Psyllid ID: psy1135


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120----
MDGSKYYESLAEGMKSQNFTIDFTKPHIKPTLLNVYVFFIILYGVTILSGVALNIFAIYHIIVERLFRDATCGYFINIALADIIKCMFVLPITLMVTLVQNWTWGSFLCYFLPMLQLIPFRIYC
ccccccccHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcHHEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHccccccHHHHHHcccccEEEEEEEEc
ccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEc
MDGSKYYESLAEGmksqnftidftkphikptllNVYVFFIILYGVTILSGVALNIFAIYHIIVERLFRDATCGYFINIALADIIKCMFVLPITLMVTLVQNWTWGSFLCyflpmlqlipfriyc
MDGSKYYESLAEGMKSQNFTIDFTKPHIKPTLLNVYVFFIILYGVTILSGVALNIFAIYHIIVERLFRDATCGYFINIALADIIKCMFVLPITLMVTLVQNWTWGSFLCYFLPMLQLIPFRIYC
MDGSKYYESLAEGMKSQNFTIDFTKPHIKPTLLNVYVFFIILYGVTILSGVALNIFAIYHIIVERLFRDATCGYFINIALADIIKCMFVLPITLMVTLVQNWTWGSFLCYFLPMLQLIPFRIYC
*****************NFTIDFTKPHIKPTLLNVYVFFIILYGVTILSGVALNIFAIYHIIVERLFRDATCGYFINIALADIIKCMFVLPITLMVTLVQNWTWGSFLCYFLPMLQLIPFRIY*
*******ESLAEGMKSQNFTIDFTKPHIKPTLLNVYVFFIILYGVTILSGVALNIFAIYHIIVERLFRDATCGYFINIALADIIKCMFVLPITLMVTLVQNWTWGSFLCYFLPMLQLIPFRIYC
********SLAEGMKSQNFTIDFTKPHIKPTLLNVYVFFIILYGVTILSGVALNIFAIYHIIVERLFRDATCGYFINIALADIIKCMFVLPITLMVTLVQNWTWGSFLCYFLPMLQLIPFRIYC
MDGSKYYESLAEGMKSQNFTIDFTKPHIKPTLLNVYVFFIILYGVTILSGVALNIFAIYHIIVERLFRDATCGYFINIALADIIKCMFVLPITLMVTLVQNWTWGSFLCYFLPMLQLIPFRIYC
ooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHi
ooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHiiii
oooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHiiiii
ooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHi
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDGSKYYESLAEGMKSQNFTIDFTKPHIKPTLLNVYVFFIILYGVTILSGVALNIFAIYHIIVERLFRDATCGYFINIALADIIKCMFVLPITLMVTLVQNWTWGSFLCYFLPMLQLIPFRIYC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query124 2.2.26 [Sep-21-2011]
Q9DDN6 385 Neuropeptide Y receptor t no N/A 0.790 0.254 0.34 6e-07
O02836 382 Neuropeptide Y receptor t yes N/A 0.798 0.259 0.306 1e-06
Q9VNM1 485 Neuropeptide F receptor O no N/A 0.669 0.171 0.329 1e-06
P97295 381 Neuropeptide Y receptor t yes N/A 0.725 0.236 0.354 2e-06
Q9GK74 381 Neuropeptide Y receptor t yes N/A 0.725 0.236 0.354 2e-06
P79113 384 Neuropeptide Y receptor t yes N/A 0.814 0.263 0.327 2e-06
Q5IS62 381 Neuropeptide Y receptor t yes N/A 0.774 0.251 0.333 3e-06
P49146 381 Neuropeptide Y receptor t yes N/A 0.774 0.251 0.333 3e-06
Q9Z2D5 381 Neuropeptide Y receptor t yes N/A 0.774 0.251 0.333 3e-06
Q17239 446 5-hydroxytryptamine recep N/A N/A 0.532 0.147 0.363 8e-06
>sp|Q9DDN6|NPY2R_CHICK Neuropeptide Y receptor type 2 OS=Gallus gallus GN=NPY2R PE=3 SV=1 Back     alignment and function desciption
 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 50/100 (50%), Gaps = 2/100 (2%)

Query: 25  KPHIKP--TLLNVYVFFIILYGVTILSGVALNIFAIYHIIVERLFRDATCGYFINIALAD 82
           KP +K   TL+ V +  I  Y   IL GV  N   I+ II  +  R  T  +  N+A+AD
Sbjct: 41  KPELKDSTTLVEVQIILIFAYCSIILLGVIGNSLVIHVIIKFKSMRTVTNFFIANLAVAD 100

Query: 83  IIKCMFVLPITLMVTLVQNWTWGSFLCYFLPMLQLIPFRI 122
           ++     LP TL+ TL+  W  G  LC+ +P  Q +   +
Sbjct: 101 LLVNTLCLPFTLVYTLLGEWKLGPVLCHLVPYAQALAVHV 140




Receptor for neuropeptide Y and peptide YY.
Gallus gallus (taxid: 9031)
>sp|O02836|NPY2R_PIG Neuropeptide Y receptor type 2 OS=Sus scrofa GN=NPY2R PE=2 SV=2 Back     alignment and function description
>sp|Q9VNM1|NPFR1_DROME Neuropeptide F receptor OS=Drosophila melanogaster GN=NPFR1 PE=1 SV=3 Back     alignment and function description
>sp|P97295|NPY2R_MOUSE Neuropeptide Y receptor type 2 OS=Mus musculus GN=Npy2r PE=2 SV=2 Back     alignment and function description
>sp|Q9GK74|NPY2R_MACMU Neuropeptide Y receptor type 2 OS=Macaca mulatta GN=NPY2R PE=2 SV=1 Back     alignment and function description
>sp|P79113|NPY2R_BOVIN Neuropeptide Y receptor type 2 OS=Bos taurus GN=NPY2R PE=2 SV=1 Back     alignment and function description
>sp|Q5IS62|NPY2R_PANTR Neuropeptide Y receptor type 2 OS=Pan troglodytes GN=NPY2R PE=2 SV=1 Back     alignment and function description
>sp|P49146|NPY2R_HUMAN Neuropeptide Y receptor type 2 OS=Homo sapiens GN=NPY2R PE=2 SV=1 Back     alignment and function description
>sp|Q9Z2D5|NPY2R_CAVPO Neuropeptide Y receptor type 2 OS=Cavia porcellus GN=NPY2R PE=3 SV=1 Back     alignment and function description
>sp|Q17239|5HTR_BOMMO 5-hydroxytryptamine receptor OS=Bombyx mori PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query124
347963708 813 AGAP000383-PA [Anopheles gambiae str. PE 0.887 0.135 0.418 8e-24
195447402 1131 GK25261 [Drosophila willistoni] gi|19416 0.951 0.104 0.434 1e-22
221517146 1008 CG32547, isoform C [Drosophila melanogas 0.951 0.117 0.409 5e-22
56385014 949 G protein coupled receptor [Drosophila m 0.951 0.124 0.409 5e-22
195400919 974 GJ15198 [Drosophila virilis] gi|19414171 0.806 0.102 0.47 2e-21
189234095 445 PREDICTED: similar to AGAP000383-PA [Tri 0.822 0.229 0.460 2e-21
195567529 519 GD15634 [Drosophila simulans] gi|1942047 0.951 0.227 0.409 3e-21
195481344 638 GE15527 [Drosophila yakuba] gi|194189136 0.903 0.175 0.413 1e-20
194766706 889 GF22505 [Drosophila ananassae] gi|190619 0.903 0.125 0.431 1e-20
195130817 945 GI15592 [Drosophila mojavensis] gi|19390 0.951 0.124 0.418 1e-20
>gi|347963708|ref|XP_001688310.2| AGAP000383-PA [Anopheles gambiae str. PEST] gi|333467071|gb|EDO64334.2| AGAP000383-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
 Score =  114 bits (285), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 46/110 (41%), Positives = 73/110 (66%)

Query: 13  GMKSQNFTIDFTKPHIKPTLLNVYVFFIILYGVTILSGVALNIFAIYHIIVERLFRDATC 72
           G K+ +   D++ P++KP +  +Y  FI+LY +    G+ LN+  I +I   +L+RD T 
Sbjct: 26  GEKNYSVNGDYSAPYLKPVVARIYPLFILLYAIPTALGLTLNVMIIVYISKYKLYRDVTH 85

Query: 73  GYFINIALADIIKCMFVLPITLMVTLVQNWTWGSFLCYFLPMLQLIPFRI 122
            + +N+A+   ++C FVLPITLMV ++QNW +G FLC+FLP+LQ IP  +
Sbjct: 86  AFLVNLAVCHCVQCAFVLPITLMVMIIQNWVFGQFLCFFLPLLQDIPLHV 135




Source: Anopheles gambiae str. PEST

Species: Anopheles gambiae

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195447402|ref|XP_002071198.1| GK25261 [Drosophila willistoni] gi|194167283|gb|EDW82184.1| GK25261 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|221517146|ref|NP_728174.2| CG32547, isoform C [Drosophila melanogaster] gi|442616842|ref|NP_001259682.1| CG32547, isoform D [Drosophila melanogaster] gi|220901822|gb|AAX52506.2| CG32547, isoform C [Drosophila melanogaster] gi|440216914|gb|AGB95524.1| CG32547, isoform D [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|56385014|gb|AAP69822.1| G protein coupled receptor [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195400919|ref|XP_002059063.1| GJ15198 [Drosophila virilis] gi|194141715|gb|EDW58132.1| GJ15198 [Drosophila virilis] Back     alignment and taxonomy information
>gi|189234095|ref|XP_967232.2| PREDICTED: similar to AGAP000383-PA [Tribolium castaneum] gi|270002890|gb|EEZ99337.1| hypothetical protein TcasGA2_TC004565 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195567529|ref|XP_002107312.1| GD15634 [Drosophila simulans] gi|194204718|gb|EDX18294.1| GD15634 [Drosophila simulans] Back     alignment and taxonomy information
>gi|195481344|ref|XP_002101612.1| GE15527 [Drosophila yakuba] gi|194189136|gb|EDX02720.1| GE15527 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|194766706|ref|XP_001965465.1| GF22505 [Drosophila ananassae] gi|190619456|gb|EDV34980.1| GF22505 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195130817|ref|XP_002009847.1| GI15592 [Drosophila mojavensis] gi|193908297|gb|EDW07164.1| GI15592 [Drosophila mojavensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query124
FB|FBgn0052547 1008 CG32547 [Drosophila melanogast 0.951 0.117 0.409 3.2e-21
ZFIN|ZDB-GENE-040924-9 372 npy7r "neuropeptide Y receptor 0.782 0.260 0.371 1.3e-10
ZFIN|ZDB-GENE-040924-8 384 npy2r "neuropeptide Y receptor 0.685 0.221 0.352 4.9e-09
UNIPROTKB|Q9DDN6 385 NPY2R "Neuropeptide Y receptor 0.790 0.254 0.34 4.9e-09
UNIPROTKB|Q30D05 385 NPY7R "Uncharacterized protein 0.709 0.228 0.340 1e-08
FB|FBgn0036934 600 sNPF-R "short neuropeptide F r 0.661 0.136 0.304 2.2e-08
UNIPROTKB|F1RYR8 382 NPY2R "Neuropeptide Y receptor 0.75 0.243 0.326 2.8e-08
UNIPROTKB|O02836 382 NPY2R "Neuropeptide Y receptor 0.75 0.243 0.326 2.8e-08
FB|FBgn0037408 485 NPFR1 "neuropeptide F receptor 0.669 0.171 0.329 3.3e-08
ZFIN|ZDB-GENE-980526-208 375 npy8br "neuropeptide Y recepto 0.701 0.232 0.287 5.7e-08
FB|FBgn0052547 CG32547 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 261 (96.9 bits), Expect = 3.2e-21, P = 3.2e-21
 Identities = 50/122 (40%), Positives = 76/122 (62%)

Query:     5 KYYESLAEGMK-SQNFTIDFTK---PHIKPTLLNVYVFFIILYGVTILSGVALNIFAIYH 60
             KY  +L+  +    N T+D  +   P +K ++ +VY  F+I Y    L GV LN+  + +
Sbjct:    66 KYVTALSHFLDWHSNGTVDMERLSGPILKSSIKSVYWLFLIQYAALALLGVVLNVIIVVY 125

Query:    61 IIVERLFRDATCGYFINIALADIIKCMFVLPITLMVTLVQNWTWGSFLCYFLPMLQLIPF 120
             I+  RL++D T  + IN+AL   ++C  VLP++LMV L+QNW +G FLC+FLPMLQ IP 
Sbjct:   126 IMYHRLYKDVTHAFIINLALCHFVQCALVLPVSLMVMLIQNWIFGQFLCFFLPMLQDIPL 185

Query:   121 RI 122
              +
Sbjct:   186 HV 187




GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA;ISS
GO:0008188 "neuropeptide receptor activity" evidence=ISS
GO:0016021 "integral to membrane" evidence=IEA;ISS
GO:0004930 "G-protein coupled receptor activity" evidence=IEA
ZFIN|ZDB-GENE-040924-9 npy7r "neuropeptide Y receptor Y7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040924-8 npy2r "neuropeptide Y receptor Y2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9DDN6 NPY2R "Neuropeptide Y receptor type 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q30D05 NPY7R "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0036934 sNPF-R "short neuropeptide F receptor" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1RYR8 NPY2R "Neuropeptide Y receptor type 2" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|O02836 NPY2R "Neuropeptide Y receptor type 2" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0037408 NPFR1 "neuropeptide F receptor" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-980526-208 npy8br "neuropeptide Y receptor Y8b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query124
PHA03087 335 PHA03087, PHA03087, G protein-coupled chemokine re 0.002
>gnl|CDD|222976 PHA03087, PHA03087, G protein-coupled chemokine receptor-like protein; Provisional Back     alignment and domain information
 Score = 36.3 bits (84), Expect = 0.002
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 2/81 (2%)

Query: 40  IILYGVTILSGVALNIFAIYHIIVERLFRDATCGYFINIALADIIKCMFVLPITLMVTLV 99
           I++Y      G+  NI  IY ++ +   +     Y +N+A++D++  M  LP  +   ++
Sbjct: 44  IVVYSTIFFFGLVGNIIVIY-VLTKTKIKTPMDIYLLNLAVSDLLFVM-TLPFQIYYYIL 101

Query: 100 QNWTWGSFLCYFLPMLQLIPF 120
             W++G F C  +  L  I F
Sbjct: 102 FQWSFGEFACKIVSGLYYIGF 122


Length = 335

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 124
KOG4219|consensus 423 99.78
PHA03234 338 DNA packaging protein UL33; Provisional 99.78
PHA02638 417 CC chemokine receptor-like protein; Provisional 99.58
PHA02834 323 chemokine receptor-like protein; Provisional 99.58
PHA03235 409 DNA packaging protein UL33; Provisional 99.52
KOG4220|consensus 503 99.5
PHA03087 335 G protein-coupled chemokine receptor-like protein; 99.39
PF00001 257 7tm_1: 7 transmembrane receptor (rhodopsin family) 99.24
PF10320 257 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemorecep 98.37
KOG2087|consensus 363 98.1
PF05462 303 Dicty_CAR: Slime mold cyclic AMP receptor 97.59
PF11710 201 Git3: G protein-coupled glucose receptor regulatin 97.58
PF05296 303 TAS2R: Mammalian taste receptor protein (TAS2R); I 97.21
PF10324 318 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemorecept 97.06
PF10328 274 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemorecept 96.51
PF10321 313 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemorecept 95.19
PF10317 292 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemorecept 94.95
PF03402 265 V1R: Vomeronasal organ pheromone receptor family, 91.87
PF00002 242 7tm_2: 7 transmembrane receptor (Secretin family); 90.25
PF01102122 Glycophorin_A: Glycophorin A; InterPro: IPR001195 82.96
>KOG4219|consensus Back     alignment and domain information
Probab=99.78  E-value=2.3e-19  Score=130.18  Aligned_cols=95  Identities=23%  Similarity=0.450  Sum_probs=86.8

Q ss_pred             CCcchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCccCChhHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccccccc
Q psy1135          29 KPTLLNVYVFFIILYGVTILSGVALNIFAIYHIIVERLFRDATCGYFINIALADIIKCMFVLPITLMVTLVQNWTWGSFL  108 (124)
Q Consensus        29 ~~~~~~~~~~~~~~~~~~~~~g~~gN~lvi~~i~~~~~l~~~~~~~l~nLa~aDl~~~~~~~p~~~~~~~~~~w~~g~~~  108 (124)
                      .......+.+..++|+++++++++||++|++++..+|++|+.+|+|++|||+||++++++..|+...+.+.+.|.+|.+.
T Consensus        28 f~lp~~~~~~wai~yg~l~~vAv~GN~iVlwIil~hrrMRtvtnyfL~NLAfADl~~s~Fn~~f~f~yal~~~W~~G~f~  107 (423)
T KOG4219|consen   28 FVLPAWQQALWAIAYGLLVFVAVVGNLIVLWIILAHRRMRTVTNYFLVNLAFADLSMSIFNTVFNFQYALHQEWYFGSFY  107 (423)
T ss_pred             ccCCHHHHHHHHHHHHHHHHHHHhcCceEEEEEeehhehhhhHHHHHHHHHHHHHHHHHHhhHHHHHHHHHhccccccce
Confidence            33345677788999999999999999999999999999999999999999999999999999999998888999999999


Q ss_pred             ccccchhhhhhhccc
Q psy1135         109 CYFLPMLQLIPFRIY  123 (124)
Q Consensus       109 C~~~~~~~~~~~~~S  123 (124)
                      |++..|+......+|
T Consensus       108 C~f~nf~~itav~vS  122 (423)
T KOG4219|consen  108 CRFVNFFPITAVFVS  122 (423)
T ss_pred             eeeccccchhhhhHh
Confidence            999999888776655



>PHA03234 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PHA02638 CC chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA02834 chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA03235 DNA packaging protein UL33; Provisional Back     alignment and domain information
>KOG4220|consensus Back     alignment and domain information
>PHA03087 G protein-coupled chemokine receptor-like protein; Provisional Back     alignment and domain information
>PF00001 7tm_1: 7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature; InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10320 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemoreceptor Srsx; InterPro: IPR019424 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>KOG2087|consensus Back     alignment and domain information
>PF05462 Dicty_CAR: Slime mold cyclic AMP receptor Back     alignment and domain information
>PF11710 Git3: G protein-coupled glucose receptor regulating Gpa2; InterPro: IPR023041 This entry contains a functionally uncharacterised region belonging to the Git3 G-protein coupled receptor Back     alignment and domain information
>PF05296 TAS2R: Mammalian taste receptor protein (TAS2R); InterPro: IPR007960 This family consists of several forms of mammalian taste receptor proteins (TAS2Rs) Back     alignment and domain information
>PF10324 7TM_GPCR_Srw: Serpentine type 7TM GPCR chemoreceptor Srw; InterPro: IPR019427 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10328 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemoreceptor Srx; InterPro: IPR019430 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10321 7TM_GPCR_Srt: Serpentine type 7TM GPCR chemoreceptor Srt; InterPro: IPR019425 Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type [] Back     alignment and domain information
>PF10317 7TM_GPCR_Srd: Serpentine type 7TM GPCR chemoreceptor Srd; InterPro: IPR019421 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF03402 V1R: Vomeronasal organ pheromone receptor family, V1R; InterPro: IPR004072 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF00002 7tm_2: 7 transmembrane receptor (Secretin family); InterPro: IPR000832 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query124
3rze_A 452 Structure Of The Human Histamine H1 Receptor In Com 8e-04
>pdb|3RZE|A Chain A, Structure Of The Human Histamine H1 Receptor In Complex With Doxepin Length = 452 Back     alignment and structure

Iteration: 1

Score = 38.9 bits (89), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 19/73 (26%), Positives = 37/73 (50%) Query: 39 FIILYGVTILSGVALNIFAIYHIIVERLFRDATCGYFINIALADIIKCMFVLPITLMVTL 98 +++ L V LN+ +Y + ER Y +++++AD+I V+P+ ++ L Sbjct: 11 LVVVLSTICLVTVGLNLLVLYAVRSERKLHTVGNLYIVSLSVADLIVGAVVMPMNILYLL 70 Query: 99 VQNWTWGSFLCYF 111 + W+ G LC F Sbjct: 71 MSKWSLGRPLCLF 83

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query124
2ks9_A 364 Substance-P receptor; water, autodock, NK1, neurop 2e-11
4ea3_A 434 Fusion protein of nociceptin receptor and cytochr; 4e-09
3uon_A 467 Human M2 muscarinic acetylcholine, receptor T4 LY 4e-08
2rh1_A 500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 8e-08
4dkl_A 464 MU-type opioid receptor, lysozyme chimera; G-prote 1e-07
3pbl_A 481 D(3) dopamine receptor, lysozyme chimera; structur 3e-07
3rze_A 452 Histamine H1 receptor, lysozyme chimera; structura 4e-07
1u19_A 349 Rhodopsin; G protein-coupled receptor, membrane pr 7e-07
3v2y_A 520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 3e-06
3eml_A 488 Human adenosine A2A receptor/T4 lysozyme chimera; 1e-05
3odu_A 502 C-X-C chemokine receptor type 4, lysozyme chimera; 1e-05
3sn6_R 514 Lysozyme, beta-2 adrenergic receptor; seven transm 2e-05
4eiy_A 447 Adenosine receptor A2A/soluble cytochrome B562 CH; 5e-05
2z73_A 448 Rhodopsin; visual pigment, GQ-type, G-protein coup 9e-05
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Length = 364 Back     alignment and structure
 Score = 58.5 bits (142), Expect = 2e-11
 Identities = 22/104 (21%), Positives = 43/104 (41%), Gaps = 2/104 (1%)

Query: 16  SQNFTIDFTKPHIKPTLLNVYVFFIILYGVTILSGVALNIFAIYHIIVERLFRDATCGYF 75
           S N + + ++P+         V +   Y V +++ V  N+  ++ I+  +  R  T  YF
Sbjct: 12  SPNISTNTSEPNQFVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAHKRMRTVT-NYF 70

Query: 76  I-NIALADIIKCMFVLPITLMVTLVQNWTWGSFLCYFLPMLQLI 118
           + N+A A+     F   +     +   W +G F C F     + 
Sbjct: 71  LVNLAFAEASMAAFNTVVNFTYAVHNEWYYGLFYCKFHNFFPIA 114


>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Length = 467 Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Length = 500 Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Length = 464 Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, protein structure initiative, AC technologies center for gene to 3D structure; HET: ETQ MAL; 2.89A {Homo sapiens} Length = 481 Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Length = 452 Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Length = 349 Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Length = 520 Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Length = 488 Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Length = 502 Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A Length = 514 Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Length = 447 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query124
4grv_A 510 Neurotensin receptor type 1, lysozyme chimera; G-p 99.77
1u19_A 349 Rhodopsin; G protein-coupled receptor, membrane pr 99.76
2ks9_A 364 Substance-P receptor; water, autodock, NK1, neurop 99.75
2rh1_A 500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 99.74
2lnl_A 296 C-X-C chemokine receptor type 1; G protein coupled 99.73
3uon_A 467 Human M2 muscarinic acetylcholine, receptor T4 LY 99.73
3pbl_A 481 D(3) dopamine receptor, lysozyme chimera; structur 99.71
4dkl_A 464 MU-type opioid receptor, lysozyme chimera; G-prote 99.69
3odu_A 502 C-X-C chemokine receptor type 4, lysozyme chimera; 99.66
3rze_A 452 Histamine H1 receptor, lysozyme chimera; structura 99.65
4amj_A 315 Beta-1 adrenergic receptor; membrane protein, 7TMR 99.65
3sn6_R 514 Lysozyme, beta-2 adrenergic receptor; seven transm 99.64
3v2y_A 520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 99.64
3vw7_A 484 Proteinase-activated receptor 1, lysozyme; high re 99.64
4eiy_A 447 Adenosine receptor A2A/soluble cytochrome B562 CH; 99.64
4ea3_A 434 Fusion protein of nociceptin receptor and cytochr; 99.63
3eml_A 488 Human adenosine A2A receptor/T4 lysozyme chimera; 99.63
2z73_A 448 Rhodopsin; visual pigment, GQ-type, G-protein coup 99.62
2lot_A64 Apelin receptor; membrane protein; NMR {Homo sapie 97.52
>4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus} Back     alignment and structure
Probab=99.77  E-value=6e-19  Score=132.56  Aligned_cols=92  Identities=14%  Similarity=0.230  Sum_probs=77.9

Q ss_pred             chhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCcc---CChhHHHHHHHHHHHHHHHHHHHHHHHHHHhh--ccccccc
Q psy1135          32 LLNVYVFFIILYGVTILSGVALNIFAIYHIIVERLF---RDATCGYFINIALADIIKCMFVLPITLMVTLV--QNWTWGS  106 (124)
Q Consensus        32 ~~~~~~~~~~~~~~~~~~g~~gN~lvi~~i~~~~~l---~~~~~~~l~nLa~aDl~~~~~~~p~~~~~~~~--~~w~~g~  106 (124)
                      ....+++..++|.+++++|++||++|++++.+.|++   |+++|+|++|||+||++++++.+|+.+.....  +.|.+|+
T Consensus        28 ~~~~~v~~~~~~~~i~~~g~~gN~lvi~~i~~~~~~r~~~~~~n~~i~~La~aDll~~~~~~p~~~~~~~~~~~~w~~g~  107 (510)
T 4grv_A           28 DIYSKVLVTAIYLALFVVGTVGNSVTLFTLARKKSLQSLQSTVHYHLGSLALSDLLILLLAMPVELYNFIWVHHPWAFGD  107 (510)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSCC----CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTCCSSCSSHH
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHhhhheeeecCCCCCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCEEhhH
Confidence            345667888999999999999999999999887654   58899999999999999999999998887654  4699999


Q ss_pred             ccccccchhhhhhhccc
Q psy1135         107 FLCYFLPMLQLIPFRIY  123 (124)
Q Consensus       107 ~~C~~~~~~~~~~~~~S  123 (124)
                      .+|++..++..++.++|
T Consensus       108 ~~C~~~~~~~~~~~~~S  124 (510)
T 4grv_A          108 AGCRGYYFLRDACTYAT  124 (510)
T ss_dssp             HHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            99999999888877665



>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Back     alignment and structure
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Back     alignment and structure
>2lnl_A C-X-C chemokine receptor type 1; G protein coupled receptor, GPCR, membrane protei transmembrane, 7TM, phospholipid, signaling, signaling PROT; NMR {Homo sapiens} Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, PSI-biology, protein structure initiative; HET: ETQ MAL; 2.89A {Homo sapiens} Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A 4gbr_A* Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Back     alignment and structure
>3vw7_A Proteinase-activated receptor 1, lysozyme; high resolution structure, protease-activated receptor 1, in conformation, antagonist vorapaxar; HET: VPX OLC; 2.20A {Homo sapiens} Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Back     alignment and structure
>2lot_A Apelin receptor; membrane protein; NMR {Homo sapiens} PDB: 2lou_A 2lov_A 2low_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 124
d1u19a_ 348 f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 4e-04
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Length = 348 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Family A G protein-coupled receptor-like
superfamily: Family A G protein-coupled receptor-like
family: Rhodopsin-like
domain: Rhodopsin
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 36.5 bits (83), Expect = 4e-04
 Identities = 14/80 (17%), Positives = 28/80 (35%)

Query: 35  VYVFFIILYGVTILSGVALNIFAIYHIIVERLFRDATCGYFINIALADIIKCMFVLPITL 94
            +        + I+ G  +N   +Y  +  +  R       +N+A+AD+         TL
Sbjct: 36  QFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTL 95

Query: 95  MVTLVQNWTWGSFLCYFLPM 114
             +L   + +G   C     
Sbjct: 96  YTSLHGYFVFGPTGCNLEGF 115


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query124
d1u19a_ 348 Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} 99.73
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Family A G protein-coupled receptor-like
superfamily: Family A G protein-coupled receptor-like
family: Rhodopsin-like
domain: Rhodopsin
species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.73  E-value=5.9e-18  Score=118.76  Aligned_cols=100  Identities=17%  Similarity=0.263  Sum_probs=85.8

Q ss_pred             CCCCCCCCcchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCccCChhHHHHHHHHHHHHHHHHHHHHHHHHHHhhccc
Q psy1135          23 FTKPHIKPTLLNVYVFFIILYGVTILSGVALNIFAIYHIIVERLFRDATCGYFINIALADIIKCMFVLPITLMVTLVQNW  102 (124)
Q Consensus        23 ~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~gN~lvi~~i~~~~~l~~~~~~~l~nLa~aDl~~~~~~~p~~~~~~~~~~w  102 (124)
                      ++.+..+..++..+.+..+++.+++++|++||+++++++.++|++|++.|+++.|||++|++.++...|..+.....+.|
T Consensus        24 ~~~~~~~~~~~~~~~~~~~~~~ii~v~gi~gN~lvi~vi~~~k~lr~~~~~~l~nLaiaDll~~~~~~~~~~~~~~~~~~  103 (348)
T d1u19a_          24 FEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYF  103 (348)
T ss_dssp             TTSCCTTTSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSTTCCSHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHTSC
T ss_pred             CCCCccccccHHHHHHHHHHHHHHHHHHHHHHHHeehhhhccCCCCCHhHHHHHHHHHHHHHHHHHHHHHhhhhhccCcc
Confidence            34444445555567788899999999999999999999999999999999999999999999999999999888888889


Q ss_pred             ccccccccccchhhhhhhcc
Q psy1135         103 TWGSFLCYFLPMLQLIPFRI  122 (124)
Q Consensus       103 ~~g~~~C~~~~~~~~~~~~~  122 (124)
                      ..+...|+...+....+..+
T Consensus       104 ~~~~~~c~~~~~~~~~~~~~  123 (348)
T d1u19a_         104 VFGPTGCNLEGFFATLGGEI  123 (348)
T ss_dssp             TTHHHHHHHHHHHHHHHHHH
T ss_pred             ccCchhhhhhhhccccceee
Confidence            99999999998877666544