666666666666666666666666666666666666666666666666666


Q ss_pred             CCCHHHHHHHHHHhcCCccccCCCCCCCcccCCHHHHHHHHHHhCCCCCccCCcchhhhcChHHHHHHHhhccCCCCCcC
Q psy11318         95 FASRHSLKNHILKIHKAVLYQCNECSTSKDYLTKRDLRRHMKLHFNGKRYHCTQCSKFYIQESDLMEHMAVHSGVRKLTT  174 (263)
Q Consensus        95 f~~~~~l~~H~~~~~~~~~~~C~~C~~~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c  174 (263)
                      |.+...|..|++.|+++++|.|..|+  +.|.+...|..|+++|+++++|.|..|++.|.+...|..|+++|+++++|.|
T Consensus        87 f~~~~~l~~H~~~h~~~~~~~C~~C~--~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C  164 (190)
T 2i13_A           87 FSQRANLRAHQRTHTGEKPYACPECG--KSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKC  164 (190)
T ss_dssp             ESCHHHHHHHHHHHHTCCCEECTTTC--CEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHHHHCCCCEEC
T ss_pred             cCCHHHHHHHHHhcCCCCCCcCCCCC--CccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHHHHHHHHHhcCCCCCeEC
Confidence            66666666666666666666666666  6666666666666666666666666666666666666666666666666666


Q ss_pred             CCCcccccccceeeeccCCCcc
Q psy11318        175 GPIKTEQTFGVRELRHVGFPMK  196 (263)
Q Consensus       175 ~~c~~~~~~~~~l~~H~~~~~~  196 (263)
                      ..|++.|.+...|..|+++|..
T Consensus       165 ~~C~~~f~~~~~L~~H~~~H~~  186 (190)
T 2i13_A          165 PECGKSFSRRDALNVHQRTHTG  186 (190)
T ss_dssp             TTTCCEESSHHHHHHHHTTC--
T ss_pred             CCCCCccCCHHHHHHHHHhcCC
Confidence            6666666666666666666554



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2k9h_A Glycoprotein; hantavirus, zinc finger, CCHC, metal binding protein; NMR {Andes virus} Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>2czr_A TBP-interacting protein; tata-binding protein (TBP), hyperthermophilic archaeon, Zn-finger motif, transcription; 2.30A {Thermococcus kodakarensis} SCOP: c.52.4.1 Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>2djr_A Zinc finger BED domain-containing protein 2; C2H2 type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 263
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 9e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 8e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.001
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.002
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 6e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 8e-04
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 0.002
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 0.003
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 0.004
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.003
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 37.4 bits (86), Expect = 9e-05
 Identities = 14/49 (28%), Positives = 20/49 (40%), Gaps = 2/49 (4%)

Query: 90  ECPKTFASRHSLKNHILKIHKAVLYQCNECSTSKDYLTKRDLRRHMKLH 138
           +C K+F  +     H+        Y C  C   K +  K  L  HMK+H
Sbjct: 7   QCGKSFTHKSQRDRHMSMHLGLRPYGCGVC--GKKFKMKHHLVGHMKIH 53


>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query263
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.62
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.6
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.24
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.21
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.2
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.15
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.14
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.11
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.1
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.08
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.06
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.05
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.04
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.04
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.03
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.03
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.99
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.92
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.91
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.86
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.86
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.85
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.82
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.8
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.8
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.8
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.77
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.75
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.75
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.74
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.73
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.71
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.7
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.64
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.64
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.6
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.58
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.57
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.56
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.54
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.51
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.49
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.44
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.22
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.17
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.13
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.06
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.05
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.95
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.91
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.88
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.87
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.84
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.79
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.78
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.77
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.75
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.72
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.64
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.61
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.61
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.54
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.5
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.48
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.48
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.47
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.46
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.43
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.38
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.35
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.24
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.18
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.13
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.02
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.97
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 96.97
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.95
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.86
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.82
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.82
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.81
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.77
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.74
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.71
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.65
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 96.6
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.55
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.48
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.41
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.03
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.01
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.97
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.94
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.92
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 95.84
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.76
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.72
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.63
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.58
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.48
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 94.94
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.91
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.85
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.81
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 94.07
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.69
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 93.67
d1y0jb136 U-shaped transcription factor, different fingers { 93.5
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 92.88
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 92.48
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 92.16
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 91.58
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 90.28
d1y0jb136 U-shaped transcription factor, different fingers { 89.79
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 89.44
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 89.1
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 89.09
d2ghfa236 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 88.43
d2czra1218 TBP-interacting protein {Thermococcus kodakaraensi 88.41
d2ghfa236 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 88.27
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 87.99
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 87.93
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 87.38
d6rxna_45 Rubredoxin {Desulfovibrio desulfuricans, strain 27 86.79
d1iroa_53 Rubredoxin {Clostridium pasteurianum [TaxId: 1501] 86.33
d1fu9a_36 U-shaped transcription factor, different fingers { 84.55
d1wjpa341 Zinc finger protein 295, ZNF295 {Human (Homo sapie 84.46
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 84.02
d1wjpa341 Zinc finger protein 295, ZNF295 {Human (Homo sapie 82.94
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 82.86
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.62  E-value=1.5e-16  Score=93.13  Aligned_cols=51  Identities=33%  Similarity=0.718  Sum_probs=37.9

Q ss_pred             CCccccccccccCChHHHHHHHHhhCCc-ccccCCCccccCChhHHHHHHHHh
Q psy11318          1 MRYYCNACSKNFSAKDTLNKHMDIHKGV-RYQCEECPKDFSTRKYLTQHQNAI   52 (263)
Q Consensus         1 ~~y~C~~C~~~f~~~~~L~~H~~~h~~~-~~~C~~C~~~f~~~~~l~~H~~~~   52 (263)
                      |+|+| +||+.|..+..|..|+++|+++ ||.|.+||++|.....|..|+++|
T Consensus         2 K~y~C-~Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           2 KLYPC-QCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCEEC-TTSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             cCCCC-CCCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            57777 4777777777777777777774 777777777777777777777653



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2czra1 c.52.4.1 (A:1-218) TBP-interacting protein {Thermococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} Back     information, alignment and structure
>d1iroa_ g.41.5.1 (A:) Rubredoxin {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure