Psyllid ID: psy11360

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940
MGKFFLWILPSHCLHLGLMRVILANRITIPGGPFSALTPSMWPQDIISKLNQVPEDPNSQPDYRFDEFGFRVEEEDGPEQNSNKLLSEPFIEDPQHRLQWVAYLEFNSSSANSPGKEESEALTWDNLGVISRTDKLRSMTRQGIPHSLRPQLWLRLSGALEKKALSKIKYQDIVKASSSDALAFAKQIEKDLLRTMPTNACFSTFSSTGVPRLRRILRALAWLFPDIGGVVNALDFGSRGWWFESKRKVKRQKSILQNLIFGEEENGEDIKTKNIHQTGIQADQKVLRSLVASGLPQLEVSLLQHDIELSLITLHWFLTLFASVVHFKILLRIWDLLFLDGSIVLFHSCEPVLVTLENSAEIFNALSDIPGDIVDIDNLLEVGAEIFNALSDIPGDIVDIDNLLEVSFSVSTSISQSLIDSHRRRHLAFLMSDQGALIGNPALSNNLPKQQLNRLGRILRSLFTLAFGCFLGQTAVARQATPARPQILVDLREATCQIGRHFLTTDPRLSHASLTPNYSPESHQSDHDAYADVSRSRQRRAKALLDFERHDDDELGFRKNDVITIISQKDEHCWIGELNGLKGWFPAKFVELLDERSKQYSLAGDDSVTETITDLVRGTLCPALKQILSCGLKRRALGEVCHPWLFIEEVATREVEKDFTSVYSRLLLCKTYRLDEDGKVLTPEELLYRCVQAVNQSHDMAHVQMDVKFRSLICLGLNEQVLHLWLEVLCSCEPVVLKWYHPWSFISSPGWVQVKCDLRVLSQFPFNLSPDWELPPKKGQSQPLKDGVATREVEKDFTSVYSRLLLCKTYRLDEDGKVLTPEELLYRCVQAVNQSHDMAHVQMDVKFRSLICLGLNEQVLHLWLEVLCSCEPVVLKWYHPWSFISSPGWVQVKCDLRVLSQFPFNLSPDWELPPRKGQSQPLKDGVQDMLVKHHLFSWDL
cccEEEEEcccccHHHHHHHHHHHccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccHHccccccccHHHHHHHHHHHHHcccccccccccHHHHcccccccccccHHHHHHHHHcccccccHHHHHHHHHcHHHHHHcccHHHHHHHHHccccccccHHHHHHcccccccccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccccHHHHHHHHHHHHcccccccHHHHHHHHHHHcccEEEHHHHHHHHHccccHHHHHHHHcccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccEEEEEcccccHHHHccccccccccHHHHHHHHHHHccccccccccccHHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHcccccccccccccHHHHHHHHHHHHHHccccccccccccEEEEEEEccccHHHHHHHHHHHccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccHHHHHHHccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcccccccccccccEEEEEcccccHHHHHHHHHHHHcccHHHHHHccccccccccccEEEccccccccccccccccccccccccccccccHHHHHHHHHHHccccccc
cccEEEEEcccHHHHHHHHHHHcccccccccccccccccccccHHHHHHcccccccccccccccccccccEEccccccccccccccccccccccccccHHHHHHHccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccHHHHHHHHHHHccccccHHHccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHccccEEEEEHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHEEcccccccccHHHcccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccEEccccHHHHHHHHHccccHEEEEEccccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEcccccHHHHHHHHHHHHHHHHcHHcEEEEcccEccccccEccEccccEEEEEEcccccEEEEEEccEEEEEEHHHEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHEEEHccEEccccccEccHHHHHHHHHHHHHccccccccHHcHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHcccHHHHcccccEEEEEHHHHHHHccEcccccccccccHccccccHcccccHHHHHHHHHHHHHHEEEccEEccccccEccHHHHHHHHHHHHHHcccHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHcccHHHHcccccEEEEEHHHHHHHccccccccccccccccccccHHHHHHHHHHHHccEcccc
mgkfflwilpshclHLGLMRVILAnritipggpfsaltpsmwpqdIISKlnqvpedpnsqpdyrfdefgfrveeedgpeqnsnkllsepfiedpqHRLQWVAYLEfnsssanspgkeesealtwdnlgviSRTDKlrsmtrqgiphslrpQLWLRLSGALEKKALSKIKYQDIVKASSSDALAFAKQIEKDLLrtmptnacfstfsstgvPRLRRILRALAWLfpdiggvvnaldfgsrgwwfesKRKVKRQKSILQNLifgeeengediktknihqtGIQADQKVLRSLVASGLPQLEVSLLQHDIELSLITLHWFLTLFASVVHFKILLRIWDLLfldgsivlfhscepVLVTLENSAEIFNalsdipgdivdiDNLLEVGAEIFNAlsdipgdivdidNLLEVSFSVSTSISQSLIDSHRRRHLAFLMSDqgalignpalsnnlpkqQLNRLGRILRSLFTLAFGCFLGqtavarqatparpQILVDLREATCQIGrhflttdprlshasltpnyspeshqsdhdayADVSRSRQRRAKALLDferhdddelgfrknDVITIISQkdehcwigelnglkgwfpAKFVELLDERSkqyslagddsvTETITDLVRGTLCPALKQILSCGLkrralgevchpwlFIEEVATREVEKDFTSVYSRLLLCKtyrldedgkvltpeeLLYRCVQAVNQSHDMAHVQMDVKFRSLICLGLNEQVLHLWLEVLCscepvvlkwyhpwsfisspgwvqvkCDLRvlsqfpfnlspdwelppkkgqsqplkdgvatrevEKDFTSVYSRLLLCKtyrldedgkvltpeeLLYRCVQAVNQSHDMAHVQMDVKFRSLICLGLNEQVLHLWLEVLCscepvvlkwyhpwsfisspgwvqvkCDLRvlsqfpfnlspdwelpprkgqsqplkdgVQDMLVKHHLFSWDL
MGKFFLWILPSHCLHLGLMRVILANRITIPGGPFSALTPSMWPQDIISKLNQVPEDPNSQPDYRFDEFGFRVEEEDGPEQNSNKLLSEPFIEDPQHRLQWVAYLEFNSSsanspgkeesealtwdnlGVISRTDKLRsmtrqgiphslrpqlWLRLSGALEKKALSKIKYQDIVKASSSDALAFAKQIEKDLLRTMPTNACfstfsstgvprLRRILRALAWLFPDIGGVVNALDFGSRGWWFESKRKVKRQKSILQnlifgeeengediKTKNIHQTGIQADQKVLRSLVASGLPQLEVSLLQHDIELSLITLHWFLTLFASVVHFKILLRIWDLLFLDGSIVLFHSCEPVLVTLENSAEIFNALSDIPGDIVDIDNLLEVGAEIFNALSDIPGDIVDIDNLLEVSFSVSTSISQSLIDSHRRRHLAFLMSDQGALIGNPALSNNLPKQQLNRLGRILRSLFTLAFGCFLGQTAVARQATPARPQILVDLREATCQIGRHflttdprlshASLTpnyspeshqsdHDAYADVSRSRQRRAKALLdferhdddelgfrkNDVITIISQKDEHCWIGELNGLKGWFPAKFVELLDERSKQyslagddsVTETITDLVRGTLCPALKQILSCGLKRRALGEVCHPWLFIEEVatrevekdftSVYSRLLLCKTYRLDEDGKVLTPEELLYRCVQAVNQSHDMAHVQMDVKFRSLICLGLNEQVLHLWLEVLCSCEPVVLKWYHPWSFISSPGWVQVKCDLRVLSQFPFnlspdwelppkkgqsqplkdgvatrevekdftsVYSRLLLCKTYRLDEDGKVLTPEELLYRCVQAVNQSHDMAHVQMDVKFRSLICLGLNEQVLHLWLEVLCSCEPVVLKWYHPWSFISSPGWVQVKCDLRVLSQFPFnlspdwelppRKGQSQPLKDGVQDMLVKHHLFSWDL
MGKFFLWILPSHCLHLGLMRVILANRITIPGGPFSALTPSMWPQDIISKLNQVPEDPNSQPDYRFDEFGFRVEEEDGPEQNSNKLLSEPFIEDPQHRLQWVAYLEFNSSSANSPGKEESEALTWDNLGVISRTDKLRSMTRQGIPHSLRPQLWLRLSGALEKKALSKIKYQDIVKASSSDALAFAKQIEKDLLRTMPTNACFSTFSSTGVPrlrrilralawlFPDIGGVVNALDFGSRGWWFESKRKVKRQKSILQNLIFGEEENGEDIKTKNIHQTGIQADQKVLRSLVASGLPQLEVSLLQHDIELSLITLHWFLTLFASVVHFKILLRIWDLLFLDGSIVLFHSCEPVLVTLENSAEIFNALSDIPGDIVDIDNLLEVGAEIFNALSDIPGDIVDIDNLLEVsfsvstsisqslidsHRRRHLAFLMSDQGALIGNPALSNNLPKQQLNRLGRILRSLFTLAFGCFLGQTAVARQATPARPQILVDLREATCQIGRHFLTTDPRLSHASLTPNYSPESHQSDHDAYADVSRSRQRRAKALLDFERHDDDELGFRKNDVITIISQKDEHCWIGELNGLKGWFPAKFVELLDERSKQYSLAGDDSVTETITDLVRGTLCPALKQILSCGLKRRALGEVCHPWLFIEEVATREVEKDFTSVYSRLLLCKTYRLDEDGKVLTPEELLYRCVQAVNQSHDMAHVQMDVKFRSLICLGLNEQVLHLWLEVLCSCEPVVLKWYHPWSFISSPGWVQVKCDLRVLSQFPFNLSPDWELPPKKGQSQPLKDGVATREVEKDFTSVYSRLLLCKTYRLDEDGKVLTPEELLYRCVQAVNQSHDMAHVQMDVKFRSLICLGLNEQVLHLWLEVLCSCEPVVLKWYHPWSFISSPGWVQVKCDLRVLSQFPFNLSPDWELPPRKGQSQPLKDGVQDMLVKHHLFSWDL
***FFLWILPSHCLHLGLMRVILANRITIPGGPFSALTPSMWPQDIIS***********************************************HRLQWVAYLEF***************LTWDNLGVISRT*********GIPHSLRPQLWLRLSGALEKKALSKIKYQDIVKASSSDALAFAKQIEKDLLRTMPTNACFSTFSSTGVPRLRRILRALAWLFPDIGGVVNALDFGSRGWWFESKRKVKRQKSILQNLIFGEE*****IKTKNIHQTGIQADQKVLRSLVASGLPQLEVSLLQHDIELSLITLHWFLTLFASVVHFKILLRIWDLLFLDGSIVLFHSCEPVLVTLENSAEIFNALSDIPGDIVDIDNLLEVGAEIFNALSDIPGDIVDIDNLLEVSFSVSTSISQSLIDSHRRRHLAFLMSDQGALIGNPALSNNLPKQQLNRLGRILRSLFTLAFGCFLGQTAVARQATPARPQILVDLREATCQIGRHFLTT***********************************************DELGFRKNDVITIISQKDEHCWIGELNGLKGWFPAKFVELLDERSKQYSLAGDDSVTETITDLVRGTLCPALKQILSCGLKRRALGEVCHPWLFIEEVATREVEKDFTSVYSRLLLCKTYRLDEDGKVLTPEELLYRCVQAVNQSHDMAHVQMDVKFRSLICLGLNEQVLHLWLEVLCSCEPVVLKWYHPWSFISSPGWVQVKCDLRVLSQFPFNLSPDW********************VEKDFTSVYSRLLLCKTYRLDEDGKVLTPEELLYRCVQAVNQSHDMAHVQMDVKFRSLICLGLNEQVLHLWLEVLCSCEPVVLKWYHPWSFISSPGWVQVKCDLRVLSQFPFNLSPDW*******************LVKHHLF****
*GKFFLWILPSHCLHLG*************************************************EFGFRVEE*************************WVAYLEF**********EESEALTWDNLGVISRTDKLRSMTRQGIPHSLRPQLWLRLSGALEKKALSKIKYQDIVKA*********KQIEKDLLRTMPTNACFSTFSSTGVPRLRRILRALAWLFPDIGGVVNALDFGSRGWWFESKRKVKRQKSILQNLIFGEEENGEDIKTKNIHQTGIQADQKVLRSLVASGLPQLEVSLLQHDIELSLITLHWFLTLFASVVHFKILLRIWDLLFLDGSIVLFHSCEPVLVTLENSAEIFNALSDIPGDIVDIDNLL***************DIVDIDNLLEVSFS*************RRR*******************************************************************************************************************AKALLDFERHDDDELGFRKNDVITIISQKDEHCWIGELNGLKGWFPA*************************TDLVRGTLCPALKQILSCGLKRRALGEVCHPWLFIEEVATREVEKDFTSVYSRLLLCKTYRLDEDGKVLTPEELLYRCVQAVNQSHDM****MDVKFRSLICLGLNEQVLHLWLEVLCSCEPVVLKWYHPWSFISSPGWVQVKCDLRVLSQFPFNLSPDW***********************DFTSVYSRLLLCKTYRLDEDGKVLTPEELLYRCVQAVNQSHDMAHVQMDVKFRSLICLGLNEQVLHLWLEVLCSCEPVVLKWYHPWSFISSPGWVQVKCDLRVLSQFPFNLSPD****************VQDMLVKHHLFSWDL
MGKFFLWILPSHCLHLGLMRVILANRITIPGGPFSALTPSMWPQDIISKLNQVPEDPNSQPDYRFDEFGFRVE*********NKLLSEPFIEDPQHRLQWVAYLEFNS************ALTWDNLGVISRTDKLRSMTRQGIPHSLRPQLWLRLSGALEKKALSKIKYQDIVKASSSDALAFAKQIEKDLLRTMPTNACFSTFSSTGVPRLRRILRALAWLFPDIGGVVNALDFGSRGWWFESKRKVKRQKSILQNLIFGEEENGEDIKTKNIHQTGIQADQKVLRSLVASGLPQLEVSLLQHDIELSLITLHWFLTLFASVVHFKILLRIWDLLFLDGSIVLFHSCEPVLVTLENSAEIFNALSDIPGDIVDIDNLLEVGAEIFNALSDIPGDIVDIDNLLEVSFSVSTSISQSLIDSHRRRHLAFLMSDQGALIGNPALSNNLPKQQLNRLGRILRSLFTLAFGCFLGQTAVARQATPARPQILVDLREATCQIGRHFLTTDPRLSHASLT**********************QRRAKALLDFERHDDDELGFRKNDVITIISQKDEHCWIGELNGLKGWFPAKFVELLDERSKQYSLAGDDSVTETITDLVRGTLCPALKQILSCGLKRRALGEVCHPWLFIEEVATREVEKDFTSVYSRLLLCKTYRLDEDGKVLTPEELLYRCVQAVNQSHDMAHVQMDVKFRSLICLGLNEQVLHLWLEVLCSCEPVVLKWYHPWSFISSPGWVQVKCDLRVLSQFPFNLSPDWELP*************ATREVEKDFTSVYSRLLLCKTYRLDEDGKVLTPEELLYRCVQAVNQSHDMAHVQMDVKFRSLICLGLNEQVLHLWLEVLCSCEPVVLKWYHPWSFISSPGWVQVKCDLRVLSQFPFNLSPDWELP*********KDGVQDMLVKHHLFSWDL
*GKFFLWILPSHCLHLGLMRVILANRIT**GGPFSALTPSMWP*****KLN********QPDYRFDEFGFRVEEE**********LSEPFIEDPQHRLQWVAYLEFNSSSANSPGKEESEALTWDNLGVISRTDKLRSMTRQGIPHSLRPQLWLRLSGALEKKALSKIKYQDIVKASSSDALAFAKQIEKDLLRTMPTNACFSTFSSTGVPRLRRILRALAWLFPDIGGVVNALDFGSRGWWFESKRKVKRQKSILQNLIFGEEENGEDIKTKNIHQTGIQADQKVLRSLVASGLPQLEVSLLQHDIELSLITLHWFLTLFASVVHFKILLRIWDLLFLDGSIVLFHSCEPVLVTLENSAEIFNALSDIPGDIVDIDNLLEVGAEIFNALSDIPGDIVDIDNLLEVSFSVSTSISQSLIDSHRRRHLAFLMSDQGALIGNPALSNNLPKQQLNRLGRILRSLFTLAFGCFLGQTAVARQATPARPQILVDLREATCQIGRHFLTTDPRLSHASLTPNYSPESHQSDHDAYADVSRSRQRRAKALLDFERHDDDELGFRKNDVITIISQKDEHCWIGELNGLKGWFPAKFVELLDERSKQYSLAGDDSVTETITDLVRGTLCPALKQILSCGLKRRALGEVCHPWLFIEEVATREVEKDFTSVYSRLLLCKTYRLDEDGKVLTPEELLYRCVQAVNQSHDMAHVQMDVKFRSLICLGLNEQVLHLWLEVLCSCEPVVLKWYHPWSFISSPGWVQVKCDLRVLSQFPFNLSPDWELPPKKGQSQPLKDGVATREVEKDFTSVYSRLLLCKTYRLDEDGKVLTPEELLYRCVQAVNQSHDMAHVQMDVKFRSLICLGLNEQVLHLWLEVLCSCEPVVLKWYHPWSFISSPGWVQVKCDLRVLSQFPFNLSPDWELPPRKGQSQPLKDGVQDMLVKHHLFSWDL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKFFLWILPSHCLHLGLMRVILANRITIPGGPFSALTPSMWPQDIISKLNQVPEDPNSQPDYRFDEFGFRVEEEDGPEQNSNKLLSEPFIEDPQHRLQWVAYLEFNSSSANSPGKEESEALTWDNLGVISRTDKLRSMTRQGIPHSLRPQLWLRLSGALEKKALSKIKYQDIVKASSSDALAFAKQIEKDLLRTMPTNACFSTFSSTGVPRLRRILRALAWLFPDIGGVVNALDFGSRGWWFESKRKVKRQKSILQNLIFGEEENGEDIKTKNIHQTGIQADQKVLRSLVASGLPQLEVSLLQHDIELSLITLHWFLTLFASVVHFKILLRIWDLLFLDGSIVLFHSCEPVLVTLENSAEIFNALSDIPGDIVDIDNLLEVGAEIFNALSDIPGDIVDIDNLLEVSFSVSTSISQSLIDSHRRRHLAFLMSDQGALIGNPALSNNLPKQQLNRLGRILRSLFTLAFGCFLGQTAVARQATPARPQILVDLREATCQIGRHFLTTDPRLSHASLTPNYSPESHQSDHDAYADVSRSRQRRAKALLDFERHDDDELGFRKNDVITIISQKDEHCWIGELNGLKGWFPAKFVELLDERSKQYSLAGDDSVTETITDLVRGTLCPALKQILSCGLKRRALGEVCHPWLFIEEVATREVEKDFTSVYSRLLLCKTYRLDEDGKVLTPEELLYRCVQAVNQSHDMAHVQMDVKFRSLICLGLNEQVLHLWLEVLCSCEPVVLKWYHPWSFISSPGWVQVKCDLRVLSQFPFNLSPDWELPPKKGQSQPLKDGVATREVEKDFTSVYSRLLLCKTYRLDEDGKVLTPEELLYRCVQAVNQSHDMAHVQMDVKFRSLICLGLNEQVLHLWLEVLCSCEPVVLKWYHPWSFISSPGWVQVKCDLRVLSQFPFNLSPDWELPPRKGQSQPLKDGVQDMLVKHHLFSWDL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query940 2.2.26 [Sep-21-2011]
A6H8I2753 Small G protein signaling N/A N/A 0.765 0.956 0.566 0.0
Q96HU1749 Small G protein signaling yes N/A 0.743 0.933 0.547 0.0
Q7T2D0755 Small G protein signaling yes N/A 0.75 0.933 0.550 0.0
Q2KI13747 Small G protein signaling yes N/A 0.755 0.950 0.539 0.0
Q8VCZ6750 Small G protein signaling yes N/A 0.758 0.950 0.538 0.0
Q6P6R7749 Small G protein signaling yes N/A 0.757 0.950 0.536 0.0
B1AVH7922 TBC1 domain family member no N/A 0.267 0.272 0.297 1e-24
P53258950 GTPase-activating protein yes N/A 0.234 0.231 0.312 1e-23
A6QP29925 TBC1 domain family member no N/A 0.264 0.269 0.285 2e-23
B5DFA1924 TBC1 domain family member no N/A 0.267 0.271 0.297 2e-23
>sp|A6H8I2|SGSM3_XENLA Small G protein signaling modulator 3 homolog OS=Xenopus laevis GN=sgsm3 PE=2 SV=1 Back     alignment and function desciption
 Score =  840 bits (2169), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/768 (56%), Positives = 540/768 (70%), Gaps = 48/768 (6%)

Query: 30  PGGPFSALTPSMWPQDIISKLNQVPEDPNSQPDYRFDEFGFRVEEEDGPEQNSNKLLSEP 89
           PGGPFSALT SMWPQDI++K  Q  E    QP++R+DEFGFRV++EDG E NS+KLL  P
Sbjct: 9   PGGPFSALTASMWPQDILAKYTQ-KEQTVEQPEFRYDEFGFRVDKEDGAEPNSSKLLGIP 67

Query: 90  FIEDPQHRLQWVAYLEFNSSSANSPGKEESEALTWDNLGV-ISRTDKLRSMTRQGIPHSL 148
             EDPQ RL+W A+LEF  +        +   LTWD + V +  +DKLRS+   GIPHS+
Sbjct: 68  LTEDPQQRLRWQAHLEFTHN-------HDVGDLTWDKIDVTLPHSDKLRSLVLAGIPHSM 120

Query: 149 RPQLWLRLSGALEKKALSKIKYQDIVKASSSDALAFAKQIEKDLLRTMPTNACFSTFSST 208
           RPQLW+RLSGAL+KK  S++ Y+DI + SS+D    AKQIEKDLLRTMP+NACFS   S 
Sbjct: 121 RPQLWMRLSGALQKKQNSEMTYKDIGRNSSNDDTLAAKQIEKDLLRTMPSNACFSNLQSV 180

Query: 209 GVPRLRRILRALAWLFPDIG-----GVVNALDFGSRGWWFESKRKVKRQKSILQNLIFGE 263
           GVPRLRR+LR LAWLFPDIG     G+V A        + E +       +I+++L+   
Sbjct: 181 GVPRLRRVLRGLAWLFPDIGYCQGTGMVAACLL----LFLEEEDAFWMMATIVEDLV--- 233

Query: 264 EENGEDIKTKNIHQTGIQADQKVLRSLVASGLPQLEVSLLQHDIELSLITLHWFLTLFAS 323
                 +   N    G+Q DQ+VLR L+   LP+L+  L +HDIELSLITLHWFLT FAS
Sbjct: 234 -----PVSYFNTTLVGVQTDQRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFAS 288

Query: 324 VVHFKILLRIWDLLFLDGSIVLFHSCEPVLVTLENSAEIFNALSDIPGDIVDIDNLLEVG 383
           VVH K+LLRIWD  F  GS+VLF +   +L   E              +++  +N     
Sbjct: 289 VVHIKLLLRIWDFFFYQGSLVLFQTTLGMLKMKEE-------------ELIQSEN----S 331

Query: 384 AEIFNALSDIPGDIVDIDNLLEVSFSVSTSISQSLIDSHRRRHLAFLMSDQGALIGNPAL 443
           A IFN LSDIP  I + D LL  +  +S ++++ +I++ RR+HLA+L++DQG L+ + A 
Sbjct: 332 ASIFNTLSDIPSQIEEADVLLREAMLISGTLTEVMIEAQRRKHLAYLIADQGQLLNSTAA 391

Query: 444 SNNLPKQQLNRLGRILRSLFTLAFGCFLGQTAVARQATPARPQILVDLREATCQIGRHFL 503
             NL K    +  R   ++ TL FG         +     +  ++ DLREA  Q+ RHF 
Sbjct: 392 VANLSKIMRRQSQRRKSAITTLLFGD--DNFEALKSKNIKQTALVADLREAILQVARHFQ 449

Query: 504 TTDPRLSHASLTPNYSPESHQSDHDAYADVSRSRQRRAKALLDFERHDDDELGFRKNDVI 563
            TDP+     LTP+Y+ ESHQ DH+ Y   S+SR+RRAKALLDFERHDDDELGFRKND+I
Sbjct: 450 YTDPKNCSIDLTPDYTMESHQRDHENYVSCSQSRRRRAKALLDFERHDDDELGFRKNDII 509

Query: 564 TIISQKDEHCWIGELNGLKGWFPAKFVELLDERSKQYSLAGDDSVTETITDLVRGTLCPA 623
           TIISQKDEHCW+GELNGL+GWFPAKFV++LDERSK+YS+AGDDSVTE ITDL+RGTL P+
Sbjct: 510 TIISQKDEHCWVGELNGLRGWFPAKFVDILDERSKEYSVAGDDSVTEGITDLIRGTLSPS 569

Query: 624 LKQILSCGLKRRAL-GEVCHPWLFIEEVATREVEKDFTSVYSRLLLCKTYRLDEDGKVLT 682
           +K I   GLK+ +L G  CHPWLFIEE A+REVE+DF SVYSRL+LCKTYRLDEDGKVLT
Sbjct: 570 IKSIFEHGLKKPSLLGGPCHPWLFIEEAASREVERDFDSVYSRLVLCKTYRLDEDGKVLT 629

Query: 683 PEELLYRCVQAVNQSHDMAHVQMDVKFRSLICLGLNEQVLHLWLEVLCSCEPVVLKWYHP 742
           PEELLYR VQ+VN SHD AH QMDVK RSLI +GLNEQVLHLWLEVLCS  P V KWY P
Sbjct: 630 PEELLYRGVQSVNVSHDAAHAQMDVKLRSLISIGLNEQVLHLWLEVLCSSLPTVEKWYQP 689

Query: 743 WSFISSPGWVQVKCDLRVLSQFPFNLSPDWELPPKK--GQSQPLKDGV 788
           WSF+ SPGWVQ+KC+LRVLS+F F+LSPDWELP K+   + +PLK+GV
Sbjct: 690 WSFLRSPGWVQIKCELRVLSKFAFSLSPDWELPVKREDKEKKPLKEGV 737

Xenopus laevis (taxid: 8355)
>sp|Q96HU1|SGSM3_HUMAN Small G protein signaling modulator 3 OS=Homo sapiens GN=SGSM3 PE=1 SV=1 Back     alignment and function description
>sp|Q7T2D0|SGSM3_DANRE Small G protein signaling modulator 3 OS=Danio rerio GN=sgsm3 PE=2 SV=1 Back     alignment and function description
>sp|Q2KI13|SGSM3_BOVIN Small G protein signaling modulator 3 OS=Bos taurus GN=SGSM3 PE=2 SV=1 Back     alignment and function description
>sp|Q8VCZ6|SGSM3_MOUSE Small G protein signaling modulator 3 OS=Mus musculus GN=Sgsm3 PE=1 SV=1 Back     alignment and function description
>sp|Q6P6R7|SGSM3_RAT Small G protein signaling modulator 3 OS=Rattus norvegicus GN=Sgsm3 PE=1 SV=1 Back     alignment and function description
>sp|B1AVH7|TBD2A_MOUSE TBC1 domain family member 2A OS=Mus musculus GN=Tbc1d2 PE=2 SV=1 Back     alignment and function description
>sp|P53258|GYP2_YEAST GTPase-activating protein GYP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDR1 PE=1 SV=1 Back     alignment and function description
>sp|A6QP29|TBD2A_BOVIN TBC1 domain family member 2A OS=Bos taurus GN=TBC1D2 PE=2 SV=1 Back     alignment and function description
>sp|B5DFA1|TBD2A_RAT TBC1 domain family member 2A OS=Rattus norvegicus GN=Tbc1d2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query940
332023306794 Small G protein signaling modulator 3-li 0.769 0.910 0.647 0.0
66549359794 PREDICTED: small G protein signaling mod 0.762 0.903 0.637 0.0
156536999795 PREDICTED: small G protein signaling mod 0.763 0.903 0.638 0.0
380018187794 PREDICTED: LOW QUALITY PROTEIN: small G 0.762 0.903 0.636 0.0
350408742794 PREDICTED: small G protein signaling mod 0.762 0.903 0.638 0.0
340716989794 PREDICTED: small G protein signaling mod 0.762 0.903 0.637 0.0
307201540794 Small G protein signaling modulator 3-li 0.769 0.910 0.638 0.0
383853245794 PREDICTED: small G protein signaling mod 0.762 0.903 0.633 0.0
91095075803 PREDICTED: similar to gtpase-activating 0.756 0.885 0.633 0.0
157136009801 gtpase-activating protein gyp2 [Aedes ae 0.755 0.886 0.621 0.0
>gi|332023306|gb|EGI63560.1| Small G protein signaling modulator 3-like protein [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  977 bits (2526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/766 (64%), Positives = 581/766 (75%), Gaps = 43/766 (5%)

Query: 30  PGGPFSALTPSMWPQDIISKLNQVPEDPNSQPDYRFDEFGFRVEEEDGPEQNSNKLLSEP 89
           PGGPFSALTPSMWPQDI++KLNQ P+DPNSQP+YRFDEFGFRVEEEDGPEQNS KLL  P
Sbjct: 51  PGGPFSALTPSMWPQDILAKLNQ-PDDPNSQPEYRFDEFGFRVEEEDGPEQNSKKLLGIP 109

Query: 90  FIEDPQHRLQWVAYLEFNSSSANSPGKEESEALTWDNLGV-ISRTDKLRSMTRQGIPHSL 148
           F+EDPQHRLQWVA LEF      S  KE +E L+W N+   + RTDKLR M R+GIPHSL
Sbjct: 110 FVEDPQHRLQWVALLEF------SHNKEVAE-LSWQNMDRNLPRTDKLREMVRRGIPHSL 162

Query: 149 RPQLWLRLSGALEKKALSKIKYQDIVKASSSDALAFAKQIEKDLLRTMPTNACFSTFSST 208
           RPQ+W+R+SGAL+KK  S+I Y+DIVKASS+DAL   KQIEKDLLR MP NACFS   ST
Sbjct: 163 RPQIWMRMSGALQKKCSSEIMYKDIVKASSNDALMTNKQIEKDLLRIMPANACFSHLHST 222

Query: 209 GVPRLRRILRALAWLFPDIGGVVNALDFGSRGWWFESKRKVKRQKSILQNLIFGEEENGE 268
           G+PRLRR++RALAWL+PDIG        G+         + +    ++  ++       E
Sbjct: 223 GIPRLRRVMRALAWLYPDIGYCQGT---GTMAASLLLLLEEEDAFWMMATIV-------E 272

Query: 269 DIKTKNIHQT---GIQADQKVLRSLVASGLPQLEVSLLQHDIELSLITLHWFLTLFASVV 325
           D+   + + +   GIQADQKVLR+LVA+ LP ++  LLQHDIELSLI+LHWFLTLFASVV
Sbjct: 273 DLLPASYYSSTLLGIQADQKVLRTLVANYLPDIDHVLLQHDIELSLISLHWFLTLFASVV 332

Query: 326 HFKILLRIWDLLFLDGSIVLFHSCEPVLVTLENSAEIFNALSDIPGDIVDIDNLLEVGAE 385
           H KILLRIWD+   DGSIVLF     +L   E                      LE  A+
Sbjct: 333 HMKILLRIWDMFLFDGSIVLFQITLGMLKIKETDLR-----------------QLENSAQ 375

Query: 386 IFNALSDIPGDIVDIDNLLEVSFSVSTSISQSLIDSHRRRHLAFLMSDQGALIGNPALSN 445
           IFNALSDIPGDI D+D L  VS  VS S++  L+++HRRRHLA+LM+DQG L+GNP    
Sbjct: 376 IFNALSDIPGDIDDVDQLFNVSLEVSGSLTDVLVETHRRRHLAYLMADQGGLVGNPDAVP 435

Query: 446 NLPKQQLNR--LGRILRSLFTLAFGCFLGQTAVARQATPARPQILVDLREATCQIGRHFL 503
           NLPKQ LNR  + R    L T+ FG   G+   A+     + +ILVDLREA  Q+ RHF+
Sbjct: 436 NLPKQHLNRRQMKRNKSMLQTILFGNDDGEDD-AKSKNIRQTEILVDLREAVLQVARHFI 494

Query: 504 TTDPRLSHASLTPNYSPESHQSDHDAYADVSRSRQRRAKALLDFERHDDDELGFRKNDVI 563
             DP+L++  L  +Y+ ESH  DHD Y +VSR+R+RRAKALLDFERHDDDELGFRKND+I
Sbjct: 495 NVDPKLNNVVLIADYTMESHAKDHDNYVNVSRTRKRRAKALLDFERHDDDELGFRKNDII 554

Query: 564 TIISQKDEHCWIGELNGLKGWFPAKFVELLDERSKQYSLAGDDSVTETITDLVRGTLCPA 623
           TIISQKDEHCW+GELNGL+GWFPAKFVELLDERSKQY+ AGDD+V+E +TDLVRGTLCP 
Sbjct: 555 TIISQKDEHCWVGELNGLRGWFPAKFVELLDERSKQYTCAGDDAVSEAVTDLVRGTLCPT 614

Query: 624 LKQILSCGLKRRA-LGEVCHPWLFIEEVATREVEKDFTSVYSRLLLCKTYRLDEDGKVLT 682
           +K +L  G+KR + LG  CHPWLFIEE + REVEKDF SVYSRL+LCKTYRLDEDGKVLT
Sbjct: 615 MKAVLEHGMKRPSFLGGPCHPWLFIEEASNREVEKDFNSVYSRLVLCKTYRLDEDGKVLT 674

Query: 683 PEELLYRCVQAVNQSHDMAHVQMDVKFRSLICLGLNEQVLHLWLEVLCSCEPVVLKWYHP 742
           PEELLYRCVQ+VN +HD AH QMDVK RSLICLGLNEQVLHLWLEVLCSC  VV KWY P
Sbjct: 675 PEELLYRCVQSVNLTHDNAHAQMDVKLRSLICLGLNEQVLHLWLEVLCSCVEVVQKWYQP 734

Query: 743 WSFISSPGWVQVKCDLRVLSQFPFNLSPDWELPPKKGQSQPLKDGV 788
           WSFI+SPGWVQ+KC+LR+LSQF FNL+PDWELPPKK QSQPLKDGV
Sbjct: 735 WSFINSPGWVQIKCELRILSQFAFNLNPDWELPPKKEQSQPLKDGV 780

Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|66549359|ref|XP_395011.2| PREDICTED: small G protein signaling modulator 3 homolog [Apis mellifera] Back     alignment and taxonomy information
>gi|156536999|ref|XP_001608289.1| PREDICTED: small G protein signaling modulator 3 homolog [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|380018187|ref|XP_003693016.1| PREDICTED: LOW QUALITY PROTEIN: small G protein signaling modulator 3 homolog [Apis florea] Back     alignment and taxonomy information
>gi|350408742|ref|XP_003488497.1| PREDICTED: small G protein signaling modulator 3 homolog [Bombus impatiens] Back     alignment and taxonomy information
>gi|340716989|ref|XP_003396972.1| PREDICTED: small G protein signaling modulator 3 homolog [Bombus terrestris] Back     alignment and taxonomy information
>gi|307201540|gb|EFN81303.1| Small G protein signaling modulator 3-like protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383853245|ref|XP_003702133.1| PREDICTED: small G protein signaling modulator 3 homolog [Megachile rotundata] Back     alignment and taxonomy information
>gi|91095075|ref|XP_972860.1| PREDICTED: similar to gtpase-activating protein gyp2 [Tribolium castaneum] gi|270014751|gb|EFA11199.1| hypothetical protein TcasGA2_TC005163 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|157136009|ref|XP_001656725.1| gtpase-activating protein gyp2 [Aedes aegypti] gi|108881093|gb|EAT45318.1| AAEL003379-PA [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query940
UNIPROTKB|E1BR02753 SGSM3 "Uncharacterized protein 0.436 0.544 0.628 1.5e-221
UNIPROTKB|F1PTE5751 SGSM3 "Uncharacterized protein 0.430 0.539 0.624 1.5e-214
UNIPROTKB|Q96HU1749 SGSM3 "Small G protein signali 0.430 0.540 0.623 1.9e-214
MGI|MGI:1916329750 Sgsm3 "small G protein signali 0.430 0.54 0.617 1.1e-211
UNIPROTKB|Q2KI13747 SGSM3 "Small G protein signali 0.435 0.547 0.617 1.7e-211
RGD|735113749 Sgsm3 "small G protein signali 0.430 0.540 0.617 2.2e-211
UNIPROTKB|Q6P6R7749 Sgsm3 "Small G protein signali 0.430 0.540 0.617 2.2e-211
UNIPROTKB|F1SRA4743 SGSM3 "Uncharacterized protein 0.430 0.545 0.617 7.2e-202
UNIPROTKB|I3LKE4745 SGSM3 "Uncharacterized protein 0.430 0.543 0.617 1.1e-200
FB|FBgn0038304804 CG12241 [Drosophila melanogast 0.544 0.636 0.608 7.2e-171
UNIPROTKB|E1BR02 SGSM3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 1346 (478.9 bits), Expect = 1.5e-221, Sum P(2) = 1.5e-221
 Identities = 262/417 (62%), Positives = 307/417 (73%)

Query:   377 DNLL--EVGAEIFNALSDIPGDIVDIDNLLEVXXXXXXXXXXXXXXXHRRRHLAFLMSDQ 434
             D L+  E  A IFN LSDIP  I D D LL                  RR+HLA+L++DQ
Sbjct:   323 DELIQSENSASIFNTLSDIPSQIEDADVLLREAMRVAGSLTDVAVETQRRKHLAYLIADQ 382

Query:   435 GALIGNPALSNNLPKQQLNRLGRILRSLFTLAFGCFLGQTAVARQATPARPQILVDLREA 494
             G L+ +    NNL K    R  R    + +L FG    +   A+     + +++ DLREA
Sbjct:   383 GQLLNSSTTVNNLSKIVRRRTQRRKSGITSLLFGDDDLEALKAKNIK--QTELVADLREA 440

Query:   495 TCQIGRHFLTTDPRLSHASLTPNYSPESHQSDHDAYADVSRSRQRRAKALLDFERHDDDE 554
               Q+ RHF   DP+     LTP+YS ESHQ DH+ Y   SR+R+RRAKALLDFERHDDDE
Sbjct:   441 ILQVARHFQCVDPKNCSIDLTPDYSMESHQRDHENYVACSRNRRRRAKALLDFERHDDDE 500

Query:   555 LGFRKNDVITIISQKDEHCWIGELNGLKGWFPAKFVELLDERSKQYSLAGDDSVTETITD 614
             LGFRKND+ITIISQKDEHCW+GELNGL+GWFPAKFVE+LDERSK+YS+AGDDSVTE +TD
Sbjct:   501 LGFRKNDIITIISQKDEHCWVGELNGLRGWFPAKFVEILDERSKEYSIAGDDSVTEGVTD 560

Query:   615 LVRGTLCPALKQILSCGLKRRAL-GEVCHPWLFIEEVATREVEKDFTSVYSRLLLCKTYR 673
             LVRGTLCPALK I   GLK+ +L G  CHPWLFIEE A+REVE+DF SVYSRL+LCKTYR
Sbjct:   561 LVRGTLCPALKSIFEHGLKKPSLLGGACHPWLFIEEAASREVERDFDSVYSRLVLCKTYR 620

Query:   674 LDEDGKVLTPEELLYRCVQAVNQSHDMAHVQMDVKFRSLICLGLNEQVLHLWLEVLCSCE 733
             LDEDGKVLTPEELLYR VQAVN +HD AH QMDVK RSLIC+GLNEQVLHLWLEVLCS  
Sbjct:   621 LDEDGKVLTPEELLYRAVQAVNMTHDAAHAQMDVKLRSLICVGLNEQVLHLWLEVLCSSL 680

Query:   734 PVVLKWYHPWSFISSPGWVQVKCDLRVLSQFPFNLSPDWELPPKKGQSQ--PLKDGV 788
               V KW+HPWSF+ SPGWVQ+KC+LRVL +F F+LS DWELP K+ + +  PLK+GV
Sbjct:   681 QTVEKWFHPWSFLRSPGWVQIKCELRVLCKFAFSLSQDWELPIKREEKEKKPLKEGV 737
GO:0005097 "Rab GTPase activator activity" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005921 "gap junction" evidence=IEA
GO:0017137 "Rab GTPase binding" evidence=IEA
GO:0032486 "Rap protein signal transduction" evidence=IEA
GO:0045732 "positive regulation of protein catabolic process" evidence=IEA
UNIPROTKB|F1PTE5 SGSM3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q96HU1 SGSM3 "Small G protein signaling modulator 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1916329 Sgsm3 "small G protein signaling modulator 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KI13 SGSM3 "Small G protein signaling modulator 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|735113 Sgsm3 "small G protein signaling modulator 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6P6R7 Sgsm3 "Small G protein signaling modulator 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1SRA4 SGSM3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LKE4 SGSM3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0038304 CG12241 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7T2D0SGSM3_DANRENo assigned EC number0.55030.750.9337yesN/A
Q8VCZ6SGSM3_MOUSENo assigned EC number0.53820.75850.9506yesN/A
Q2KI13SGSM3_BOVINNo assigned EC number0.53950.75530.9504yesN/A
Q96HU1SGSM3_HUMANNo assigned EC number0.54730.74360.9332yesN/A
Q6P6R7SGSM3_RATNo assigned EC number0.53690.75740.9506yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query940
cd1181353 cd11813, SH3_SGSM3, Src Homology 3 domain of Small 2e-33
pfam02759128 pfam02759, RUN, RUN domain 3e-30
smart00164216 smart00164, TBC, Domain in Tre-2, BUB2p, and Cdc16 4e-29
pfam00566206 pfam00566, RabGAP-TBC, Rab-GTPase-TBC domain 1e-24
pfam02759128 pfam02759, RUN, RUN domain 2e-24
COG5210496 COG5210, COG5210, GTPase-activating protein [Gener 6e-24
smart0059364 smart00593, RUN, domain involved in Ras-like GTPas 1e-15
smart0059364 smart00593, RUN, domain involved in Ras-like GTPas 1e-15
smart0032656 smart00326, SH3, Src homology 3 domains 4e-15
cd0017451 cd00174, SH3, Src Homology 3 domain superfamily 2e-13
cd1180355 cd11803, SH3_Endophilin_A, Src homology 3 domain o 1e-12
cd1181954 cd11819, SH3_Cortactin_like, Src homology 3 domain 2e-12
cd1180553 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3e-12
cd1187753 cd11877, SH3_PIX, Src Homology 3 domain of Pak Int 4e-12
pfam0001847 pfam00018, SH3_1, SH3 domain 1e-11
cd1184353 cd11843, SH3_PACSIN, Src homology 3 domain of Prot 2e-11
cd1195953 cd11959, SH3_Cortactin, Src homology 3 domain of C 6e-11
cd1182054 cd11820, SH3_STAM, Src homology 3 domain of Signal 1e-10
cd1187353 cd11873, SH3_CD2AP-like_1, First Src Homology 3 do 2e-10
cd1184053 cd11840, SH3_Intersectin_5, Fifth Src homology 3 d 4e-10
cd1182353 cd11823, SH3_Nostrin, Src homology 3 domain of Nit 4e-10
cd1214255 cd12142, SH3_D21-like, Src Homology 3 domain of SH 4e-10
cd1187555 cd11875, SH3_CD2AP-like_3, Third Src Homology 3 do 4e-10
cd1194953 cd11949, SH3_GRB2_C, C-terminal Src homology 3 dom 1e-09
cd1196054 cd11960, SH3_Abp1_eu, Src homology 3 domain of eum 1e-09
cd1184255 cd11842, SH3_Ysc84p_like, Src homology 3 domain of 2e-09
pfam0765353 pfam07653, SH3_2, Variant SH3 domain 2e-09
cd1178653 cd11786, SH3_SH3RF_1, First Src Homology 3 domain 2e-09
cd1177851 cd11778, SH3_Bzz1_2, Second Src Homology 3 domain 3e-09
cd1192954 cd11929, SH3_SH3RF2_1, First Src Homology 3 domain 3e-09
cd1182753 cd11827, SH3_MyoIe_If_like, Src homology 3 domain 4e-09
cd1195053 cd11950, SH3_GRAP2_C, C-terminal Src homology 3 do 4e-09
cd1207355 cd12073, SH3_HS1, Src homology 3 domain of Hematop 4e-09
cd1196153 cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src 5e-09
cd1182652 cd11826, SH3_Abi, Src homology 3 domain of Abl Int 5e-09
cd1205756 cd12057, SH3_CIN85_3, Third Src Homology 3 domain 5e-09
cd1199052 cd11990, SH3_Intersectin2_2, Second Src homology 3 7e-09
cd1198952 cd11989, SH3_Intersectin1_2, Second Src homology 3 7e-09
cd1182853 cd11828, SH3_ARHGEF9_like, Src homology 3 domain o 8e-09
cd1182554 cd11825, SH3_PLCgamma, Src homology 3 domain of Ph 8e-09
cd1196455 cd11964, SH3_STAM1, Src homology 3 domain of Signa 9e-09
cd1182153 cd11821, SH3_ASAP, Src homology 3 domain of ArfGAP 2e-08
cd1206154 cd12061, SH3_betaPIX, Src Homology 3 domain of bet 3e-08
cd1183054 cd11830, SH3_VAV_2, C-terminal (or second) Src hom 4e-08
cd1192754 cd11927, SH3_SH3RF1_1, First Src Homology 3 domain 4e-08
cd1178153 cd11781, SH3_Sorbs_1, First Src Homology 3 domain 4e-08
cd1183655 cd11836, SH3_Intersectin_1, First Src homology 3 d 4e-08
cd1199554 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 5e-08
cd1178253 cd11782, SH3_Sorbs_2, Second Src Homology 3 domain 6e-08
cd1197373 cd11973, SH3_ASEF, Src homology 3 domain of APC-St 7e-08
cd1205657 cd12056, SH3_CD2AP_3, Third Src Homology 3 domain 9e-08
cd1199654 cd11996, SH3_Intersectin2_5, Fifth Src homology 3 1e-07
cd1188254 cd11882, SH3_GRAF-like, Src Homology 3 domain of G 1e-07
cd1181252 cd11812, SH3_AHI-1, Src Homology 3 domain of Abels 2e-07
cd1194752 cd11947, SH3_GRAP2_N, N-terminal Src homology 3 do 2e-07
cd1197654 cd11976, SH3_VAV1_2, C-terminal (or second) Src ho 2e-07
cd1206058 cd12060, SH3_alphaPIX, Src Homology 3 domain of al 3e-07
cd1176257 cd11762, SH3_FCHSD_2, Second Src Homology 3 domain 3e-07
cd1187453 cd11874, SH3_CD2AP-like_2, Second Src Homology 3 d 4e-07
cd1196557 cd11965, SH3_ASAP1, Src homology 3 domain of ArfGA 4e-07
cd1196357 cd11963, SH3_STAM2, Src homology 3 domain of Signa 5e-07
cd1181651 cd11816, SH3_Eve1_3, Third Src homology 3 domain o 7e-07
cd1189456 cd11894, SH3_FCHSD2_2, Second Src Homology 3 domai 8e-07
cd1184154 cd11841, SH3_SH3YL1_like, Src homology 3 domain of 8e-07
cd1178753 cd11787, SH3_SH3RF_2, Second Src Homology 3 domain 1e-06
cd1181850 cd11818, SH3_Eve1_5, Fifth Src homology 3 domain o 1e-06
cd1205253 cd12052, SH3_CIN85_1, First Src Homology 3 domain 2e-06
cd1176355 cd11763, SH3_SNX9_like, Src Homology 3 domain of S 2e-06
cd1192854 cd11928, SH3_SH3RF3_1, First Src Homology 3 domain 2e-06
cd1179651 cd11796, SH3_DNMBP_N3, Third N-terminal Src homolo 2e-06
cd1197060 cd11970, SH3_PLCgamma1, Src homology 3 domain of P 3e-06
cd1197261 cd11972, SH3_Abi2, Src homology 3 domain of Abl In 4e-06
cd1205553 cd12055, SH3_CIN85_2, Second Src Homology 3 domain 4e-06
cd1197758 cd11977, SH3_VAV2_2, C-terminal (or second) Src ho 4e-06
cd1180452 cd11804, SH3_GRB2_like_N, N-terminal Src homology 5e-06
cd1204653 cd12046, SH3_p67phox_C, C-terminal (or second) Src 5e-06
cd1197454 cd11974, SH3_ASEF2, Src homology 3 domain of APC-S 6e-06
cd1189755 cd11897, SH3_SNX18, Src Homology 3 domain of Sorti 6e-06
cd1199856 cd11998, SH3_PACSIN1-2, Src homology 3 domain of P 6e-06
cd1175855 cd11758, SH3_CRK_N, N-terminal Src Homology 3 doma 7e-06
cd1197159 cd11971, SH3_Abi1, Src homology 3 domain of Abl In 8e-06
cd1205455 cd12054, SH3_CD2AP_2, Second Src Homology 3 domain 9e-06
cd1183353 cd11833, SH3_Stac_1, First C-terminal Src homology 1e-05
cd1187053 cd11870, SH3_p67phox-like_C, C-terminal Src Homolo 1e-05
cd1194854 cd11948, SH3_GRAP_N, N-terminal Src homology 3 dom 1e-05
cd1192055 cd11920, SH3_Sorbs2_1, First Src Homology 3 domain 1e-05
cd1181750 cd11817, SH3_Eve1_4, Fourth Src homology 3 domain 1e-05
cd1205958 cd12059, SH3_MLK1-3, Src Homology 3 domain of Mixe 1e-05
cd1196254 cd11962, SH3_Abp1_fungi_C1, First C-terminal Src h 1e-05
cd1195153 cd11951, SH3_GRAP_C, C-terminal Src homology 3 dom 1e-05
cd1180953 cd11809, SH3_srGAP, Src homology 3 domain of Slit- 2e-05
cd1197562 cd11975, SH3_ARHGEF9, Src homology 3 domain of the 3e-05
cd1194656 cd11946, SH3_GRB2_N, N-terminal Src homology 3 dom 3e-05
cd1197856 cd11978, SH3_VAV3_2, C-terminal (or second) Src ho 3e-05
cd1199756 cd11997, SH3_PACSIN3, Src homology 3 domain of Pro 3e-05
cd1191955 cd11919, SH3_Sorbs1_1, First Src Homology 3 domain 3e-05
cd1176653 cd11766, SH3_Nck_2, Second Src Homology 3 domain o 3e-05
cd1177557 cd11775, SH3_Sla1p_3, Third Src Homology 3 domain 3e-05
cd1183753 cd11837, SH3_Intersectin_2, Second Src homology 3 4e-05
cd1205356 cd12053, SH3_CD2AP_1, First Src Homology 3 domain 6e-05
cd1177253 cd11772, SH3_OSTF1, Src Homology 3 domain of metaz 6e-05
cd1198755 cd11987, SH3_Intersectin1_1, First Src homology 3 7e-05
cd1180653 cd11806, SH3_PRMT2, Src homology 3 domain of Prote 7e-05
cd1182453 cd11824, SH3_PSTPIP1, Src homology 3 domain of Pro 8e-05
cd1187658 cd11876, SH3_MLK, Src Homology 3 domain of Mixed L 9e-05
cd1179064 cd11790, SH3_Amphiphysin, Src Homology 3 domain of 1e-04
cd1196656 cd11966, SH3_ASAP2, Src homology 3 domain of ArfGA 1e-04
cd1182952 cd11829, SH3_GAS7, Src homology 3 domain of Growth 1e-04
cd1200257 cd12002, SH3_NEDD9, Src homology 3 domain of CAS ( 1e-04
cd1186954 cd11869, SH3_p40phox, Src Homology 3 domain of the 2e-04
cd1177054 cd11770, SH3_Nephrocystin, Src Homology 3 domain o 2e-04
cd1180757 cd11807, SH3_ASPP, Src homology 3 domain of Apopto 2e-04
cd1205858 cd12058, SH3_MLK4, Src Homology 3 domain of Mixed 2e-04
cd1195457 cd11954, SH3_ASPP1, Src Homology 3 domain of Apopt 3e-04
cd1178955 cd11789, SH3_Nebulin_family_C, C-terminal Src Homo 3e-04
cd1201361 cd12013, SH3_RIM-BP_3, Third Src homology 3 domain 3e-04
cd1185653 cd11856, SH3_p47phox_like, Src homology 3 domains 4e-04
cd1193459 cd11934, SH3_Lasp1_C, C-terminal Src Homology 3 do 4e-04
cd1177160 cd11771, SH3_Pex13p_fungal, Src Homology 3 domain 4e-04
cd1199956 cd11999, SH3_PACSIN_like, Src homology 3 domain of 6e-04
cd1195655 cd11956, SH3_srGAP4, Src homology 3 domain of Slit 6e-04
cd1188456 cd11884, SH3_MYO15, Src Homology 3 domain of Myosi 8e-04
cd1184552 cd11845, SH3_Src_like, Src homology 3 domain of Sr 8e-04
cd1192155 cd11921, SH3_Vinexin_1, First Src Homology 3 domai 0.001
cd1198857 cd11988, SH3_Intersectin2_1, First Src homology 3 0.001
cd1193558 cd11935, SH3_Nebulette_C, C-terminal Src Homology 0.001
cd1188953 cd11889, SH3_Cyk3p-like, Src Homology 3 domain of 0.001
cd1202153 cd12021, SH3_p47phox_1, First or N-terminal Src ho 0.002
cd1201262 cd12012, SH3_RIM-BP_2, Second Src homology 3 domai 0.002
cd1198653 cd11986, SH3_Stac3_1, First C-terminal Src homolog 0.002
cd1188355 cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25 0.002
cd1200168 cd12001, SH3_BCAR1, Src homology 3 domain of the C 0.002
cd1185855 cd11858, SH3_Myosin-I_fungi, Src homology 3 domain 0.002
cd1196757 cd11967, SH3_SASH1, Src homology 3 domain of SAM A 0.002
cd1184456 cd11844, SH3_CAS, Src homology 3 domain of CAS (Cr 0.002
cd1193358 cd11933, SH3_Nebulin_C, C-terminal Src Homology 3 0.003
cd1199152 cd11991, SH3_Intersectin1_3, Third Src homology 3 0.004
cd1195357 cd11953, SH3_ASPP2, Src Homology 3 (SH3) domain of 0.004
cd1193055 cd11930, SH3_SH3RF1_2, Second Src Homology 3 domai 0.004
cd1186555 cd11865, SH3_Nbp2-like, Src Homology 3 domain of S 0.004
>gnl|CDD|212747 cd11813, SH3_SGSM3, Src Homology 3 domain of Small G protein Signaling Modulator 3 Back     alignment and domain information 
 Score =  122 bits (307), Expect = 2e-33
 Identities = 50/53 (94%), Positives = 53/53 (100%)

Query: 540 RAKALLDFERHDDDELGFRKNDVITIISQKDEHCWIGELNGLKGWFPAKFVEL 592
           RAKALLDFERHDDDELGFRKND+ITIISQKDEHCW+GELNGL+GWFPAKFVEL
Sbjct: 1   RAKALLDFERHDDDELGFRKNDIITIISQKDEHCWVGELNGLRGWFPAKFVEL 53

SGSM3 is also called Merlin-associated protein (MAP), RUN and SH3 domain-containing protein (RUSC3), RUN and TBC1 domain-containing protein 3 (RUTBC3), Rab GTPase-activating protein 5 (RabGAP5), or Rab GAP-like protein (RabGAPLP). It is expressed ubiquitously and functions as a regulator of small G protein RAP- and RAB-mediated neuronal signaling. It is involved in modulating NGF-mediated neurite outgrowth and differentiation. It also interacts with the tumor suppressor merlin and may play a role in the merlin-associated suppression of cell growth. SGSM3 contains TBC, SH3, and RUN domains. SH3 domains are protein interaction domains that bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs. They play versatile and diverse roles in the cell including the regulation of enzymes, changing the subcellular localization of signaling pathway components, and mediating the formation of multiprotein complex assemblies. Length = 53
>gnl|CDD|217217 pfam02759, RUN, RUN domain Back     alignment and domain information
>gnl|CDD|214540 smart00164, TBC, Domain in Tre-2, BUB2p, and Cdc16p Back     alignment and domain information
>gnl|CDD|215997 pfam00566, RabGAP-TBC, Rab-GTPase-TBC domain Back     alignment and domain information
>gnl|CDD|217217 pfam02759, RUN, RUN domain Back     alignment and domain information
>gnl|CDD|227535 COG5210, COG5210, GTPase-activating protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|214736 smart00593, RUN, domain involved in Ras-like GTPase signaling Back     alignment and domain information
>gnl|CDD|214736 smart00593, RUN, domain involved in Ras-like GTPase signaling Back     alignment and domain information
>gnl|CDD|214620 smart00326, SH3, Src homology 3 domains Back     alignment and domain information
>gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily Back     alignment and domain information
>gnl|CDD|212737 cd11803, SH3_Endophilin_A, Src homology 3 domain of Endophilin-A Back     alignment and domain information
>gnl|CDD|212753 cd11819, SH3_Cortactin_like, Src homology 3 domain of Cortactin and related proteins Back     alignment and domain information
>gnl|CDD|212739 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins Back     alignment and domain information
>gnl|CDD|212810 cd11877, SH3_PIX, Src Homology 3 domain of Pak Interactive eXchange factors Back     alignment and domain information
>gnl|CDD|215659 pfam00018, SH3_1, SH3 domain Back     alignment and domain information
>gnl|CDD|212777 cd11843, SH3_PACSIN, Src homology 3 domain of Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins Back     alignment and domain information
>gnl|CDD|212892 cd11959, SH3_Cortactin, Src homology 3 domain of Cortactin Back     alignment and domain information
>gnl|CDD|212754 cd11820, SH3_STAM, Src homology 3 domain of Signal Transducing Adaptor Molecules Back     alignment and domain information
>gnl|CDD|212806 cd11873, SH3_CD2AP-like_1, First Src Homology 3 domain (SH3A) of CD2-associated protein and similar proteins Back     alignment and domain information
>gnl|CDD|212774 cd11840, SH3_Intersectin_5, Fifth Src homology 3 domain (or SH3E) of Intersectin Back     alignment and domain information
>gnl|CDD|212757 cd11823, SH3_Nostrin, Src homology 3 domain of Nitric Oxide Synthase TRaffic INducer Back     alignment and domain information
>gnl|CDD|213018 cd12142, SH3_D21-like, Src Homology 3 domain of SH3 domain-containing protein 21 (SH3D21) and similar proteins Back     alignment and domain information
>gnl|CDD|212808 cd11875, SH3_CD2AP-like_3, Third Src Homology 3 domain (SH3C) of CD2-associated protein and similar proteins Back     alignment and domain information
>gnl|CDD|212882 cd11949, SH3_GRB2_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 Back     alignment and domain information
>gnl|CDD|212893 cd11960, SH3_Abp1_eu, Src homology 3 domain of eumetazoan Actin-binding protein 1 Back     alignment and domain information
>gnl|CDD|212776 cd11842, SH3_Ysc84p_like, Src homology 3 domain of Ysc84p and similar fungal proteins Back     alignment and domain information
>gnl|CDD|219499 pfam07653, SH3_2, Variant SH3 domain Back     alignment and domain information
>gnl|CDD|212720 cd11786, SH3_SH3RF_1, First Src Homology 3 domain of SH3 domain containing ring finger proteins Back     alignment and domain information
>gnl|CDD|212712 cd11778, SH3_Bzz1_2, Second Src Homology 3 domain of Bzz1 and similar domains Back     alignment and domain information
>gnl|CDD|212862 cd11929, SH3_SH3RF2_1, First Src Homology 3 domain of SH3 domain containing ring finger 2 Back     alignment and domain information
>gnl|CDD|212761 cd11827, SH3_MyoIe_If_like, Src homology 3 domain of Myosins Ie, If, and similar proteins Back     alignment and domain information
>gnl|CDD|212883 cd11950, SH3_GRAP2_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein 2 Back     alignment and domain information
>gnl|CDD|213006 cd12073, SH3_HS1, Src homology 3 domain of Hematopoietic lineage cell-specific protein 1 Back     alignment and domain information
>gnl|CDD|212894 cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src homology 3 domain of Fungal Actin-binding protein 1 Back     alignment and domain information
>gnl|CDD|212760 cd11826, SH3_Abi, Src homology 3 domain of Abl Interactor proteins Back     alignment and domain information
>gnl|CDD|212990 cd12057, SH3_CIN85_3, Third Src Homology 3 domain (SH3C) of Cbl-interacting protein of 85 kDa Back     alignment and domain information
>gnl|CDD|212923 cd11990, SH3_Intersectin2_2, Second Src homology 3 domain (or SH3B) of Intersectin-2 Back     alignment and domain information
>gnl|CDD|212922 cd11989, SH3_Intersectin1_2, Second Src homology 3 domain (or SH3B) of Intersectin-1 Back     alignment and domain information
>gnl|CDD|212762 cd11828, SH3_ARHGEF9_like, Src homology 3 domain of ARHGEF9-like Rho guanine nucleotide exchange factors Back     alignment and domain information
>gnl|CDD|212759 cd11825, SH3_PLCgamma, Src homology 3 domain of Phospholipase C (PLC) gamma Back     alignment and domain information
>gnl|CDD|212897 cd11964, SH3_STAM1, Src homology 3 domain of Signal Transducing Adaptor Molecule 1 Back     alignment and domain information
>gnl|CDD|212755 cd11821, SH3_ASAP, Src homology 3 domain of ArfGAP with SH3 domain, ankyrin repeat and PH domain containing proteins Back     alignment and domain information
>gnl|CDD|212994 cd12061, SH3_betaPIX, Src Homology 3 domain of beta-Pak Interactive eXchange factor Back     alignment and domain information
>gnl|CDD|212764 cd11830, SH3_VAV_2, C-terminal (or second) Src homology 3 domain of VAV proteins Back     alignment and domain information
>gnl|CDD|212860 cd11927, SH3_SH3RF1_1, First Src Homology 3 domain of SH3 domain containing ring finger protein 1, an E3 ubiquitin-protein ligase Back     alignment and domain information
>gnl|CDD|212715 cd11781, SH3_Sorbs_1, First Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains Back     alignment and domain information
>gnl|CDD|212770 cd11836, SH3_Intersectin_1, First Src homology 3 domain (or SH3A) of Intersectin Back     alignment and domain information
>gnl|CDD|212928 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-1 Back     alignment and domain information
>gnl|CDD|212716 cd11782, SH3_Sorbs_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains Back     alignment and domain information
>gnl|CDD|212906 cd11973, SH3_ASEF, Src homology 3 domain of APC-Stimulated guanine nucleotide Exchange Factor Back     alignment and domain information
>gnl|CDD|212989 cd12056, SH3_CD2AP_3, Third Src Homology 3 domain (SH3C) of CD2-associated protein Back     alignment and domain information
>gnl|CDD|212929 cd11996, SH3_Intersectin2_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-2 Back     alignment and domain information
>gnl|CDD|212815 cd11882, SH3_GRAF-like, Src Homology 3 domain of GTPase Regulator Associated with Focal adhesion kinase and similar proteins Back     alignment and domain information
>gnl|CDD|212746 cd11812, SH3_AHI-1, Src Homology 3 domain of Abelson helper integration site-1 (AHI-1) Back     alignment and domain information
>gnl|CDD|212880 cd11947, SH3_GRAP2_N, N-terminal Src homology 3 domain of GRB2-related adaptor protein 2 Back     alignment and domain information
>gnl|CDD|212909 cd11976, SH3_VAV1_2, C-terminal (or second) Src homology 3 domain of VAV1 protein Back     alignment and domain information
>gnl|CDD|212993 cd12060, SH3_alphaPIX, Src Homology 3 domain of alpha-Pak Interactive eXchange factor Back     alignment and domain information
>gnl|CDD|212696 cd11762, SH3_FCHSD_2, Second Src Homology 3 domain of FCH and double SH3 domains proteins Back     alignment and domain information
>gnl|CDD|212807 cd11874, SH3_CD2AP-like_2, Second Src Homology 3 domain (SH3B) of CD2-associated protein and similar proteins Back     alignment and domain information
>gnl|CDD|212898 cd11965, SH3_ASAP1, Src homology 3 domain of ArfGAP with SH3 domain, ankyrin repeat and PH domain containing protein 1 Back     alignment and domain information
>gnl|CDD|212896 cd11963, SH3_STAM2, Src homology 3 domain of Signal Transducing Adaptor Molecule 2 Back     alignment and domain information
>gnl|CDD|212750 cd11816, SH3_Eve1_3, Third Src homology 3 domain of ADAM-binding protein Eve-1 Back     alignment and domain information
>gnl|CDD|212827 cd11894, SH3_FCHSD2_2, Second Src Homology 3 domain of FCH and double SH3 domains protein 2 Back     alignment and domain information
>gnl|CDD|212775 cd11841, SH3_SH3YL1_like, Src homology 3 domain of SH3 domain containing Ysc84-like 1 (SH3YL1) protein Back     alignment and domain information
>gnl|CDD|212721 cd11787, SH3_SH3RF_2, Second Src Homology 3 domain of SH3 domain containing ring finger proteins Back     alignment and domain information
>gnl|CDD|212752 cd11818, SH3_Eve1_5, Fifth Src homology 3 domain of ADAM-binding protein Eve-1 Back     alignment and domain information
>gnl|CDD|212985 cd12052, SH3_CIN85_1, First Src Homology 3 domain (SH3A) of Cbl-interacting protein of 85 kDa Back     alignment and domain information
>gnl|CDD|212697 cd11763, SH3_SNX9_like, Src Homology 3 domain of Sorting Nexin 9 and similar proteins Back     alignment and domain information
>gnl|CDD|212861 cd11928, SH3_SH3RF3_1, First Src Homology 3 domain of SH3 domain containing ring finger 3, an E3 ubiquitin-protein ligase Back     alignment and domain information
>gnl|CDD|212730 cd11796, SH3_DNMBP_N3, Third N-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba Back     alignment and domain information
>gnl|CDD|212903 cd11970, SH3_PLCgamma1, Src homology 3 domain of Phospholipase C (PLC) gamma 1 Back     alignment and domain information
>gnl|CDD|212905 cd11972, SH3_Abi2, Src homology 3 domain of Abl Interactor 2 Back     alignment and domain information
>gnl|CDD|212988 cd12055, SH3_CIN85_2, Second Src Homology 3 domain (SH3B) of Cbl-interacting protein of 85 kDa Back     alignment and domain information
>gnl|CDD|212910 cd11977, SH3_VAV2_2, C-terminal (or second) Src homology 3 domain of VAV2 protein Back     alignment and domain information
>gnl|CDD|212738 cd11804, SH3_GRB2_like_N, N-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins Back     alignment and domain information
>gnl|CDD|212979 cd12046, SH3_p67phox_C, C-terminal (or second) Src Homology 3 domain of the p67phox subunit of NADPH oxidase Back     alignment and domain information
>gnl|CDD|212907 cd11974, SH3_ASEF2, Src homology 3 domain of APC-Stimulated guanine nucleotide Exchange Factor 2 Back     alignment and domain information
>gnl|CDD|212830 cd11897, SH3_SNX18, Src Homology 3 domain of Sorting nexin 18 Back     alignment and domain information
>gnl|CDD|212931 cd11998, SH3_PACSIN1-2, Src homology 3 domain of Protein kinase C and Casein kinase Substrate in Neurons 1 (PACSIN1) and PACSIN 2 Back     alignment and domain information
>gnl|CDD|212692 cd11758, SH3_CRK_N, N-terminal Src Homology 3 domain of Ct10 Regulator of Kinase adaptor proteins Back     alignment and domain information
>gnl|CDD|212904 cd11971, SH3_Abi1, Src homology 3 domain of Abl Interactor 1 Back     alignment and domain information
>gnl|CDD|212987 cd12054, SH3_CD2AP_2, Second Src Homology 3 domain (SH3B) of CD2-associated protein Back     alignment and domain information
>gnl|CDD|212767 cd11833, SH3_Stac_1, First C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing (Stac) proteins Back     alignment and domain information
>gnl|CDD|212803 cd11870, SH3_p67phox-like_C, C-terminal Src Homology 3 domain of the p67phox subunit of NADPH oxidase and similar proteins Back     alignment and domain information
>gnl|CDD|212881 cd11948, SH3_GRAP_N, N-terminal Src homology 3 domain of GRB2-related adaptor protein Back     alignment and domain information
>gnl|CDD|212853 cd11920, SH3_Sorbs2_1, First Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) Back     alignment and domain information
>gnl|CDD|212751 cd11817, SH3_Eve1_4, Fourth Src homology 3 domain of ADAM-binding protein Eve-1 Back     alignment and domain information
>gnl|CDD|212992 cd12059, SH3_MLK1-3, Src Homology 3 domain of Mixed Lineage Kinases 1, 2, and 3 Back     alignment and domain information
>gnl|CDD|212895 cd11962, SH3_Abp1_fungi_C1, First C-terminal Src homology 3 domain of Fungal Actin-binding protein 1 Back     alignment and domain information
>gnl|CDD|212884 cd11951, SH3_GRAP_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein Back     alignment and domain information
>gnl|CDD|212743 cd11809, SH3_srGAP, Src homology 3 domain of Slit-Robo GTPase Activating Proteins Back     alignment and domain information
>gnl|CDD|212908 cd11975, SH3_ARHGEF9, Src homology 3 domain of the Rho guanine nucleotide exchange factor ARHGEF9 Back     alignment and domain information
>gnl|CDD|212879 cd11946, SH3_GRB2_N, N-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 Back     alignment and domain information
>gnl|CDD|212911 cd11978, SH3_VAV3_2, C-terminal (or second) Src homology 3 domain of VAV3 protein Back     alignment and domain information
>gnl|CDD|212930 cd11997, SH3_PACSIN3, Src homology 3 domain of Protein kinase C and Casein kinase Substrate in Neurons 3 (PACSIN3) Back     alignment and domain information
>gnl|CDD|212852 cd11919, SH3_Sorbs1_1, First Src Homology 3 domain of Sorbin and SH3 domain containing 1 (Sorbs1), also called ponsin Back     alignment and domain information
>gnl|CDD|212700 cd11766, SH3_Nck_2, Second Src Homology 3 domain of Nck adaptor proteins Back     alignment and domain information
>gnl|CDD|212709 cd11775, SH3_Sla1p_3, Third Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p Back     alignment and domain information
>gnl|CDD|212771 cd11837, SH3_Intersectin_2, Second Src homology 3 domain (or SH3B) of Intersectin Back     alignment and domain information
>gnl|CDD|212986 cd12053, SH3_CD2AP_1, First Src Homology 3 domain (SH3A) of CD2-associated protein Back     alignment and domain information
>gnl|CDD|212706 cd11772, SH3_OSTF1, Src Homology 3 domain of metazoan osteoclast stimulating factor 1 Back     alignment and domain information
>gnl|CDD|212920 cd11987, SH3_Intersectin1_1, First Src homology 3 domain (or SH3A) of Intersectin-1 Back     alignment and domain information
>gnl|CDD|212740 cd11806, SH3_PRMT2, Src homology 3 domain of Protein arginine N-methyltransferase 2 Back     alignment and domain information
>gnl|CDD|212758 cd11824, SH3_PSTPIP1, Src homology 3 domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 1 Back     alignment and domain information
>gnl|CDD|212809 cd11876, SH3_MLK, Src Homology 3 domain of Mixed Lineage Kinases Back     alignment and domain information
>gnl|CDD|212724 cd11790, SH3_Amphiphysin, Src Homology 3 domain of Amphiphysin and related domains Back     alignment and domain information
>gnl|CDD|212899 cd11966, SH3_ASAP2, Src homology 3 domain of ArfGAP with SH3 domain, ankyrin repeat and PH domain containing protein 2 Back     alignment and domain information
>gnl|CDD|212763 cd11829, SH3_GAS7, Src homology 3 domain of Growth Arrest Specific protein 7 Back     alignment and domain information
>gnl|CDD|212935 cd12002, SH3_NEDD9, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding protein family member, Neural precursor cell Expressed, Developmentally Down-regulated 9 Back     alignment and domain information
>gnl|CDD|212802 cd11869, SH3_p40phox, Src Homology 3 domain of the p40phox subunit of NADPH oxidase Back     alignment and domain information
>gnl|CDD|212704 cd11770, SH3_Nephrocystin, Src Homology 3 domain of Nephrocystin (or Nephrocystin-1) Back     alignment and domain information
>gnl|CDD|212741 cd11807, SH3_ASPP, Src homology 3 domain of Apoptosis Stimulating of p53 proteins (ASPP) Back     alignment and domain information
>gnl|CDD|212991 cd12058, SH3_MLK4, Src Homology 3 domain of Mixed Lineage Kinase 4 Back     alignment and domain information
>gnl|CDD|212887 cd11954, SH3_ASPP1, Src Homology 3 domain of Apoptosis Stimulating of p53 protein 1 Back     alignment and domain information
>gnl|CDD|212723 cd11789, SH3_Nebulin_family_C, C-terminal Src Homology 3 domain of the Nebulin family of proteins Back     alignment and domain information
>gnl|CDD|212946 cd12013, SH3_RIM-BP_3, Third Src homology 3 domain of Rab3-interacting molecules (RIMs) binding proteins Back     alignment and domain information
>gnl|CDD|212790 cd11856, SH3_p47phox_like, Src homology 3 domains of the p47phox subunit of NADPH oxidase and similar domains Back     alignment and domain information
>gnl|CDD|212867 cd11934, SH3_Lasp1_C, C-terminal Src Homology 3 domain of LIM and SH3 domain protein 1 Back     alignment and domain information
>gnl|CDD|212705 cd11771, SH3_Pex13p_fungal, Src Homology 3 domain of fungal peroxisomal membrane protein Pex13p Back     alignment and domain information
>gnl|CDD|212932 cd11999, SH3_PACSIN_like, Src homology 3 domain of an unknown subfamily of proteins with similarity to Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins Back     alignment and domain information
>gnl|CDD|212889 cd11956, SH3_srGAP4, Src homology 3 domain of Slit-Robo GTPase Activating Protein 4 Back     alignment and domain information
>gnl|CDD|212817 cd11884, SH3_MYO15, Src Homology 3 domain of Myosin XV Back     alignment and domain information
>gnl|CDD|212779 cd11845, SH3_Src_like, Src homology 3 domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|212854 cd11921, SH3_Vinexin_1, First Src Homology 3 domain of Vinexin, also called Sorbin and SH3 domain containing 3 (Sorbs3) Back     alignment and domain information
>gnl|CDD|212921 cd11988, SH3_Intersectin2_1, First Src homology 3 domain (or SH3A) of Intersectin-2 Back     alignment and domain information
>gnl|CDD|212868 cd11935, SH3_Nebulette_C, C-terminal Src Homology 3 domain of Nebulette and LIM-nebulette (or Lasp2) Back     alignment and domain information
>gnl|CDD|212822 cd11889, SH3_Cyk3p-like, Src Homology 3 domain of Cytokinesis protein 3 and similar proteins Back     alignment and domain information
>gnl|CDD|212954 cd12021, SH3_p47phox_1, First or N-terminal Src homology 3 domain of the p47phox subunit of NADPH oxidase, also called Neutrophil Cytosolic Factor 1 Back     alignment and domain information
>gnl|CDD|212945 cd12012, SH3_RIM-BP_2, Second Src homology 3 domain of Rab3-interacting molecules (RIMs) binding proteins Back     alignment and domain information
>gnl|CDD|212919 cd11986, SH3_Stac3_1, First C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing protein 3 (Stac3) Back     alignment and domain information
>gnl|CDD|212816 cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25/Cdc25 guanine nucleotide exchange factors Back     alignment and domain information
>gnl|CDD|212934 cd12001, SH3_BCAR1, Src homology 3 domain of the CAS (Crk-Associated Substrate) scaffolding protein family member, Breast Cancer Anti-estrogen Resistance 1 Back     alignment and domain information
>gnl|CDD|212792 cd11858, SH3_Myosin-I_fungi, Src homology 3 domain of Type I fungal Myosins Back     alignment and domain information
>gnl|CDD|212900 cd11967, SH3_SASH1, Src homology 3 domain of SAM And SH3 Domain Containing Protein 1 Back     alignment and domain information
>gnl|CDD|212778 cd11844, SH3_CAS, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding proteins Back     alignment and domain information
>gnl|CDD|212866 cd11933, SH3_Nebulin_C, C-terminal Src Homology 3 domain of Nebulin Back     alignment and domain information
>gnl|CDD|212924 cd11991, SH3_Intersectin1_3, Third Src homology 3 domain (or SH3C) of Intersectin-1 Back     alignment and domain information
>gnl|CDD|212886 cd11953, SH3_ASPP2, Src Homology 3 (SH3) domain of Apoptosis Stimulating of p53 protein 2 Back     alignment and domain information
>gnl|CDD|212863 cd11930, SH3_SH3RF1_2, Second Src Homology 3 domain of SH3 domain containing ring finger protein 1, an E3 ubiquitin-protein ligase Back     alignment and domain information
>gnl|CDD|212799 cd11865, SH3_Nbp2-like, Src Homology 3 domain of Saccharomyces cerevisiae Nap1-binding protein 2 and similar fungal proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 940
KOG2222|consensus848 100.0
KOG3759|consensus621 100.0
KOG2058|consensus436 100.0
KOG4347|consensus671 100.0
smart00164199 TBC Domain in Tre-2, BUB2p, and Cdc16p. Probable R 99.96
KOG2223|consensus586 99.96
COG5210496 GTPase-activating protein [General function predic 99.95
KOG3759|consensus621 99.95
KOG2222|consensus848 99.92
KOG4436|consensus948 99.91
KOG1092|consensus484 99.91
KOG4567|consensus370 99.88
PF00566214 RabGAP-TBC: Rab-GTPase-TBC domain; InterPro: IPR00 99.88
KOG2221|consensus267 99.87
KOG1102|consensus397 99.84
KOG2224|consensus781 99.76
KOG1093|consensus725 99.75
PF02759133 RUN: RUN domain; InterPro: IPR004012 This domain i 99.73
KOG1091|consensus625 99.63
smart0059364 RUN domain involved in Ras-like GTPase signaling. 99.53
smart0059364 RUN domain involved in Ras-like GTPase signaling. 99.5
PF02759133 RUN: RUN domain; InterPro: IPR004012 This domain i 99.39
KOG4436|consensus948 99.37
PF1460449 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 99.27
KOG2595|consensus395 99.25
KOG2197|consensus488 99.21
KOG1264|consensus1267 99.13
PF0765355 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 99.09
KOG2070|consensus 661 99.03
KOG2199|consensus462 99.03
KOG3601|consensus222 98.96
KOG1118|consensus366 98.93
KOG2996|consensus865 98.91
KOG1029|consensus1118 98.89
KOG3636|consensus669 98.88
PF0001848 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho 98.78
smart0032658 SH3 Src homology 3 domains. Src homology 3 (SH3) d 98.77
KOG0162|consensus1106 98.76
KOG4226|consensus379 98.71
cd0017454 SH3 Src homology 3 domains; SH3 domains bind to pr 98.69
KOG4348|consensus 627 98.68
KOG2801|consensus559 98.63
KOG4225|consensus489 98.62
KOG4792|consensus293 98.54
KOG4348|consensus627 98.44
KOG4226|consensus379 98.38
KOG2856|consensus472 98.37
KOG1029|consensus1118 98.15
KOG4225|consensus489 98.07
KOG2546|consensus483 98.01
KOG1843|consensus473 98.0
KOG3655|consensus484 97.99
KOG0515|consensus752 97.92
KOG3875|consensus362 97.82
KOG1702|consensus264 97.74
KOG3523|consensus695 97.28
KOG4278|consensus 1157 97.05
KOG4773|consensus386 96.89
KOG3632|consensus1335 96.69
KOG2528|consensus490 96.46
KOG4792|consensus293 96.45
KOG1451|consensus812 96.26
KOG4381|consensus368 96.12
KOG0197|consensus468 95.98
KOG4429|consensus421 95.94
KOG3771|consensus460 95.85
KOG3557|consensus721 95.51
KOG0609|consensus542 95.31
KOG4575|consensus 874 95.16
KOG3725|consensus375 94.8
KOG3775|consensus482 94.8
KOG3601|consensus222 94.24
KOG3632|consensus1335 93.12
KOG0199|consensus 1039 88.89
KOG4381|consensus 368 87.81
KOG3565|consensus640 85.91
KOG0040|consensus 2399 84.18
KOG2080|consensus1295 84.12
PF0823955 SH3_3: Bacterial SH3 domain; InterPro: IPR013247 S 83.96
PF149611296 BROMI: Broad-minded protein 83.15
>KOG2222|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.1e-150  Score=1217.71  Aligned_cols=731  Identities=56%  Similarity=0.960  Sum_probs=677.4

Q ss_pred             hhcccccCCCCCCcccCCCCChHHHHHhhccCCCC---CCCCCCCCCCCCCcccccCC-----CCcc--ccccccCCCCc
Q psy11360         22 ILANRITIPGGPFSALTPSMWPQDIISKLNQVPED---PNSQPDYRFDEFGFRVEEED-----GPEQ--NSNKLLSEPFI   91 (940)
Q Consensus        22 ~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~---~~~~~~~~~D~~GF~~~~~~-----~~~~--~~~~~~~~~~~   91 (940)
                      |.-.+|+.||+||||++.+|||++|++|+..|.|.   |+.+|.+.+|+|||++++++     ++|+  ++.|.+++|+.
T Consensus        44 i~~~~~~~~g~pfsain~am~p~~ilaklgggae~~sgpndqp~~~fdefgfr~edddhdpnlg~eeetss~k~ls~pfl  123 (848)
T KOG2222|consen   44 IADGLFELDGGPFSAINAAMLPIEILAKLGGGAEEASGPNDQPEEFFDEFGFRKEDDDHDPNLGDEEETSSAKHLSEPFL  123 (848)
T ss_pred             hhhccccCCCCChhhhhHhhhhHHHHHhcCCchhhccCCCCChHHHHHhhCcccccccCCCCCCchhccchhhhccCcch
Confidence            67789999999999999999999999999998763   88999999999999999887     5654  68899999999


Q ss_pred             cchhHHHHHHHHHHhcCCCCCCCCccccccccccccc-cCCChHHHHHHHh-cCCCCChhHHHHHHHhccHHHHhhCHHH
Q psy11360         92 EDPQHRLQWVAYLEFNSSSANSPGKEESEALTWDNLG-VISRTDKLRSMTR-QGIPHSLRPQLWLRLSGALEKKALSKIK  169 (940)
Q Consensus        92 e~~~~~~kW~~~l~~~~~~~~~~~~~~~~~~~W~~~~-~~~~~~kLk~lir-~GIP~~lR~~vW~~Llg~~~~~~~~~~~  169 (940)
                      |+.++++||+++|++.++       ++..++.|+.+. ...++++++.+++ +|||+++|+.+|++|+|+..+++..+..
T Consensus       124 edaq~klk~ia~le~~hk-------e~~~dl~w~hi~~~~~ktdk~~~llkeggiphslr~~lw~rlsga~~kkk~ae~s  196 (848)
T KOG2222|consen  124 EDAQHKLKLIAHLEDSHK-------EEAADLLWEHIDGMELKTDKFEELLKEGGIPHSLRAFLWMRLSGALAKKKDAETS  196 (848)
T ss_pred             hhhHHHHHHHHHHHHhhH-------HHHhhhhHHhhcccccchHHHHHHHHcCCCCcchhHHHHHHhhhhhhhhcccccc
Confidence            999999999999999887       788889999987 7889999999999 6699999999999999999999889999


Q ss_pred             HHHHHHhccCchhHHHHHHHHhhhhcCCCCccccCCCCCChhHHhhhhhhheeecCCCc---cc--ceecccCCccceeh
Q psy11360        170 YQDIVKASSSDALAFAKQIEKDLLRTMPTNACFSTFSSTGVPRLRRILRALAWLFPDIG---GV--VNALDFGSRGWWFE  244 (940)
Q Consensus       170 Y~~l~~~~~~~~~~~~~qIekDl~RT~p~~~~F~~~~~~~~~~L~rIL~Aya~~np~iG---gm--Iaa~~~~~~~~~~~  244 (940)
                      |.++++++.++.....+||++|+.||.|+|.||+++++.|+.+|||||++.|+..|++|   ||  |+|.          
T Consensus       197 y~~ilk~~andk~~~~~qiekdllr~lpnn~cf~k~n~~gi~~lrrilk~ia~ifpdigycqg~gviva~----------  266 (848)
T KOG2222|consen  197 YEDILKACANDKLMIGKQIEKDLLRILPNNACFSKKNGEGIEALRRILKCIAFIFPDIGYCQGMGVIVAC----------  266 (848)
T ss_pred             HHHHHHHhcccccchhHHHHHHHHHhCCCcceeeCCCCcchHHHHHHHhhheeecCCcccccCccHHHHH----------
Confidence            99999999999999999999999999999999999999999999999999999999999   66  9999          


Q ss_pred             hhhHHHhhhhhhhhhhccCcccc--------cccccCCcc---cccchhhHHHHHHHHHhhchhHHHHHhhcCCcchhHH
Q psy11360        245 SKRKVKRQKSILQNLIFGEEENG--------EDIKTKNIH---QTGIQADQKVLRSLVASGLPQLEVSLLQHDIELSLIT  313 (940)
Q Consensus       245 ~~~~~~~~~~~~~LLl~~~Ee~A--------~~ll~~~y~---~~gi~~~~~v~~~Ll~~~~P~L~~hL~~~~i~~~l~~  313 (940)
                                   ||+||+||.|        ++++|++||   +.|+|++.+|...|++.++|.|.+.|++++|+.++++
T Consensus       267 -------------lllf~~ee~afwmmaaiiedilp~nfysqtllgiqaderv~~~li~~~l~~ldeal~~~dielslit  333 (848)
T KOG2222|consen  267 -------------LLLFCEEENAFWMMAAIIEDILPANFYSQTLLGIQADERVMHHLIACHLPDLDEALEDHDIELSLIT  333 (848)
T ss_pred             -------------HHHHhcchhHHHHHHHHHHHhcCchhhhhhHhccchhHHHHHHHHHhccCchhHHHHhccceeeehH
Confidence                         9999999999        899999999   9999999999999999999999999999999999999


Q ss_pred             HHHHHHhhccccchhhHHHHHHHHHHhChHHHH-------HhhHHHHhcCCCHHHHHHHhhCCCCCCccchhhhhhhHHH
Q psy11360        314 LHWFLTLFASVVHFKILLRIWDLLFLDGSIVLF-------HSCEPVLVTLENSAEIFNALSDIPGDIVDIDNLLEVGAEI  386 (940)
Q Consensus       314 ~~WfltLF~~~lp~~~vlRIWD~fl~eG~~vlf-------k~~~~~Ll~~~d~~ei~~~L~~lp~~~~d~~~~~~~~~~~  386 (940)
                      ..||+|||+++|.+...+||||.||++|...+|       |+.+.+|..+      -              +..+..+.+
T Consensus       334 l~w~ltlf~nv~~~killriwd~~fy~g~i~ifql~i~ilkmkeqdi~~i------a--------------ettensa~i  393 (848)
T KOG2222|consen  334 LHWFLTLFANVFHMKILLRIWDFFFYEGGINIFQLIIGILKMKEQDIKEI------A--------------ETTENSADI  393 (848)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhheecCcchhHHHHHHHHHhhHHHHHHH------H--------------HhcccHHHH
Confidence            999999999999999999999999999999998       4444444433      0              001123445


Q ss_pred             hhhccCCCCCCCCHHHHHHHHHhccCCCCHHHHHHHHHHHHHHHhhhcccccCCCccCCCCchH--HHhhhhhhccccee
Q psy11360        387 FNALSDIPGDIVDIDNLLEVSFSVSTSISQSLIDSHRRRHLAFLMSDQGALIGNPALSNNLPKQ--QLNRLGRILRSLFT  464 (940)
Q Consensus       387 ~~~~~~~p~~~~d~d~Li~~A~~~~~~is~~~i~~~r~~~~~~l~~~~~~~~~~~~~~~nL~k~--~rr~~~r~ks~~~~  464 (940)
                      |++++++|.+++|++.+++.|-++-++||+-.|+++|++|.+.+|++||..+++++...|||++  +||++.++||.+..
T Consensus       394 f~als~ip~~vtdve~l~~~~~~~~~sis~~li~~~rkkh~a~lmadqg~~i~n~~a~~nlpkqq~~rrkl~ksksiie~  473 (848)
T KOG2222|consen  394 FNALSDIPAEVTDVEKLFEQAGEFEFSISDHLIAEHRKKHLAVLMADQGHIIGNPAAAPNLPKQQLARRKLRKSKSIIEA  473 (848)
T ss_pred             HHHHHhCCchhhhHHHHHHHHhhcccchhHHHHHHHHHHhHHhhhhcCCcccCCcccCCCCcHHHHHHHHHHhhHHHHHH
Confidence            5555555556669999999999999999999999999999999999999999999999999985  89999999999999


Q ss_pred             eecccCCCchhhhcccCCCCCchhHhhHHHHhhcCCcccccCCccC-ccccCCCCCCCCCCCCCCccccccccccceEEE
Q psy11360        465 LAFGCFLGQTAVARQATPARPQILVDLREATCQIGRHFLTTDPRLS-HASLTPNYSPESHQSDHDAYADVSRSRQRRAKA  543 (940)
Q Consensus       465 llfg~~~~~~~~~k~k~~~~~E~~~dl~e~i~~~g~~f~~~~~~f~-sl~lv~~y~~~s~~~~~~~~~~~~~~~~~~a~A  543 (940)
                      ++|..|..+..-.|+|||+|+|+++||+|+|.++||||++.+++.. .+.+..+|+++|+.+++.++....+.+..+|+|
T Consensus       474 ~~~~~dg~~~d~~knknirqteilvdlkeailki~r~fis~d~kl~~~i~~qadys~esh~kd~~nfik~~r~~~kraka  553 (848)
T KOG2222|consen  474 FFFRGDGEEADDLKNKNIRQTEILVDLKEAILKICRHFISCDEKLAGHICLQADYSPESHAKDHANFIKGARTGAKRAKA  553 (848)
T ss_pred             HHhcCCcccccccccccchhhhHhHHHHHHHHHHhHHHeecchhhccceeeeccCCchhhhhhHHHHhhhhhhhhHHHHH
Confidence            8887773333349999999999999999999999999999998775 557999999999999999999988888889999


Q ss_pred             eecCCCCCCCCccccCCCEEEEEeecCCCceEEEeCCcccccCCcceeeecccccccccCCCCCccccccccccccchhh
Q psy11360        544 LLDFERHDDDELGFRKNDVITIISQKDEHCWIGELNGLKGWFPAKFVELLDERSKQYSLAGDDSVTETITDLVRGTLCPA  623 (940)
Q Consensus       544 Lydf~~~~~~ELsf~kGdiI~Vl~~~d~~WW~G~~~g~~G~fP~nyV~~l~~~~~~~~~~gd~s~se~it~lVRg~L~pA  623 (940)
                      |.||...+++||.|+++|+|+|++..|+.+|.|++||.+||||+.||+.++.+.+.+...|++..++++++++||.|+++
T Consensus       554 l~df~r~dddelgfrkndiitiisekdehcwvgelnglrgwfpakfvellder~k~yt~~gddais~~itd~irg~la~a  633 (848)
T KOG2222|consen  554 LHDFAREDDDELGFRKNDIITIISEKDEHCWVGELNGLRGWFPAKFVELLDERGKLYTIAGDDAISEEITDLIRGRLANA  633 (848)
T ss_pred             HhhhhhccccccccccccEEEEeecCCcceeeeccccccccchHHHHHHHHhccceeeeccccccCHHHHHHHHhhhHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHhcCccccC--CCCccccchhhhhhhhhccccchhhhhhhhhhhccccccCCCCcCChhHHHHHHHHHHhhccccc
Q psy11360        624 LKQILSCGLKRRA--LGEVCHPWLFIEEVATREVEKDFTSVYSRLLLCKTYRLDEDGKVLTPEELLYRCVQAVNQSHDMA  701 (940)
Q Consensus       624 l~~ll~hGl~~~~--~~~~~h~W~~ie~~~~~~~~~~~~s~~~r~~l~~sf~ld~~g~~~t~~~~l~~~i~~i~~~h~~~  701 (940)
                      +++++.||++.+.  .+++.|||.|||.                                                    
T Consensus       634 ~k~~ldhgik~~a~~~s~~~hpw~fied----------------------------------------------------  661 (848)
T KOG2222|consen  634 FKAFLDHGIKENAFLGSGAIHPWLFIED----------------------------------------------------  661 (848)
T ss_pred             HHHHHHccccccccccCcCCChhHHHHH----------------------------------------------------
Confidence            9999999999998  3478999999998                                                    


Q ss_pred             cccccchhhHHHhhhhhhhhHHHHHHHHhcChhHHhhhccccccccCchHHHHhhhcccccCcccccCCCcCCCCCCCCC
Q psy11360        702 HVQMDVKFRSLICLGLNEQVLHLWLEVLCSCEPVVLKWYHPWSFISSPGWVQVKCDLRVLSQFPFNLSPDWELPPKKGQS  781 (940)
Q Consensus       702 ~~~~d~kf~afIc~~LN~~~L~~Wl~~l~~~~~~i~~~Y~p~sfl~~~~~~~~l~~L~~Ls~~~F~L~~d~~~~~~~~~~  781 (940)
                                                                                                      
T Consensus       662 --------------------------------------------------------------------------------  661 (848)
T KOG2222|consen  662 --------------------------------------------------------------------------------  661 (848)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             CcccccccchhccccccccchhhhhccccccCCCCCcCChhhHHHHHHHHHhhcccccccccccchhhhhhhhcccchhH
Q psy11360        782 QPLKDGVATREVEKDFTSVYSRLLLCKTYRLDEDGKVLTPEELLYRCVQAVNQSHDMAHVQMDVKFRSLICLGLNEQVLH  861 (940)
Q Consensus       782 ~~~~~~~~~~~~~~~~~s~~sr~~l~~~~~l~~~~~~~t~~~~l~~~i~~~~~~h~~~~~~~d~~~~~~~~~~ln~~~l~  861 (940)
                            ++.++++++|+|+||||+||++||||+|||++||+++|||+||.||.+|++++++||+|+|++||+||||||+|
T Consensus       662 ------~a~~~vekdf~svys~lvlcktyrldedgkiltpeellfr~vq~in~shd~~~a~~dvklrsli~lglneq~ih  735 (848)
T KOG2222|consen  662 ------AATREVEKDFESVYSRLVLCKTYRLDEDGKILTPEELLFRCVQAINDSHDAAHAHMDVKLRSLICLGLNEQCIH  735 (848)
T ss_pred             ------HHHHHHHhhHHHHHHhhhhhhheecccCCcccCHHHHHHHHHHHHhcchhhhhhhhchhhhhheeecccHHHHH
Confidence                  44578999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhcC---hhhhhccccCcccccCcchhhhhhhhccccCcccccCCCCCCCC----CC------------------
Q psy11360        862 LWLEVLCSC---EPVVLKWYHPWSFISSPGWVQVKCDLRVLSQFPFNLSPDWELPP----RK------------------  916 (940)
Q Consensus       862 ~w~~~~~~~---~~~~~~~y~~ws~~~~~g~~~~~~~l~~l~~~~f~l~~d~~~~~----~~------------------  916 (940)
                      +|++++|+|   .++++||||+|+|+.||||+||+|.||.||||+|||++||+||.    ++                  
T Consensus       736 lw~dllca~tqhe~i~nk~yhswafi~sp~w~qikcdlrilsqfafnln~~~ei~gidk~kr~fvnglltsqkkkilstv  815 (848)
T KOG2222|consen  736 LWFDLLCAATQHEEIRNKWYHSWAFIDSPAWRQIKCDLRILSQFAFNLNMDFEIEGIDKKKRGFVNGLLTSQKKKILSTV  815 (848)
T ss_pred             HHHHHHHhcccHHHHHHHHhhhhheecCccceeeehhHhHHhhhhhcCCccccccCcccccccccccchhhhhhhhhhhh
Confidence            999999999   78999999999999999999999999999999999999999994    21                  


Q ss_pred             ---------CCCCchhhHHHhhhhhccccccCC
Q psy11360        917 ---------GQSQPLKDGVQDMLVKHHLFSWDL  940 (940)
Q Consensus       917 ---------~~~~~~~~~~~~~~~~~~~~~~~~  940 (940)
                               +.-+|+||||+|||+|||||||||
T Consensus       816 vsssqdnkq~~eeplk~gv~dmlikhhlfswdl  848 (848)
T KOG2222|consen  816 VSSSQDNKQKEEEPLKDGVRDMLIKHHLFSWDL  848 (848)
T ss_pred             cccccccccccccchhhhHHHHHHHHhhcccCC
Confidence                     467899999999999999999997

>KOG3759|consensus Back     alignment and domain information
>KOG2058|consensus Back     alignment and domain information
>KOG4347|consensus Back     alignment and domain information
>smart00164 TBC Domain in Tre-2, BUB2p, and Cdc16p Back     alignment and domain information
>KOG2223|consensus Back     alignment and domain information
>COG5210 GTPase-activating protein [General function prediction only] Back     alignment and domain information
>KOG3759|consensus Back     alignment and domain information
>KOG2222|consensus Back     alignment and domain information
>KOG4436|consensus Back     alignment and domain information
>KOG1092|consensus Back     alignment and domain information
>KOG4567|consensus Back     alignment and domain information
>PF00566 RabGAP-TBC: Rab-GTPase-TBC domain; InterPro: IPR000195 Identification of a TBC domain in GYP6_YEAST and GYP7_YEAST, which are GTPase activator proteins of yeast Ypt6 and Ypt7, imply that these domains are GTPase activator proteins of Rab-like small GTPases [] Back     alignment and domain information
>KOG2221|consensus Back     alignment and domain information
>KOG1102|consensus Back     alignment and domain information
>KOG2224|consensus Back     alignment and domain information
>KOG1093|consensus Back     alignment and domain information
>PF02759 RUN: RUN domain; InterPro: IPR004012 This domain is present in several proteins that are linked to the functions of GTPases in the Rap and Rab families Back     alignment and domain information
>KOG1091|consensus Back     alignment and domain information
>smart00593 RUN domain involved in Ras-like GTPase signaling Back     alignment and domain information
>smart00593 RUN domain involved in Ras-like GTPase signaling Back     alignment and domain information
>PF02759 RUN: RUN domain; InterPro: IPR004012 This domain is present in several proteins that are linked to the functions of GTPases in the Rap and Rab families Back     alignment and domain information
>KOG4436|consensus Back     alignment and domain information
>PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A Back     alignment and domain information
>KOG2595|consensus Back     alignment and domain information
>KOG2197|consensus Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG2070|consensus Back     alignment and domain information
>KOG2199|consensus Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>KOG1118|consensus Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG3636|consensus Back     alignment and domain information
>PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>smart00326 SH3 Src homology 3 domains Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies Back     alignment and domain information
>KOG4348|consensus Back     alignment and domain information
>KOG2801|consensus Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>KOG4348|consensus Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>KOG2856|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>KOG2546|consensus Back     alignment and domain information
>KOG1843|consensus Back     alignment and domain information
>KOG3655|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG3875|consensus Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>KOG3523|consensus Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>KOG4773|consensus Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>KOG2528|consensus Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>KOG1451|consensus Back     alignment and domain information
>KOG4381|consensus Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>KOG4429|consensus Back     alignment and domain information
>KOG3771|consensus Back     alignment and domain information
>KOG3557|consensus Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>KOG4575|consensus Back     alignment and domain information
>KOG3725|consensus Back     alignment and domain information
>KOG3775|consensus Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>KOG4381|consensus Back     alignment and domain information
>KOG3565|consensus Back     alignment and domain information
>KOG0040|consensus Back     alignment and domain information
>KOG2080|consensus Back     alignment and domain information
>PF08239 SH3_3: Bacterial SH3 domain; InterPro: IPR013247 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>PF14961 BROMI: Broad-minded protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query940
2yuo_A78 Solution Structure Of The Sh3 Domain Of Mouse Run A 2e-31
2yun_A79 Solution Structure Of The Sh3 Domain Of Human Nostr 8e-09
3c0c_A73 X-Ray Crystal Structure Of The Rat Endophilin A2 Sh 1e-08
3iql_A71 Crystal Structure Of The Rat Endophilin-A1 Sh3 Doma 7e-08
2dbm_A73 Solution Structures Of The Sh3 Domain Of Human Sh3- 1e-07
4iim_A70 Crystal Structure Of The Second Sh3 Domain Of Itsn1 1e-07
3nmz_D116 Crytal Structure Of Apc Complexed With Asef Length 1e-06
1j3t_A74 Solution Structure Of The Second Sh3 Domain Of Huma 1e-06
1h3h_A60 Structural Basis For Specific Recognition Of An Rxx 3e-06
1k76_A62 Solution Structure Of The C-Terminal Sem-5 Sh3 Doma 3e-06
3sem_A60 Sem5 Sh3 Domain Complexed With Peptoid Inhibitor Le 3e-06
1sem_A58 Structural Determinants Of Peptide-Binding Orientat 3e-06
2ew3_A68 Solution Structure Of The Sh3 Domain Of Human Sh3gl 3e-06
2drm_A58 Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 L 4e-06
2drk_A59 Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 L 4e-06
1oot_A60 Crystal Structure Of The Sh3 Domain From A S. Cerev 5e-06
2ed1_A76 Solution Structure Of The Sh3 Domain Of 130 Kda Pho 6e-06
2djq_A68 The Solution Structure Of The First Sh3 Domain Of M 6e-06
2da9_A70 Solution Structure Of The Third Sh3 Domain Of Sh3-D 7e-06
2pz1_A466 Crystal Structure Of Auto-Inhibited Asef Length = 4 8e-06
1udl_A98 The Solution Structure Of The Fifth Sh3 Domain Of I 8e-06
1uti_A58 MonaGADS SH3C IN COMPLEX WITH HPK DERIVED PEPTIDE L 9e-06
1uj0_A62 Crystal Structure Of Stam2 Sh3 Domain In Complex Wi 1e-05
3gf9_A295 Crystal Structure Of Human Intersectin 2 Rhogef Dom 1e-05
1oeb_A62 MonaGADS SH3C DOMAIN Length = 62 1e-05
2k9g_A73 Solution Structure Of The Third Sh3 Domain Of The C 1e-05
1zsg_A65 Beta Pix-Sh3 Complexed With An Atypical Peptide Fro 1e-05
2l0a_A72 Solution Nmr Structure Of Signal Transducing Adapte 1e-05
2k6d_A62 Cin85 Sh3-C Domain In Complex With Ubiquitin Length 1e-05
2ydl_A69 Crystal Structure Of Sh3c From Cin85 Length = 69 2e-05
2rqt_A61 Solution Structure Of The Human Ddef1 Sh3 Domain Le 2e-05
2dx1_A482 Crystal Structure Of Rhogef Protein Asef Length = 4 2e-05
2vwf_A58 Grb2 Sh3c (2) Length = 58 2e-05
2i0n_A80 Structure Of Dictyostelium Discoideum Myosin Vii Sh 2e-05
2d0n_A59 Crystal Structure Of The C-Terminal Sh3 Domain Of T 2e-05
1gcq_A61 Crystal Structure Of Vav And Grb2 Sh3 Domains Lengt 2e-05
1io6_A59 Growth Factor Receptor-Bound Protein 2 (Grb2) C-Ter 2e-05
2vvk_A56 Grb2 Sh3c (1) Length = 56 3e-05
2kbt_A142 Attachment Of An Nmr-Invisible Solubility Enhanceme 3e-05
1x69_A79 Solution Structures Of The Sh3 Domain Of Human Src 4e-05
3jv3_A283 Structure Of Sh3e-Dh Unit Of Murine Intersectin-1l 4e-05
2d1x_A66 The Crystal Structure Of The Cortactin-Sh3 Domain A 5e-05
2ak5_A64 Beta Pix-Sh3 Complexed With A Cbl-B Peptide Length 5e-05
2xmf_A60 Myosin 1e Sh3 Length = 60 5e-05
3ulr_B65 Lysozyme Contamination Facilitates Crystallization 6e-05
1gri_A217 Grb2 Length = 217 6e-05
2dl7_A73 Solution Structure Of The Second Sh3 Domain Of Huma 7e-05
1x2q_A88 Solution Structure Of The Sh3 Domain Of The Signal 8e-05
1wi7_A68 Solution Structure Of The Sh3 Domain Of Sh3-Domain 8e-05
3hzj_A310 Crystal Structure Of The Rabgap Domain Of The Rabga 9e-05
2ed0_A78 Solution Structure Of The Sh3 Domain Of Abl Interac 9e-05
3haj_A486 Crystal Structure Of Human Pacsin2 F-Bar Domain (P2 1e-04
2df6_A59 Crystal Structure Of The Sh3 Domain Of Betapix In C 1e-04
2esw_A61 Atomic Structure Of The N-Terminal Sh3 Domain Of Mo 1e-04
3qyb_A301 X-Ray Crystal Structure Of Human Tbc1d4 (As160) Rab 1e-04
2o2o_A92 Solution Structure Of Domain B From Human Cin85 Pro 1e-04
3qye_A331 Crystal Structure Of Human Tbc1d1 Rabgap Domain Len 2e-04
1ujy_A76 Solution Structure Of Sh3 Domain In RacCDC42 GUANIN 2e-04
1aze_A56 Nmr Structure Of The Complex Between The C32s-Y7v M 2e-04
2dm1_A73 Solution Structure Of The Second Sh3 Domain Of Huma 2e-04
2krn_A60 High Resolution Structure Of The Second Sh3 Domain 2e-04
1ng2_A193 Structure Of Autoinhibited P47phox Length = 193 3e-04
2a08_A60 Structure Of The Yeast Yhh6 Sh3 Domain Length = 60 3e-04
3u23_A65 Atomic Resolution Crystal Structure Of The 2nd Sh3 4e-04
2dl3_A68 Solution Structure Of The First Sh3 Domain Of Human 5e-04
2l3s_A163 Structure Of The Autoinhibited Crk Length = 163 5e-04
2d8h_A80 Solution Structure Of The Sh3 Domain Of Hypothetica 6e-04
1wlp_B138 Solution Structure Of The P22phox-P47phox Complex L 6e-04
1uec_A193 Crystal Structure Of Autoinhibited Form Of Tandem S 6e-04
1ov3_A138 Structure Of The P22phox-P47phox Complex Length = 1 7e-04
4gbq_A74 Solution Nmr Structure Of The Grb2 N-Terminal Sh3 D 7e-04
2x3w_D60 Structure Of Mouse Syndapin I (Crystal Form 2) Leng 7e-04
1y0m_A61 Crystal Structure Of Of The Sh3 Domain Of Phospholi 8e-04
2ysq_A81 Solution Structure Of The Sh3 Domain From Rho Guani 8e-04
1ywo_A64 Phospholipase Cgamma1 Sh3 In Complex With A Slp-76 8e-04
2k3b_A62 Seeing The Invisible: Structures Of Excited Protein 8e-04
>pdb|2YUO|A Chain A, Solution Structure Of The Sh3 Domain Of Mouse Run And Tbc1 Domain Containing 3 Length = 78 Back     alignment and structure 
Iteration: 1

 Score =  134 bits (338), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 67/70 (95%)
Query: 534 SRSRQRRAKALLDFERHDDDELGFRKNDVITIISQKDEHCWIGELNGLKGWFPAKFVELL 593
           S S  RRAKALLDFERHDDDELGFRKND+ITIISQKDEHCW+GELNGL+GWFPAKFVE+L
Sbjct: 3   SGSSGRRAKALLDFERHDDDELGFRKNDIITIISQKDEHCWVGELNGLRGWFPAKFVEVL 62
Query: 594 DERSKQYSLA 603
           DERSK+YS+A
Sbjct: 63  DERSKEYSIA 72
>pdb|2YUN|A Chain A, Solution Structure Of The Sh3 Domain Of Human Nostrin Length = 79 Back     alignment and structure
>pdb|3C0C|A Chain A, X-Ray Crystal Structure Of The Rat Endophilin A2 Sh3 Domain Length = 73 Back     alignment and structure
>pdb|3IQL|A Chain A, Crystal Structure Of The Rat Endophilin-A1 Sh3 Domain Length = 71 Back     alignment and structure
>pdb|2DBM|A Chain A, Solution Structures Of The Sh3 Domain Of Human Sh3- Containing Grb2-Like Protein 2 Length = 73 Back     alignment and structure
>pdb|4IIM|A Chain A, Crystal Structure Of The Second Sh3 Domain Of Itsn1 Bound With A Synthetic Peptide Length = 70 Back     alignment and structure
>pdb|3NMZ|D Chain D, Crytal Structure Of Apc Complexed With Asef Length = 116 Back     alignment and structure
>pdb|1J3T|A Chain A, Solution Structure Of The Second Sh3 Domain Of Human Intersectin 2 (Kiaa1256) Length = 74 Back     alignment and structure
>pdb|1H3H|A Chain A, Structural Basis For Specific Recognition Of An Rxxk-Containing Slp-76 Peptide By The Gads C-Terminal Sh3 Domain Length = 60 Back     alignment and structure
>pdb|1K76|A Chain A, Solution Structure Of The C-Terminal Sem-5 Sh3 Domain (Minimized Average Structure) Length = 62 Back     alignment and structure
>pdb|3SEM|A Chain A, Sem5 Sh3 Domain Complexed With Peptoid Inhibitor Length = 60 Back     alignment and structure
>pdb|1SEM|A Chain A, Structural Determinants Of Peptide-Binding Orientation And Of Sequence Specificity In Sh3 Domains Length = 58 Back     alignment and structure
>pdb|2EW3|A Chain A, Solution Structure Of The Sh3 Domain Of Human Sh3gl3 Length = 68 Back     alignment and structure
>pdb|2DRM|A Chain A, Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 Length = 58 Back     alignment and structure
>pdb|2DRK|A Chain A, Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 Length = 59 Back     alignment and structure
>pdb|1OOT|A Chain A, Crystal Structure Of The Sh3 Domain From A S. Cerevisiae Hypothetical 40.4 Kda Protein At 1.39 A Resolution Length = 60 Back     alignment and structure
>pdb|2ED1|A Chain A, Solution Structure Of The Sh3 Domain Of 130 Kda Phosphatidylinositol 4,5-Biphosphate-Dependent Arf1 Gtpase- Activating Protein Length = 76 Back     alignment and structure
>pdb|2DJQ|A Chain A, The Solution Structure Of The First Sh3 Domain Of Mouse Sh3 Domain Containing Ring Finger 2 Length = 68 Back     alignment and structure
>pdb|2DA9|A Chain A, Solution Structure Of The Third Sh3 Domain Of Sh3-Domain Kinase Binding Protein 1 (Regulator Of Ubiquitous Kinase, Ruk) Length = 70 Back     alignment and structure
>pdb|2PZ1|A Chain A, Crystal Structure Of Auto-Inhibited Asef Length = 466 Back     alignment and structure
>pdb|1UDL|A Chain A, The Solution Structure Of The Fifth Sh3 Domain Of Intersectin 2 (Kiaa1256) Length = 98 Back     alignment and structure
>pdb|1UTI|A Chain A, MonaGADS SH3C IN COMPLEX WITH HPK DERIVED PEPTIDE Length = 58 Back     alignment and structure
>pdb|1UJ0|A Chain A, Crystal Structure Of Stam2 Sh3 Domain In Complex With A Ubpy-Derived Peptide Length = 62 Back     alignment and structure
>pdb|3GF9|A Chain A, Crystal Structure Of Human Intersectin 2 Rhogef Domain Length = 295 Back     alignment and structure
>pdb|1OEB|A Chain A, MonaGADS SH3C DOMAIN Length = 62 Back     alignment and structure
>pdb|2K9G|A Chain A, Solution Structure Of The Third Sh3 Domain Of The Cin85 Adapter Protein Length = 73 Back     alignment and structure
>pdb|1ZSG|A Chain A, Beta Pix-Sh3 Complexed With An Atypical Peptide From Alpha- Pak Length = 65 Back     alignment and structure
>pdb|2L0A|A Chain A, Solution Nmr Structure Of Signal Transducing Adapter Molecule 1 Stam-1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4479e Length = 72 Back     alignment and structure
>pdb|2K6D|A Chain A, Cin85 Sh3-C Domain In Complex With Ubiquitin Length = 62 Back     alignment and structure
>pdb|2YDL|A Chain A, Crystal Structure Of Sh3c From Cin85 Length = 69 Back     alignment and structure
>pdb|2RQT|A Chain A, Solution Structure Of The Human Ddef1 Sh3 Domain Length = 61 Back     alignment and structure
>pdb|2DX1|A Chain A, Crystal Structure Of Rhogef Protein Asef Length = 482 Back     alignment and structure
>pdb|2VWF|A Chain A, Grb2 Sh3c (2) Length = 58 Back     alignment and structure
>pdb|2I0N|A Chain A, Structure Of Dictyostelium Discoideum Myosin Vii Sh3 Domain With Adjacent Proline Rich Region Length = 80 Back     alignment and structure
>pdb|2D0N|A Chain A, Crystal Structure Of The C-Terminal Sh3 Domain Of The Adaptor Protein Gads In Complex With Slp-76 Motif Peptide Reveals A Unique Sh3-Sh3 Interaction Length = 59 Back     alignment and structure
>pdb|1GCQ|A Chain A, Crystal Structure Of Vav And Grb2 Sh3 Domains Length = 61 Back     alignment and structure
>pdb|1IO6|A Chain A, Growth Factor Receptor-Bound Protein 2 (Grb2) C-Terminal Sh3 Domain Complexed With A Ligand Peptide (Nmr, Minimized Mean Structure) Length = 59 Back     alignment and structure
>pdb|2VVK|A Chain A, Grb2 Sh3c (1) Length = 56 Back     alignment and structure
>pdb|2KBT|A Chain A, Attachment Of An Nmr-Invisible Solubility Enhancement Tag (Inset) Using A Sortase-Mediated Protein Ligation Method Length = 142 Back     alignment and structure
>pdb|1X69|A Chain A, Solution Structures Of The Sh3 Domain Of Human Src Substrate Cortactin Length = 79 Back     alignment and structure
>pdb|3JV3|A Chain A, Structure Of Sh3e-Dh Unit Of Murine Intersectin-1l Length = 283 Back     alignment and structure
>pdb|2D1X|A Chain A, The Crystal Structure Of The Cortactin-Sh3 Domain And Amap1- Peptide Complex Length = 66 Back     alignment and structure
>pdb|2AK5|A Chain A, Beta Pix-Sh3 Complexed With A Cbl-B Peptide Length = 64 Back     alignment and structure
>pdb|2XMF|A Chain A, Myosin 1e Sh3 Length = 60 Back     alignment and structure
>pdb|3ULR|B Chain B, Lysozyme Contamination Facilitates Crystallization Of A Hetero- Trimericcortactin:arg:lysozyme Complex Length = 65 Back     alignment and structure
>pdb|1GRI|A Chain A, Grb2 Length = 217 Back     alignment and structure
>pdb|2DL7|A Chain A, Solution Structure Of The Second Sh3 Domain Of Human Kiaa0769 Protein Length = 73 Back     alignment and structure
>pdb|1X2Q|A Chain A, Solution Structure Of The Sh3 Domain Of The Signal Transducing Adaptor Molecule 2 Length = 88 Back     alignment and structure
>pdb|1WI7|A Chain A, Solution Structure Of The Sh3 Domain Of Sh3-Domain Kinase Binding Protein 1 Length = 68 Back     alignment and structure
>pdb|3HZJ|A Chain A, Crystal Structure Of The Rabgap Domain Of The Rabgap1l Protein Length = 310 Back     alignment and structure
>pdb|2ED0|A Chain A, Solution Structure Of The Sh3 Domain Of Abl Interactor 2 (Abelson Interactor 2) Length = 78 Back     alignment and structure
>pdb|3HAJ|A Chain A, Crystal Structure Of Human Pacsin2 F-Bar Domain (P212121 Lattice) Length = 486 Back     alignment and structure
>pdb|2DF6|A Chain A, Crystal Structure Of The Sh3 Domain Of Betapix In Complex With A High Affinity Peptide From Pak2 Length = 59 Back     alignment and structure
>pdb|2ESW|A Chain A, Atomic Structure Of The N-Terminal Sh3 Domain Of Mouse Beta Pix,P21-Activated Kinase (Pak)-Interacting Exchange Factor Length = 61 Back     alignment and structure
>pdb|3QYB|A Chain A, X-Ray Crystal Structure Of Human Tbc1d4 (As160) Rabgap Domain Length = 301 Back     alignment and structure
>pdb|2O2O|A Chain A, Solution Structure Of Domain B From Human Cin85 Protein Length = 92 Back     alignment and structure
>pdb|3QYE|A Chain A, Crystal Structure Of Human Tbc1d1 Rabgap Domain Length = 331 Back     alignment and structure
>pdb|1UJY|A Chain A, Solution Structure Of Sh3 Domain In RacCDC42 GUANINE Nucleotide Exchange Factor(Gef) 6 Length = 76 Back     alignment and structure
>pdb|1AZE|A Chain A, Nmr Structure Of The Complex Between The C32s-Y7v Mutant Of The Nsh3 Domain Of Grb2 With A Peptide From Sos, 10 Structures Length = 56 Back     alignment and structure
>pdb|2DM1|A Chain A, Solution Structure Of The Second Sh3 Domain Of Human Protein Vav-2 Length = 73 Back     alignment and structure
>pdb|2KRN|A Chain A, High Resolution Structure Of The Second Sh3 Domain Of Cd2ap Length = 60 Back     alignment and structure
>pdb|1NG2|A Chain A, Structure Of Autoinhibited P47phox Length = 193 Back     alignment and structure
>pdb|2A08|A Chain A, Structure Of The Yeast Yhh6 Sh3 Domain Length = 60 Back     alignment and structure
>pdb|3U23|A Chain A, Atomic Resolution Crystal Structure Of The 2nd Sh3 Domain From Human Cd2ap (Cms) In Complex With A Proline-Rich Peptide From Human Rin3 Length = 65 Back     alignment and structure
>pdb|2DL3|A Chain A, Solution Structure Of The First Sh3 Domain Of Human Sorbin And Sh3 Domain-Containing Protein 1 Length = 68 Back     alignment and structure
>pdb|2L3S|A Chain A, Structure Of The Autoinhibited Crk Length = 163 Back     alignment and structure
>pdb|2D8H|A Chain A, Solution Structure Of The Sh3 Domain Of Hypothetical Protein Sh3yl1 Length = 80 Back     alignment and structure
>pdb|1WLP|B Chain B, Solution Structure Of The P22phox-P47phox Complex Length = 138 Back     alignment and structure
>pdb|1UEC|A Chain A, Crystal Structure Of Autoinhibited Form Of Tandem Sh3 Domain Of P47phox Length = 193 Back     alignment and structure
>pdb|1OV3|A Chain A, Structure Of The P22phox-P47phox Complex Length = 138 Back     alignment and structure
>pdb|4GBQ|A Chain A, Solution Nmr Structure Of The Grb2 N-Terminal Sh3 Domain Complexed With A Ten-Residue Peptide Derived From Sos Direct Refinement Against Noes, J-Couplings, And 1h And 13c Chemical Shifts, 15 Structures Length = 74 Back     alignment and structure
>pdb|2X3W|D Chain D, Structure Of Mouse Syndapin I (Crystal Form 2) Length = 60 Back     alignment and structure
>pdb|1Y0M|A Chain A, Crystal Structure Of Of The Sh3 Domain Of Phospholipase C Gamma-1 Length = 61 Back     alignment and structure
>pdb|2YSQ|A Chain A, Solution Structure Of The Sh3 Domain From Rho Guanine Nucleotide Exchange Factor 9 Length = 81 Back     alignment and structure
>pdb|1YWO|A Chain A, Phospholipase Cgamma1 Sh3 In Complex With A Slp-76 Motif Length = 64 Back     alignment and structure
>pdb|2K3B|A Chain A, Seeing The Invisible: Structures Of Excited Protein States By Relaxation Dispersion Nmr Length = 62 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query940
3qye_A331 TBC1 domain family member 1; rabgap, RAB, myocytes 1e-49
3hzj_A310 Rabgap1L, RAB GTPase-activating protein 1-like; st 4e-47
2qq8_A334 TBC1 domain family member 14; structural genomics 7e-39
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 8e-30
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 3e-28
2qfz_A345 TBC1 domain family member 22A; RAB-GAP, GTPase act 2e-27
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 2e-26
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 3e-26
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 3e-26
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 1e-25
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 2e-25
1fkm_A396 Protein (GYP1P), ORF YOR070C; GAP, YPT/RAB protein 1e-24
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 1e-24
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 1e-24
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 3e-24
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 8e-24
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 1e-23
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 2e-23
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 2e-23
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 2e-23
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 4e-23
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 4e-23
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 5e-23
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 9e-23
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 1e-22
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 2e-22
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 2e-22
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 3e-22
1uti_A58 GRB2-related adaptor protein 2; signaling protein 7e-22
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 8e-22
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 1e-21
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} Length 1e-21
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 2e-21
2dil_A69 Proline-serine-threonine phosphatase-interacting p 2e-21
2da9_A70 SH3-domain kinase binding protein 1; structural ge 2e-21
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 2e-21
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 3e-21
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 4e-21
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 4e-21
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 6e-21
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 7e-21
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 7e-21
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 8e-21
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 1e-20
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 2e-20
3qwl_A294 TBC1 domain family member 7; RAB GTPase activation 2e-20
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 2e-20
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 2e-20
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 2e-20
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 4e-20
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 5e-20
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 7e-20
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 7e-20
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 7e-20
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 8e-20
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 1e-19
3u23_A65 CD2-associated protein; structural genomics, struc 1e-19
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 2e-19
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 2e-19
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 2e-19
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 2e-19
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 3e-19
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 4e-19
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 4e-19
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 4e-19
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 6e-19
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 9e-19
2j6f_A62 CD2-associated protein; metal-binding, immune resp 1e-18
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 1e-18
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 1e-18
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 2e-18
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 2e-18
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 3e-18
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 3e-18
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 3e-18
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 5e-18
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 6e-18
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 9e-18
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 1e-17
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 1e-17
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 3e-17
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 4e-17
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 4e-17
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 4e-17
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 4e-17
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 7e-17
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 7e-17
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 1e-16
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 1e-16
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 1e-16
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 1e-16
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 1e-16
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 2e-16
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 2e-16
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 3e-16
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 3e-16
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 3e-16
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 4e-16
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 6e-16
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 6e-16
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 7e-16
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 8e-16
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 1e-15
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 1e-15
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 1e-15
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 1e-15
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 2e-15
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 3e-15
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 4e-15
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 9e-15
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 1e-14
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 1e-14
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 3e-14
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 3e-14
2cuc_A70 SH3 domain containing ring finger 2; structural ge 4e-14
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 5e-14
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 5e-14
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 1e-13
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 6e-14
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 1e-13
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 1e-13
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 2e-08
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 2e-13
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 2e-13
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 2e-13
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-07
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 2e-13
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 3e-13
1wxb_A68 Epidermal growth factor receptor pathway substrate 3e-13
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 5e-13
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 5e-13
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 5e-13
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 6e-13
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 8e-13
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 6e-08
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 1e-12
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 1e-12
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 1e-12
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 2e-12
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 2e-12
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 2e-12
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 2e-12
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 2e-12
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 3e-12
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 3e-12
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 3e-12
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 3e-12
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 3e-12
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 5e-12
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 5e-12
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 6e-12
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 8e-12
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 8e-12
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 8e-12
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 9e-12
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 1e-11
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 9e-12
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 1e-11
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 1e-11
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 1e-11
1awj_A77 ITK; transferase, regulatory intramolecular comple 1e-11
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 2e-11
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 2e-11
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 2e-11
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 2e-11
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 3e-11
3cwz_B384 RAB6IP1, RAB6-interacting protein 1; RAB small GTP 3e-11
3cwz_B 384 RAB6IP1, RAB6-interacting protein 1; RAB small GTP 7e-05
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 4e-11
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 6e-11
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 1e-10
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 1e-10
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 2e-10
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 5e-10
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 4e-10
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 4e-10
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 6e-10
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 9e-10
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 1e-09
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 3e-09
1i07_A60 Epidermal growth factor receptor kinase substrate 3e-09
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 4e-09
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 5e-09
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 5e-09
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 7e-09
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 9e-09
2dwk_A180 Protein RUFY3; RUN domain, effector, RAP2, bundle, 1e-08
2dwk_A180 Protein RUFY3; RUN domain, effector, RAP2, bundle, 2e-06
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 2e-08
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 3e-08
3jv3_A283 Intersectin-1; SH3 domain, DH domain, guanine nucl 2e-07
1ug1_A92 KIAA1010 protein; structural genomics, SH3 domain, 3e-07
3a98_A184 DOCK2, dedicator of cytokinesis protein 2; protein 1e-06
3i5r_A83 Phosphatidylinositol 3-kinase regulatory subunit a 3e-06
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 2e-05
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 2e-04
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 4e-04
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 5e-04
>3qye_A TBC1 domain family member 1; rabgap, RAB, myocytes, hydrolase activator; 2.20A {Homo sapiens} PDB: 3qyb_A Length = 331 Back     alignment and structure
 Score =  178 bits (452), Expect = 1e-49
 Identities = 71/346 (20%), Positives = 120/346 (34%), Gaps = 77/346 (22%)

Query: 69  GFRVEEEDGPEQNSNKLLSEPFIEDPQHRLQ-WVAYLEFNSSSANSPGKEESEALTWDNL 127
           G  +  E+       KL  E      +     W   L                  T    
Sbjct: 1   GSHMASENDLLNKRLKLDYEEITPCLKEVTTVWEKMLS-----------------TPGRS 43

Query: 128 GVISRTDKLRSMTRQGIPHSLRPQLWLRLSGALEKKALSKIK-------YQDIVKASSSD 180
            +    +K+ S   QG+P   R ++W  L+     K     K       Y++++K  +S 
Sbjct: 44  KIKFDMEKMHSAVGQGVPRHHRGEIWKFLAEQFHLKHQFPSKQQPKDVPYKELLKQLTSQ 103

Query: 181 ALAFAKQIEKDLLRTMPTNACFSTFSSTGVPRLRRILRALAWLFPDIG-----GVVNALD 235
                  I  DL RT PT+  FS     G   L  IL+A + L  ++G       V  + 
Sbjct: 104 Q----HAILIDLGRTFPTHPYFSAQLGAGQLSLYNILKAYSLLDQEVGYCQGLSFVAGIL 159

Query: 236 FGSRGWWFESKRKVKRQKSILQNLIFGEEENG--------EDIKTKNIHQT---GIQADQ 284
                                  L+   EE           D+  +  ++     +Q   
Sbjct: 160 -----------------------LLHMSEEEAFKMLKFLMFDMGLRKQYRPDMIILQIQM 196

Query: 285 KVLRSLVASGLPQLEVSLLQHDIELSLITLHWFLTLFASVVHFKILLRIWDLLFLDGSIV 344
             L  L+      L   L +H+I  SL    WFLT+FAS      + R++D++FL G+ V
Sbjct: 197 YQLSRLLHDYHRDLYNHLEEHEIGPSLYAAPWFLTMFASQFPLGFVARVFDMIFLQGTEV 256

Query: 345 LF-------HSCEPVLVTLENSAEIFNALSDIPGD--IVDIDNLLE 381
           +F        S +P+++  EN   I + +     +  +V ++  + 
Sbjct: 257 IFKVALSLLGSHKPLILQHENLETIVDFIKSTLPNLGLVQMEKTIN 302
>3hzj_A Rabgap1L, RAB GTPase-activating protein 1-like; structural genomics consortium, SGC, alternative splicing, GTPase activation, phosphoprotein; 2.30A {Homo sapiens} Length = 310 Back     alignment and structure
>2qq8_A TBC1 domain family member 14; structural genomics consortium, RAB-GAP, SGC, GTPase activation, hydrolase activator; 2.00A {Homo sapiens} Length = 334 Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2qfz_A TBC1 domain family member 22A; RAB-GAP, GTPase activator, structural genomics, structural genomics consortium, SGC, hydrolase activator; 2.10A {Homo sapiens} PDB: 3dzx_A Length = 345 Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Length = 68 Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Length = 73 Back     alignment and structure
>1fkm_A Protein (GYP1P), ORF YOR070C; GAP, YPT/RAB protein, vesicular trafficking, endocytosis, hydrolase, GTPase activation; 1.90A {Saccharomyces cerevisiae} SCOP: a.69.2.1 a.69.2.1 PDB: 2g77_A* Length = 396 Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Length = 68 Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 76 Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 74 Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 68 Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} Length = 73 Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Length = 62 Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Length = 76 Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Length = 80 Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Length = 73 Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 81 Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Length = 58 Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Length = 60 Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Length = 65 Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 70 Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 72 Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 69 Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Length = 73 Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>3qwl_A TBC1 domain family member 7; RAB GTPase activation, structural genomics consortium, TBC D SGC, hydrolase activator; 1.90A {Homo sapiens} Length = 294 Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Length = 58 Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Length = 58 Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Length = 58 Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Length = 58 Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Length = 65 Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Length = 65 Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 98 Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Length = 62 Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Length = 64 Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Length = 69 Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Length = 60 Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Length = 60 Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} PDB: 2d1x_A Length = 65 Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Length = 59 Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Length = 62 Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Length = 58 Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Length = 58 Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Length = 67 Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Length = 60 Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Length = 83 Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 62 Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Length = 69 Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Length = 58 Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Length = 74 Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Length = 61 Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Length = 64 Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 93 Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Length = 60 Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Length = 65 Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Length = 71 Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 69 Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Length = 54 Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 80 Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Length = 67 Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Length = 59 Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Length = 72 Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Length = 120 Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Length = 64 Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Length = 77 Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Length = 73 Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Length = 63 Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Length = 69 Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} Length = 67 Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Length = 57 Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Length = 73 Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Length = 142 Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Length = 89 Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Length = 93 Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} PDB: 3h0i_A 3h0f_A* Length = 73 Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Length = 68 Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Length = 70 Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Length = 108 Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Length = 67 Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Length = 60 Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Length = 115 Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 79 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Length = 341 Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 69 Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Length = 58 Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Length = 67 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A 1qwf_A 1prl_C ... Length = 84 Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Length = 92 Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 80 Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 58 Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Length = 71 Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Length = 63 Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Length = 65 Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Length = 70 Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Length = 79 Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Length = 71 Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Length = 69 Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Length = 58 Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 96 Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Length = 71 Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Length = 77 Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Length = 486 Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Length = 86 Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Length = 68 Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Length = 62 Back     alignment and structure
>3cwz_B RAB6IP1, RAB6-interacting protein 1; RAB small GTPase, RAB-binding domain, guanosine 5' triphosphate, RUN, RPIP8, UNC-14, nesca PLAT; HET: GTP; 3.20A {Mus musculus} Length = 384 Back     alignment and structure
>3cwz_B RAB6IP1, RAB6-interacting protein 1; RAB small GTPase, RAB-binding domain, guanosine 5' triphosphate, RUN, RPIP8, UNC-14, nesca PLAT; HET: GTP; 3.20A {Mus musculus} Length = 384 Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Length = 65 Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 213 Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Length = 109 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Length = 466 Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Length = 62 Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Length = 108 Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} PDB: 2kt1_A Length = 90 Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Length = 60 Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Length = 62 Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Length = 90 Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2dwk_A Protein RUFY3; RUN domain, effector, RAP2, bundle, protein binding, structural genomics, NPPSFA; 2.00A {Mus musculus} PDB: 2dwg_A 2cxf_A 2cxl_A Length = 180 Back     alignment and structure
>2dwk_A Protein RUFY3; RUN domain, effector, RAP2, bundle, protein binding, structural genomics, NPPSFA; 2.00A {Mus musculus} PDB: 2dwg_A 2cxf_A 2cxl_A Length = 180 Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Length = 67 Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Length = 283 Back     alignment and structure
>1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 92 Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Length = 184 Back     alignment and structure
>3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Length = 83 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Length = 78 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query940
3hzj_A310 Rabgap1L, RAB GTPase-activating protein 1-like; st 100.0
3qye_A331 TBC1 domain family member 1; rabgap, RAB, myocytes 100.0
2qq8_A334 TBC1 domain family member 14; structural genomics 100.0
2qfz_A345 TBC1 domain family member 22A; RAB-GAP, GTPase act 100.0
1fkm_A396 Protein (GYP1P), ORF YOR070C; GAP, YPT/RAB protein 100.0
4hl4_A292 TBC1 domain family member 20; rabgap, RAB1B, hydro 99.97
3qwl_A294 TBC1 domain family member 7; RAB GTPase activation 99.92
4giw_A198 RUN and SH3 domain-containing protein 1; NGF-TRKA 99.9
4giw_A198 RUN and SH3 domain-containing protein 1; NGF-TRKA 99.53
2lx7_A60 GAS-7, growth arrest-specific protein 7; structura 99.47
2dwk_A180 Protein RUFY3; RUN domain, effector, RAP2, bundle, 99.45
2lj0_A65 Sorbin and SH3 domain-containing protein 1; R85FL, 99.41
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} 99.35
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 99.35
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.34
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 99.34
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 99.34
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 99.34
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 99.34
2j6f_A62 CD2-associated protein; metal-binding, immune resp 99.34
1uti_A58 GRB2-related adaptor protein 2; signaling protein 99.33
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 99.33
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 99.33
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 99.33
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 99.33
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 99.32
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 99.32
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 99.32
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 99.32
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 99.32
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 99.32
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 99.31
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 99.31
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 99.31
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 99.31
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 99.3
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 99.3
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 99.3
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 99.3
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 99.3
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 99.3
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 99.3
3u23_A65 CD2-associated protein; structural genomics, struc 99.3
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 99.3
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 99.3
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 99.3
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 99.3
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 99.29
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 99.29
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 99.29
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 99.28
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 99.28
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 99.28
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 99.28
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 99.28
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 99.28
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 99.28
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 99.27
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 99.27
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 99.27
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.27
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 99.27
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 99.27
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 99.27
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 99.27
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 99.26
2da9_A70 SH3-domain kinase binding protein 1; structural ge 99.26
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 99.26
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 99.26
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 99.26
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 99.26
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 99.26
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 99.26
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 99.26
4glm_A72 Dynamin-binding protein; SH3 domain, DNMBP, struct 99.26
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 99.26
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 99.26
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 99.25
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 99.25
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 99.25
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 99.25
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 99.25
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 99.25
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 99.25
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 99.25
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 99.25
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 99.25
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 99.25
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 99.24
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 99.24
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 99.24
2dil_A69 Proline-serine-threonine phosphatase-interacting p 99.24
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 99.24
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 99.24
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 99.24
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 99.24
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 99.24
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 99.24
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 99.24
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 99.24
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 99.23
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 99.23
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 99.23
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 99.23
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 99.23
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 99.23
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 99.23
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 99.23
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 99.23
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 99.23
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 99.23
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 99.23
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 99.23
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 99.23
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 99.22
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 99.22
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 99.22
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 99.22
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 99.22
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 99.22
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 99.22
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 99.22
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 99.22
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 99.22
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 99.22
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 99.22
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 99.21
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 99.21
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 99.21
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 99.21
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 99.21
1i07_A60 Epidermal growth factor receptor kinase substrate 99.21
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 99.21
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 99.21
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 99.21
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 99.21
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 99.2
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 99.2
2cuc_A70 SH3 domain containing ring finger 2; structural ge 99.2
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 99.2
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 99.2
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 99.19
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 99.19
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 99.19
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 99.19
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 99.19
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 99.18
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 99.18
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 99.18
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 99.17
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 99.17
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 99.17
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 99.17
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 99.16
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 99.16
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 99.16
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 99.16
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 99.15
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 99.15
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 99.15
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 99.14
1wxb_A68 Epidermal growth factor receptor pathway substrate 99.13
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 99.13
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 99.13
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 99.12
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 99.12
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 99.12
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 99.12
2m0y_A74 Dedicator of cytokinesis protein 1; apoptosis; NMR 99.12
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 99.11
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 99.1
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 99.09
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 99.07
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 99.06
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 99.06
3i5r_A83 Phosphatidylinositol 3-kinase regulatory subunit a 99.06
1awj_A77 ITK; transferase, regulatory intramolecular comple 99.05
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 99.04
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.04
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 99.01
2dwk_A180 Protein RUFY3; RUN domain, effector, RAP2, bundle, 98.97
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 98.96
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 98.96
3jv3_A283 Intersectin-1; SH3 domain, DH domain, guanine nucl 98.95
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 98.95
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 98.92
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 98.88
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 98.39
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 98.87
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 98.84
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 98.84
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 98.8
3a98_A184 DOCK2, dedicator of cytokinesis protein 2; protein 98.78
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 98.77
2de0_X526 Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran 98.75
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 98.74
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 98.72
1v1c_A71 Obscurin; muscle, sarcomere, adapter, myogenesis, 98.69
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 98.68
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 98.11
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 98.62
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 98.61
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 98.6
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 98.55
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 98.52
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 98.51
1u3o_A82 Huntingtin-associated protein-interacting protein; 98.51
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 98.46
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 98.39
1kjw_A295 Postsynaptic density protein 95; protein-protein i 98.31
3pvl_A655 Myosin VIIA isoform 1; protein complex, novel fold 98.21
1ri9_A102 FYN-binding protein; SH3-like, helically extended, 98.19
4dey_A337 Voltage-dependent L-type calcium channel subunit; 98.06
2gtj_A96 FYN-binding protein; SH3, redox, signaling protein 97.96
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 97.86
1ug1_A92 KIAA1010 protein; structural genomics, SH3 domain, 97.79
3cwz_B384 RAB6IP1, RAB6-interacting protein 1; RAB small GTP 97.72
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 97.59
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 97.57
2xkx_A721 Disks large homolog 4; structural protein, scaffol 97.57
3kfv_A308 Tight junction protein ZO-3; structural genomics c 97.49
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 97.33
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 97.25
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 97.12
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 97.07
3r6n_A450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 95.63
3cwz_B 384 RAB6IP1, RAB6-interacting protein 1; RAB small GTP 94.36
2krs_A74 Probable enterotoxin; all beta, SH3, ENTD, CPF_058 85.47
2kt8_A76 Probable surface protein; SH3 family, structural g 85.1
>3hzj_A Rabgap1L, RAB GTPase-activating protein 1-like; structural genomics consortium, SGC, alternative splicing, GTPase activation, phosphoprotein; 2.30A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=2.5e-40  Score=366.50  Aligned_cols=265  Identities=22%  Similarity=0.394  Sum_probs=227.0

Q ss_pred             HHHHHHHHhcCCCCCCCCccccccccccccccCCChHHHHHHHhcCCCCChhHHHHHHHhccHHHHhhCHHHHHHHHHhc
Q psy11360         98 LQWVAYLEFNSSSANSPGKEESEALTWDNLGVISRTDKLRSMTRQGIPHSLRPQLWLRLSGALEKKALSKIKYQDIVKAS  177 (940)
Q Consensus        98 ~kW~~~l~~~~~~~~~~~~~~~~~~~W~~~~~~~~~~kLk~lir~GIP~~lR~~vW~~Llg~~~~~~~~~~~Y~~l~~~~  177 (940)
                      .+|.+|+.                 +|+++. ..++++|++++|+|||+++|+.||+.++|+.... ...+.|..++.+.
T Consensus         6 ~~W~~~~~-----------------~w~~~~-~~~~~~l~~l~~~GIP~~lR~~vW~~llg~~~~~-~~~~~Y~~l~~~~   66 (310)
T 3hzj_A            6 YSWGELLG-----------------KWHSNL-GARPKGLSTLVKSGVPEALRAEVWQLLAGCHDNQ-AMLDRYRILITKD   66 (310)
T ss_dssp             CCHHHHHH-----------------HHHTST-TSCCTTHHHHHHHCCCGGGHHHHHHHHTTCCCCH-HHHHHHHHHTTSC
T ss_pred             HHHHHHHH-----------------HHhhhc-ccCHHHHHHHHHCCCCHHHHHHHHHHHHCCCcch-hHHHHHHHHHhcc
Confidence            35999997                 566543 3577999999999999999999999999985322 1246788886553


Q ss_pred             cCchhHHHHHHHHhhhhcCCCCccccCCCCCChhHHhhhhhhheeecCCCc---cc--ceecccCCccceehhhhHHHhh
Q psy11360        178 SSDALAFAKQIEKDLLRTMPTNACFSTFSSTGVPRLRRILRALAWLFPDIG---GV--VNALDFGSRGWWFESKRKVKRQ  252 (940)
Q Consensus       178 ~~~~~~~~~qIekDl~RT~p~~~~F~~~~~~~~~~L~rIL~Aya~~np~iG---gm--Iaa~~~~~~~~~~~~~~~~~~~  252 (940)
                      .    +..++|++||.||+|++++|...++.+++.|+|||.|||.+||++|   ||  |||+                  
T Consensus        67 ~----~~~~~I~~Dv~Rt~p~~~~f~~~~~~~~~~L~~IL~ay~~~~p~igY~QGm~~iaa~------------------  124 (310)
T 3hzj_A           67 S----AQESVITRDIHRTFPAHDYFKDTGGDGQESLYKICKAYSVYDEDIGYCQGQSFLAAV------------------  124 (310)
T ss_dssp             C----TTHHHHHHHHTTSSTTSTTTSSTTSHHHHHHHHHHHHHHHHCTTTCSCTTHHHHHHH------------------
T ss_pred             C----CcHHHHHHHHHhhCCCchhhcCCCchhHHHHHHHHHHHHHHCCCCCccCCHHHHHHH------------------
Confidence            2    4578999999999999999998777899999999999999999999   88  9999                  


Q ss_pred             hhhhhhhhccCcccc----cccc----cCCcc---cccchhhHHHHHHHHHhhchhHHHHHhhcCCcchhHHHHHHHHhh
Q psy11360        253 KSILQNLIFGEEENG----EDIK----TKNIH---QTGIQADQKVLRSLVASGLPQLEVSLLQHDIELSLITLHWFLTLF  321 (940)
Q Consensus       253 ~~~~~LLl~~~Ee~A----~~ll----~~~y~---~~gi~~~~~v~~~Ll~~~~P~L~~hL~~~~i~~~l~~~~WfltLF  321 (940)
                           +|++++|++|    ..+|    .+++|   +.|++..+.+++.+++.++|+|++||++.|+++.+|+++||+|+|
T Consensus       125 -----lL~~~~e~~aF~~l~~l~~~~~~~~~~~~~~~~~~~~~~~l~~ll~~~~p~L~~hL~~~~i~~~~~~~~W~ltlF  199 (310)
T 3hzj_A          125 -----LLLHMPEEQAFCVLVKIMYDYGLRDLYRNNFEDLHCKFYQLERLMQEQLPDLHSHFSDLNLEAHMYASQWFLTLF  199 (310)
T ss_dssp             -----HHHHSCHHHHHHHHHHHHHTSCGGGGTHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHTCCGGGTSHHHHHHTT
T ss_pred             -----HHHhCCHHHHHHHHHHHHhcccccccccccHHHHHHHHHHHHHHHHHhChHHHHHHHHcCCChHHHHHHHHHHHH
Confidence                 9999999999    3333    34556   889999999999999999999999999999999999999999999


Q ss_pred             ccccchhhHHHHHHHHHHhChHHHH-------HhhHHHHhcCCCHHHHHHHhh-CCCCCCccchhhhhhhHHHhhhccCC
Q psy11360        322 ASVVHFKILLRIWDLLFLDGSIVLF-------HSCEPVLVTLENSAEIFNALS-DIPGDIVDIDNLLEVGAEIFNALSDI  393 (940)
Q Consensus       322 ~~~lp~~~vlRIWD~fl~eG~~vlf-------k~~~~~Ll~~~d~~ei~~~L~-~lp~~~~d~~~~~~~~~~~~~~~~~~  393 (940)
                      +++||++.++||||+||++|.+++|       +.+++.|+++ |+++++.+|+ ++|....+.                 
T Consensus       200 ~~~lp~~~~~riwD~~l~~g~~~l~~v~lail~~~~~~Ll~~-d~~~~l~~l~~~lp~~~~~~-----------------  261 (310)
T 3hzj_A          200 TAKFPLCMVFHIIDLLLCEGLNIIFHVALALLKTSKEDLLQA-DFEGALKFFRVQLPKRYRAE-----------------  261 (310)
T ss_dssp             TTTSCHHHHHHHHHHHHHHCTTHHHHHHHHHHHHTHHHHHTC-CHHHHHHHHHTHHHHTTCSH-----------------
T ss_pred             hccCCHHHHHHHHHHHHHCCcHHHHHHHHHHHHHHHHHHHcC-CHHHHHHHHHHhCccccccc-----------------
Confidence            9999999999999999999999987       6678899997 8999999997 566654311                 


Q ss_pred             CCCCCCHHHHHHHHHhccCCCCHHHHHHHHHHHHHHHhh
Q psy11360        394 PGDIVDIDNLLEVSFSVSTSISQSLIDSHRRRHLAFLMS  432 (940)
Q Consensus       394 p~~~~d~d~Li~~A~~~~~~is~~~i~~~r~~~~~~l~~  432 (940)
                          .|++.|++.|+++  +++.+.|.+++++|.+.-..
T Consensus       262 ----~d~~~ll~~A~~l--~~~~~~l~~~~~ey~~~~~~  294 (310)
T 3hzj_A          262 ----ENARRLMEQACNI--KVPTKKLKKYEKEYQTMRES  294 (310)
T ss_dssp             ----HHHHHHHHHHHHS--CCCHHHHHHHHHHHHHHC--
T ss_pred             ----ccHHHHHHHHHhc--CCCHHHHHHHHHHHHHHHHH
Confidence                2899999999999  69999999999999884433
>3qye_A TBC1 domain family member 1; rabgap, RAB, myocytes, hydrolase activator; 2.20A {Homo sapiens} PDB: 3qyb_A Back     alignment and structure
>2qq8_A TBC1 domain family member 14; structural genomics consortium, RAB-GAP, SGC, GTPase activation, hydrolase activator; 2.00A {Homo sapiens} Back     alignment and structure
>2qfz_A TBC1 domain family member 22A; RAB-GAP, GTPase activator, structural genomics, structural genomics consortium, SGC, hydrolase activator; 2.10A {Homo sapiens} PDB: 3dzx_A Back     alignment and structure
>1fkm_A Protein (GYP1P), ORF YOR070C; GAP, YPT/RAB protein, vesicular trafficking, endocytosis, hydrolase, GTPase activation; 1.90A {Saccharomyces cerevisiae} SCOP: a.69.2.1 a.69.2.1 PDB: 2g77_A* Back     alignment and structure
>4hl4_A TBC1 domain family member 20; rabgap, RAB1B, hydrolase activator, catalytic domain, F GTPase-activating proteins, RAB GTP-binding protein, GTP HY; 2.20A {Homo sapiens} PDB: 4hlq_A* Back     alignment and structure
>3qwl_A TBC1 domain family member 7; RAB GTPase activation, structural genomics consortium, TBC D SGC, hydrolase activator; 1.90A {Homo sapiens} Back     alignment and structure
>4giw_A RUN and SH3 domain-containing protein 1; NGF-TRKA signaling pathway, NF-KB pathway, signaling protein; 2.00A {Homo sapiens} Back     alignment and structure
>4giw_A RUN and SH3 domain-containing protein 1; NGF-TRKA signaling pathway, NF-KB pathway, signaling protein; 2.00A {Homo sapiens} Back     alignment and structure
>2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2dwk_A Protein RUFY3; RUN domain, effector, RAP2, bundle, protein binding, structural genomics, NPPSFA; 2.00A {Mus musculus} PDB: 2dwg_A 2cxf_A 2cxl_A Back     alignment and structure
>2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Back     alignment and structure
>2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Back     alignment and structure
>3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Back     alignment and structure
>2dwk_A Protein RUFY3; RUN domain, effector, RAP2, bundle, protein binding, structural genomics, NPPSFA; 2.00A {Mus musculus} PDB: 2dwg_A 2cxf_A 2cxl_A Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Back     alignment and structure
>1ri9_A FYN-binding protein; SH3-like, helically extended, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Back     alignment and structure
>2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3cwz_B RAB6IP1, RAB6-interacting protein 1; RAB small GTPase, RAB-binding domain, guanosine 5' triphosphate, RUN, RPIP8, UNC-14, nesca PLAT; HET: GTP; 3.20A {Mus musculus} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Back     alignment and structure
>3cwz_B RAB6IP1, RAB6-interacting protein 1; RAB small GTPase, RAB-binding domain, guanosine 5' triphosphate, RUN, RPIP8, UNC-14, nesca PLAT; HET: GTP; 3.20A {Mus musculus} Back     alignment and structure
>2krs_A Probable enterotoxin; all beta, SH3, ENTD, CPF_0587, CPE0606, structural genomics, PSI-2, protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>2kt8_A Probable surface protein; SH3 family, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; NMR {Clostridium perfringens} PDB: 2kyb_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 940
d2cxfa1167 a.256.1.1 (A:83-249) Rap2 interacting protein X (R 6e-21
d2cxfa1167 a.256.1.1 (A:83-249) Rap2 interacting protein X (R 2e-14
d1ujya_76 b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens 2e-18
d1uj0a_58 b.34.2.1 (A:) Signal transducing adaptor molecule 4e-18
d1udla_98 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 8e-18
d1sema_58 b.34.2.1 (A:) Growth factor receptor-bound protein 2e-17
d1awwa_67 b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Hom 4e-17
d1utia_57 b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona 5e-17
d1ugva_72 b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA062 5e-17
d1ue9a_80 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 5e-17
d1j3ta_74 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 6e-17
d1k4us_62 b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId 7e-17
d1oota_58 b.34.2.1 (A:) Hypothetical protein YFR024c {Baker' 2e-16
d1spka_72 b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RI 4e-16
d1gcqa_56 b.34.2.1 (A:) Growth factor receptor-bound protein 4e-16
d1uhfa_69 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 4e-16
d1u06a155 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chic 8e-16
d1jo8a_58 b.34.2.1 (A:) Actin binding protein ABP1 {Baker's 8e-16
d1arka_60 b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo 1e-15
d1i07a_59 b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus 1e-15
d2hspa_71 b.34.2.1 (A:) Phospholipase C, SH3 domain {Human ( 2e-15
d1gria156 b.34.2.1 (A:1-56) Growth factor receptor-bound pro 2e-15
d1ng2a158 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic 3e-15
d1uffa_93 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 6e-15
d1ycsb263 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [ 2e-14
d1ng2a2118 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic 2e-14
d1ckaa_57 b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse 3e-14
d1wlpb153 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic 3e-14
d1u5sa171 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [Tax 1e-13
d1fmka164 b.34.2.1 (A:82-145) c-src protein tyrosine kinase 1e-13
d2v1ra167 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pe 2e-13
d1uhca_79 b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA 2e-13
d1fkma2188 a.69.2.1 (A:443-630) Ypt/Rab-GAP domain of gyp1p { 2e-13
d1opka157 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domai 2e-13
d1efna_57 b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, 5e-13
d1qcfa165 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Hu 6e-13
d1gl5a_67 b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musc 8e-13
d1k9aa171 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (cs 9e-13
d1fkma1194 a.69.2.1 (A:249-442) Ypt/Rab-GAP domain of gyp1p { 1e-12
d1bb9a_83 b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicu 1e-12
d2iima162 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 d 2e-12
d1zuua156 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyc 1e-11
d1phta_83 b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-a 5e-11
d2rn8a153 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus 8e-11
d1kjwa196 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicu 2e-10
d1wiea_96 b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human 2e-10
d1wfwa_74 b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [Ta 4e-10
d1i1ja_106 b.34.2.1 (A:) Melanoma inhibitory activity protein 6e-10
d1t0ha_96 b.34.2.1 (A:) SH3-like domain of the L-type calciu 8e-10
d1gcqc_69 b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mu 1e-09
d1vyva1145 b.34.2.1 (A:71-215) SH3-like domain of the L-type 4e-09
d1ug1a_92 b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA 7e-08
d1vyua1136 b.34.2.1 (A:39-174) SH3-like domain of the L-type 3e-05
>d2cxfa1 a.256.1.1 (A:83-249) Rap2 interacting protein X (RUFY3) {Mouse (Mus musculus) [TaxId: 10090]} Length = 167 Back     information, alignment and structure

class: All alpha proteins
fold: RUN domain-like
superfamily: RUN domain-like
family: RUN domain
domain: Rap2 interacting protein X (RUFY3)
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 88.8 bits (220), Expect = 6e-21
 Identities = 23/175 (13%), Positives = 51/175 (29%), Gaps = 36/175 (20%)

Query: 601 SLAGDDSVTETITDLVRGTLCPALKQILSCGLKRRA--LGEVCHPWLFIEEVATREVEKD 658
           +L    ++      L +      ++  L  GLK +   LG+    W  +E V        
Sbjct: 23  ALNLGRTLDSDYAPLQQ--FFVVMEHCLKHGLKAKKTFLGQNKSFWGPLELVEK------ 74

Query: 659 FTSVYSRLLLCKTYRLDEDGKVLTPEELLYRCVQAVNQSHDMAHVQMDVKFRSLICLGLN 718
                                V    E+             +         R+ + L L 
Sbjct: 75  --------------------LVPEAAEITASVKDLPGLKTPVGR------GRAWLRLALM 108

Query: 719 EQVLHLWLEVLCSCEPVVLKWYHPWSFISSPGWVQVKCDLRVLSQFPFNLSPDWE 773
           ++ L  +++ L + + ++ ++Y   + +       +   L  L+    N     E
Sbjct: 109 QKKLSEYMKALINKKELLSEFYEVNALMMEEEGAIIAGLLVGLNVIDANFCMKGE 163
>d2cxfa1 a.256.1.1 (A:83-249) Rap2 interacting protein X (RUFY3) {Mouse (Mus musculus) [TaxId: 10090]} Length = 167 Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Length = 58 Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 69 Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 55 Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 67 Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1fkma2 a.69.2.1 (A:443-630) Ypt/Rab-GAP domain of gyp1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 188 Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1fkma1 a.69.2.1 (A:249-442) Ypt/Rab-GAP domain of gyp1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 83 Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 96 Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Length = 74 Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 96 Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 69 Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query940
d1fkma1194 Ypt/Rab-GAP domain of gyp1p {Baker's yeast (Saccha 99.69
d2cxfa1167 Rap2 interacting protein X (RUFY3) {Mouse (Mus mus 99.61
d1fkma2188 Ypt/Rab-GAP domain of gyp1p {Baker's yeast (Saccha 99.57
d1utia_57 Grb2-related adaptor protein 2 (Mona/Gads) {Mouse 99.46
d1gcqa_56 Growth factor receptor-bound protein 2 (GRB2), N- 99.44
d1sema_58 Growth factor receptor-bound protein 2 (GRB2), N- 99.44
d1uj0a_58 Signal transducing adaptor molecule Stam2 {Mouse ( 99.42
d1k4us_62 p67phox {Human (Homo sapiens) [TaxId: 9606]} 99.41
d1u06a155 alpha-Spectrin, SH3 domain {Chicken (Gallus gallus 99.4
d1ng2a158 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.39
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.38
d1ujya_76 Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 99.37
d1j3ta_74 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.37
d1wlpb153 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.36
d1jo8a_58 Actin binding protein ABP1 {Baker's yeast (Sacchar 99.34
d1oota_58 Hypothetical protein YFR024c {Baker's yeast (Sacch 99.34
d1ckaa_57 C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) 99.33
d2rn8a153 Bruton's tyrosine kinase {Mus musculus [TaxId: 100 99.31
d1gria156 Growth factor receptor-bound protein 2 (GRB2), N- 99.31
d2v1ra167 Peroxisomal membrane protein Pex13p {Baker's yeast 99.3
d1arka_60 SH3 domain from nebulin {Human (Homo sapiens) [Tax 99.3
d1ng2a2118 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.29
d1ycsb263 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.29
d1ue9a_80 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.29
d1ugva_72 Olygophrenin-1 like protein (KIAA0621) {Human (Hom 99.28
d1gl5a_67 tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 99.28
d1opka157 Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul 99.28
d1i07a_59 EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 99.28
d1uhfa_69 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.25
d1awwa_67 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 99.25
d2hspa_71 Phospholipase C, SH3 domain {Human (Homo sapiens) 99.25
d1spka_72 BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 99.24
d1k9aa171 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.23
d1efna_57 Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu 99.22
d1uffa_93 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.21
d1uhca_79 Hypothetical protein Baa76854.1 (KIAA1010) {Human 99.2
d1u5sa171 Nck-2 {Human (Homo sapiens) [TaxId: 9606]} 99.2
d1fmka164 c-src protein tyrosine kinase {Human (Homo sapiens 99.2
d1phta_83 Phosphatidylinositol 3-kinase (p85-alpha subunit, 99.2
d1wfwa_74 Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} 99.2
d1ug1a_92 Hypothetical protein Baa76854.1 (KIAA1010) {Human 99.19
d1bb9a_83 Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 99.18
d1zuua156 BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.17
d1qcfa165 Hemapoetic cell kinase Hck {Human (Homo sapiens) [ 99.16
d1wiea_96 RIM binding protein 2, RIMBP2 {Human (Homo sapiens 99.13
d1gcqc_69 Vav N-terminal SH3 domain {Mouse (Mus musculus) [T 99.13
d1kjwa196 Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.12
d2iima162 p56-lck tyrosine kinase, SH3 domain {Human (Homo s 99.1
d1i1ja_106 Melanoma inhibitory activity protein {Human (Homo 99.08
d1t0ha_96 SH3-like domain of the L-type calcium channel {Rab 99.06
d2cxfa1167 Rap2 interacting protein X (RUFY3) {Mouse (Mus mus 98.84
d1vyva1145 SH3-like domain of the L-type calcium channel {Rat 98.79
d1vyua1136 SH3-like domain of the L-type calcium channel {Rat 98.46
d1ri9a_77 Fyn-binding protein (T-cell adapter protein adap) 83.46
>d1fkma1 a.69.2.1 (A:249-442) Ypt/Rab-GAP domain of gyp1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: Left-handed superhelix
superfamily: Ypt/Rab-GAP domain of gyp1p
family: Ypt/Rab-GAP domain of gyp1p
domain: Ypt/Rab-GAP domain of gyp1p
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.69  E-value=1e-17  Score=170.44  Aligned_cols=118  Identities=28%  Similarity=0.351  Sum_probs=94.1

Q ss_pred             hhHHHHHHHHHHhcCCCCCCCCccccccccccccccCCChHHHHHHHhcCCCCChhHHHHHHHhccH--------HHHhh
Q psy11360         94 PQHRLQWVAYLEFNSSSANSPGKEESEALTWDNLGVISRTDKLRSMTRQGIPHSLRPQLWLRLSGAL--------EKKAL  165 (940)
Q Consensus        94 ~~~~~kW~~~l~~~~~~~~~~~~~~~~~~~W~~~~~~~~~~kLk~lir~GIP~~lR~~vW~~Llg~~--------~~~~~  165 (940)
                      .++-.+|..+|...                     ...+.++||+++++|||+++|+.||+.++|+.        .....
T Consensus         4 ~~~i~~~~~~l~~~---------------------~~i~~~~lr~l~~~Gip~~lR~~vW~~llg~~~~~~~~~~~~~~~   62 (194)
T d1fkma1           4 IQRISKFDNILKDK---------------------TIINQQDLRQISWNGIPKIHRPVVWKLLIGYLPVNTKRQEGFLQR   62 (194)
T ss_dssp             HHHHHHHHHHHSSC---------------------SBCCHHHHHHHHTTCCCGGGHHHHHHHHTTCSCSBGGGHHHHHHH
T ss_pred             HHHHHHHHHHhccc---------------------CCCCHHHHHHHHHcCCChHHHHHHHHHHHhhcCCchhhHHHHHHH
Confidence            35666898888521                     24577999999999999999999999999963        22233


Q ss_pred             CHHHHHHHHHhcc----CchhHHHHHHHHhhhhcCCCCccccCCCCCChhHHhhhhhhheeecCCCc---cc--ceec
Q psy11360        166 SKIKYQDIVKASS----SDALAFAKQIEKDLLRTMPTNACFSTFSSTGVPRLRRILRALAWLFPDIG---GV--VNAL  234 (940)
Q Consensus       166 ~~~~Y~~l~~~~~----~~~~~~~~qIekDl~RT~p~~~~F~~~~~~~~~~L~rIL~Aya~~np~iG---gm--Iaa~  234 (940)
                      ....|........    ..+....+||++||.||+|++++|.+  +.++..|+|||.|||.+||++|   ||  |||+
T Consensus        63 ~~~~y~~~~~~~~~~~~~~~~~~~~~I~~Dv~RT~~~~~~f~~--~~~~~~L~rIL~~ya~~np~~gY~QGmn~i~a~  138 (194)
T d1fkma1          63 KRKEYRDSLKHTFSDQHSRDIPTWHQIEIDIPRTNPHIPLYQF--KSVQNSLQRILYLWAIRHPASGYVQGINDLVTP  138 (194)
T ss_dssp             HHHHHHHHHHHTSSSSCSTHHHHHHHHHHHGGGSSTTSGGGGS--HHHHHHHHHHHHHHHHHCTTTCSCTTHHHHHHH
T ss_pred             HhhhhhhhhhhhhhcccccchHHHHHHHHHHHhcCCccccccc--chhHHHHHHHHHHHHHHCCCCCeeecchHHHHH
Confidence            3455666665533    23356789999999999999999986  6789999999999999999999   88  8888
>d2cxfa1 a.256.1.1 (A:83-249) Rap2 interacting protein X (RUFY3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fkma2 a.69.2.1 (A:443-630) Ypt/Rab-GAP domain of gyp1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2cxfa1 a.256.1.1 (A:83-249) Rap2 interacting protein X (RUFY3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ri9a_ b.34.2.1 (A:) Fyn-binding protein (T-cell adapter protein adap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure