Psyllid ID: psy11512


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--
MSKSHPPELKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEYRKDNTVHNIGMVEE
cccccccHHHHHcccEEEEEEccccEEEEEEEEEccccEEEEEcEEEEEccccEEEEEEEEc
ccccccHHHHHHHHcEEEEEEccccEEEEEEccccHHHHHHHHHHHHHcccccccccccccc
mskshppelkkFMDKKVTLKLNANRNVTGILRGFDPFMNLVLdegveyrkdntvhnigmvee
mskshppelkKFMDKKVTLKLNANrnvtgilrgfdpFMNLVLDEGveyrkdntvhnigmvee
MSKSHPPELKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEYRKDNTVHNIGMVEE
***************KVTLKLNANRNVTGILRGFDPFMNLVLDEGVEYRKDNTVHN******
****HPPELKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEYRKDNTVHNIGMV**
MSKSHPPELKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEYRKDNTVHNIGMVEE
****HPPELKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEYRK************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKSHPPELKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEYRKDNTVHNIGMVEE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query62 2.2.26 [Sep-21-2011]
Q9N4G977 Probable small nuclear ri yes N/A 0.951 0.766 0.711 3e-19
Q9VXE076 Probable small nuclear ri yes N/A 0.967 0.789 0.733 4e-19
P6230976 Small nuclear ribonucleop yes N/A 0.967 0.789 0.716 1e-18
P6230876 Small nuclear ribonucleop yes N/A 0.967 0.789 0.716 1e-18
Q3ZBL076 Small nuclear ribonucleop yes N/A 0.967 0.789 0.716 1e-18
A8MWD976 Small nuclear ribonucleop no N/A 0.983 0.802 0.704 3e-18
O8222180 Probable small nuclear ri yes N/A 0.951 0.737 0.639 1e-12
P2471581 Probable small nuclear ri N/A N/A 0.935 0.716 0.525 5e-10
O7496677 Small nuclear ribonucleop yes N/A 0.967 0.779 0.45 6e-10
Q54RX085 Probable small nuclear ri yes N/A 0.935 0.682 0.517 2e-09
>sp|Q9N4G9|RUXG_CAEEL Probable small nuclear ribonucleoprotein G OS=Caenorhabditis elegans GN=snr-7 PE=3 SV=1 Back     alignment and function desciption
 Score = 94.0 bits (232), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%)

Query: 1  MSKSHPPELKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEYRKDNTVHNIGM 59
          MSK+HPPELKK+MDK++ LKLN NR V+GILRGFDPFMN+V+DE VEY+KD    N+GM
Sbjct: 1  MSKTHPPELKKYMDKEMDLKLNGNRRVSGILRGFDPFMNMVIDEAVEYQKDGGSVNLGM 59




Associated with snRNP U1, U2, U4/U6 and U5.
Caenorhabditis elegans (taxid: 6239)
>sp|Q9VXE0|RUXG_DROME Probable small nuclear ribonucleoprotein G OS=Drosophila melanogaster GN=SmG PE=3 SV=1 Back     alignment and function description
>sp|P62309|RUXG_MOUSE Small nuclear ribonucleoprotein G OS=Mus musculus GN=Snrpg PE=1 SV=1 Back     alignment and function description
>sp|P62308|RUXG_HUMAN Small nuclear ribonucleoprotein G OS=Homo sapiens GN=SNRPG PE=1 SV=1 Back     alignment and function description
>sp|Q3ZBL0|RUXG_BOVIN Small nuclear ribonucleoprotein G OS=Bos taurus GN=SNRPG PE=3 SV=1 Back     alignment and function description
>sp|A8MWD9|RUXGL_HUMAN Small nuclear ribonucleoprotein G-like protein OS=Homo sapiens PE=2 SV=2 Back     alignment and function description
>sp|O82221|RUXG_ARATH Probable small nuclear ribonucleoprotein G OS=Arabidopsis thaliana GN=At2g23930 PE=2 SV=1 Back     alignment and function description
>sp|P24715|RUXG_MEDSA Probable small nuclear ribonucleoprotein G OS=Medicago sativa GN=C29 PE=3 SV=1 Back     alignment and function description
>sp|O74966|RUXG_SCHPO Small nuclear ribonucleoprotein G OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=smg1 PE=1 SV=1 Back     alignment and function description
>sp|Q54RX0|RUXG_DICDI Probable small nuclear ribonucleoprotein G OS=Dictyostelium discoideum GN=snrpG PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query62
30721454976 Probable small nuclear ribonucleoprotein 0.967 0.789 0.766 8e-19
35761905776 small nuclear ribonucleoprotein G [Danau 0.967 0.789 0.766 9e-19
33237680176 unknown [Dendroctonus ponderosae] 0.967 0.789 0.75 1e-18
31321753076 unnamed protein product [Oikopleura dioi 0.967 0.789 0.666 1e-18
19371371079 PREDICTED: probable small nuclear ribonu 0.967 0.759 0.733 2e-18
11405079376 small nuclear ribonucleoprotein G [Bomby 0.967 0.789 0.75 3e-18
19842743089 PREDICTED: similar to small nuclear ribo 0.967 0.674 0.716 3e-18
15654162676 PREDICTED: probable small nuclear ribonu 0.967 0.789 0.733 5e-18
194763519101 GF21254 [Drosophila ananassae] gi|190618 0.967 0.594 0.75 5e-18
42778469577 Putative small ribonucleoprotein particl 0.967 0.779 0.75 5e-18
>gi|307214549|gb|EFN89534.1| Probable small nuclear ribonucleoprotein G [Harpegnathos saltator] Back     alignment and taxonomy information
 Score = 97.8 bits (242), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 46/60 (76%), Positives = 54/60 (90%)

Query: 1  MSKSHPPELKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEYRKDNTVHNIGMV 60
          MSK+HPPELKK+MDKK++LKLNA R+VTGILRGFDPFMN+V+DE VE  KD T +NIGMV
Sbjct: 1  MSKAHPPELKKYMDKKLSLKLNAGRHVTGILRGFDPFMNMVIDETVEECKDGTKNNIGMV 60




Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|357619057|gb|EHJ71789.1| small nuclear ribonucleoprotein G [Danaus plexippus] Back     alignment and taxonomy information
>gi|332376801|gb|AEE63540.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|313217530|emb|CBY38609.1| unnamed protein product [Oikopleura dioica] gi|313236587|emb|CBY19879.1| unnamed protein product [Oikopleura dioica] Back     alignment and taxonomy information
>gi|193713710|ref|XP_001949387.1| PREDICTED: probable small nuclear ribonucleoprotein G-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|114050793|ref|NP_001040405.1| small nuclear ribonucleoprotein G [Bombyx mori] gi|95102770|gb|ABF51326.1| small nuclear ribonucleoprotein G [Bombyx mori] Back     alignment and taxonomy information
>gi|198427430|ref|XP_002130422.1| PREDICTED: similar to small nuclear ribonucleoprotein G [Ciona intestinalis] Back     alignment and taxonomy information
>gi|156541626|ref|XP_001601035.1| PREDICTED: probable small nuclear ribonucleoprotein G-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|194763519|ref|XP_001963880.1| GF21254 [Drosophila ananassae] gi|190618805|gb|EDV34329.1| GF21254 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|427784695|gb|JAA57799.1| Putative small ribonucleoprotein particle protein smg [Rhipicephalus pulchellus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query62
FB|FBgn026179176 SmG "Small ribonucleoprotein p 0.967 0.789 0.733 2.5e-19
WB|WBGene0000492077 snr-7 [Caenorhabditis elegans 0.951 0.766 0.711 2.5e-19
UNIPROTKB|Q3ZBL076 SNRPG "Small nuclear ribonucle 0.967 0.789 0.716 2.8e-18
UNIPROTKB|P6230876 SNRPG "Small nuclear ribonucle 0.967 0.789 0.716 2.8e-18
UNIPROTKB|F2Z5V276 LOC100525867 "Uncharacterized 0.967 0.789 0.716 2.8e-18
RGD|158471376 Snrpg "small nuclear ribonucle 0.967 0.789 0.716 2.8e-18
UNIPROTKB|A8MWD976 A8MWD9 "Small nuclear ribonucl 0.983 0.802 0.704 9.5e-18
ZFIN|ZDB-GENE-040912-10576 zgc:103688 "zgc:103688" [Danio 0.967 0.789 0.65 5.3e-17
TAIR|locus:206144680 SNRNP-G "AT2G23930" [Arabidops 0.951 0.737 0.639 7.9e-14
TAIR|locus:208077779 AT3G11500 "AT3G11500" [Arabido 0.951 0.746 0.622 1e-13
FB|FBgn0261791 SmG "Small ribonucleoprotein particle protein SmG" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 231 (86.4 bits), Expect = 2.5e-19, P = 2.5e-19
 Identities = 44/60 (73%), Positives = 52/60 (86%)

Query:     1 MSKSHPPELKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEYRKDNTVHNIGMV 60
             MSK+HPPE+KK+MDK++ LKLN  R VTGILRGFDPFMN+VLD+ VE  KDNT +NIGMV
Sbjct:     1 MSKAHPPEVKKYMDKRMMLKLNGGRAVTGILRGFDPFMNVVLDDTVEECKDNTKNNIGMV 60




GO:0005634 "nucleus" evidence=IDA
GO:0030532 "small nuclear ribonucleoprotein complex" evidence=ISS;IDA
GO:0005681 "spliceosomal complex" evidence=ISS
GO:0000398 "mRNA splicing, via spliceosome" evidence=IC;ISS
GO:0000245 "spliceosomal complex assembly" evidence=ISS
GO:0007052 "mitotic spindle organization" evidence=IMP
GO:0071011 "precatalytic spliceosome" evidence=IDA
GO:0071013 "catalytic step 2 spliceosome" evidence=IDA
WB|WBGene00004920 snr-7 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZBL0 SNRPG "Small nuclear ribonucleoprotein G" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P62308 SNRPG "Small nuclear ribonucleoprotein G" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5V2 LOC100525867 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1584713 Snrpg "small nuclear ribonucleoprotein polypeptide G" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A8MWD9 A8MWD9 "Small nuclear ribonucleoprotein G-like protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040912-105 zgc:103688 "zgc:103688" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2061446 SNRNP-G "AT2G23930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2080777 AT3G11500 "AT3G11500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P62309RUXG_MOUSENo assigned EC number0.71660.96770.7894yesN/A
P62308RUXG_HUMANNo assigned EC number0.71660.96770.7894yesN/A
O74966RUXG_SCHPONo assigned EC number0.450.96770.7792yesN/A
Q3ZBL0RUXG_BOVINNo assigned EC number0.71660.96770.7894yesN/A
O82221RUXG_ARATHNo assigned EC number0.63930.95160.7375yesN/A
P40204RUXG_YEASTNo assigned EC number0.520.80640.6493yesN/A
Q54RX0RUXG_DICDINo assigned EC number0.51720.93540.6823yesN/A
A8MWD9RUXGL_HUMANNo assigned EC number0.70490.98380.8026noN/A
Q9VXE0RUXG_DROMENo assigned EC number0.73330.96770.7894yesN/A
Q9N4G9RUXG_CAEELNo assigned EC number0.71180.95160.7662yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query62
cd0171970 cd01719, Sm_G, Sm protein G 2e-30
cd0172989 cd01729, LSm7, Like-Sm protein 7 5e-16
pfam0142366 pfam01423, LSM, LSM domain 7e-16
smart0065167 smart00651, Sm, snRNP Sm proteins 3e-13
cd0060063 cd00600, Sm_like, Sm and related proteins 1e-10
COG195879 COG1958, LSM1, Small nuclear ribonucleoprotein (sn 4e-10
cd0173169 cd01731, archaeal_Sm1, archaeal Sm protein 1 4e-09
cd0172791 cd01727, LSm8, Like-Sm protein 8 5e-09
cd0172668 cd01726, LSm6, Like-Sm protein 6 2e-08
cd0616873 cd06168, LSMD1, LSM domain containing 1 1e-06
cd0171879 cd01718, Sm_E, Sm protein E 1e-05
PRK0073772 PRK00737, PRK00737, small nuclear ribonucleoprotei 1e-05
cd0172874 cd01728, LSm1, Like-Sm protein 1 8e-05
PTZ0013889 PTZ00138, PTZ00138, small nuclear ribonucleoprotei 8e-05
cd0173082 cd01730, LSm3, Like-Sm protein 3 5e-04
cd0172269 cd01722, Sm_F, Sm protein F 5e-04
cd0171780 cd01717, Sm_B, Sm protein B 6e-04
cd0173276 cd01732, LSm5, Like-Sm protein 5 0.002
>gnl|CDD|212466 cd01719, Sm_G, Sm protein G Back     alignment and domain information
 Score =  100 bits (252), Expect = 2e-30
 Identities = 38/56 (67%), Positives = 45/56 (80%)

Query: 5  HPPELKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEYRKDNTVHNIGMV 60
          HPPELKK+MDK+++LKLN NR V+G+LRGFDPFMNLVLD+ VE   D     IGMV
Sbjct: 1  HPPELKKYMDKRLSLKLNGNRKVSGVLRGFDPFMNLVLDDAVEEVGDGEKTPIGMV 56


The eukaryotic Sm proteins (B/B', D1, D2, D3, E, F and G) assemble into a hetero-heptameric ring around the Sm site of the 2,2,7-trimethyl guanosine (m3G) capped U1, U2, U4 and U5 snRNAs (Sm snRNAs) forming the core of the snRNP particle. The snRNP particle, in turn, assembles with other components onto the pre-mRNA to form the spliceosome which is responsible for the excision of introns and the ligation of exons. Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. Sm subunit G binds subunits E and F to form a trimer which then assembles onto snRNA along with the D1/D2 and D3/B heterodimers forming a seven-membered ring structure. Length = 70

>gnl|CDD|212476 cd01729, LSm7, Like-Sm protein 7 Back     alignment and domain information
>gnl|CDD|201787 pfam01423, LSM, LSM domain Back     alignment and domain information
>gnl|CDD|197820 smart00651, Sm, snRNP Sm proteins Back     alignment and domain information
>gnl|CDD|212462 cd00600, Sm_like, Sm and related proteins Back     alignment and domain information
>gnl|CDD|224869 COG1958, LSM1, Small nuclear ribonucleoprotein (snRNP) homolog [Transcription] Back     alignment and domain information
>gnl|CDD|212478 cd01731, archaeal_Sm1, archaeal Sm protein 1 Back     alignment and domain information
>gnl|CDD|212474 cd01727, LSm8, Like-Sm protein 8 Back     alignment and domain information
>gnl|CDD|212473 cd01726, LSm6, Like-Sm protein 6 Back     alignment and domain information
>gnl|CDD|212486 cd06168, LSMD1, LSM domain containing 1 Back     alignment and domain information
>gnl|CDD|212465 cd01718, Sm_E, Sm protein E Back     alignment and domain information
>gnl|CDD|179104 PRK00737, PRK00737, small nuclear ribonucleoprotein; Provisional Back     alignment and domain information
>gnl|CDD|212475 cd01728, LSm1, Like-Sm protein 1 Back     alignment and domain information
>gnl|CDD|185472 PTZ00138, PTZ00138, small nuclear ribonucleoprotein; Provisional Back     alignment and domain information
>gnl|CDD|212477 cd01730, LSm3, Like-Sm protein 3 Back     alignment and domain information
>gnl|CDD|212469 cd01722, Sm_F, Sm protein F Back     alignment and domain information
>gnl|CDD|212464 cd01717, Sm_B, Sm protein B Back     alignment and domain information
>gnl|CDD|212479 cd01732, LSm5, Like-Sm protein 5 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 62
PRK0073772 small nuclear ribonucleoprotein; Provisional 99.86
cd0171972 Sm_G The eukaryotic Sm and Sm-like (LSm) proteins 99.85
cd0172981 LSm7 The eukaryotic Sm and Sm-like (LSm) proteins 99.84
cd0173168 archaeal_Sm1 The archaeal sm1 proteins: The Sm pro 99.82
cd0172667 LSm6 The eukaryotic Sm and Sm-like (LSm) proteins 99.81
cd0173276 LSm5 The eukaryotic Sm and Sm-like (LSm) proteins 99.81
cd0172268 Sm_F The eukaryotic Sm and Sm-like (LSm) proteins 99.8
KOG1780|consensus77 99.8
cd0616875 LSm9 The eukaryotic Sm and Sm-like (LSm) proteins 99.79
cd0173082 LSm3 The eukaryotic Sm and Sm-like (LSm) proteins 99.78
cd0171779 Sm_B The eukaryotic Sm and Sm-like (LSm) proteins 99.78
cd0172774 LSm8 The eukaryotic Sm and Sm-like (LSm) proteins 99.77
cd0172874 LSm1 The eukaryotic Sm and Sm-like (LSm) proteins 99.77
smart0065167 Sm snRNP Sm proteins. small nuclear ribonucleoprot 99.75
PF0142367 LSM: LSM domain ; InterPro: IPR001163 This family 99.75
COG195879 LSM1 Small nuclear ribonucleoprotein (snRNP) homol 99.74
cd0060063 Sm_like The eukaryotic Sm and Sm-like (LSm) protei 99.72
cd0171879 Sm_E The eukaryotic Sm and Sm-like (LSm) proteins 99.72
cd0172087 Sm_D2 The eukaryotic Sm and Sm-like (LSm) proteins 99.71
cd0172170 Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins 99.71
KOG3482|consensus79 99.7
cd0172376 LSm4 The eukaryotic Sm and Sm-like (LSm) proteins 99.68
cd0172490 Sm_D1 The eukaryotic Sm and Sm-like (LSm) proteins 99.66
cd0173378 LSm10 The eukaryotic Sm and Sm-like (LSm) proteins 99.65
PTZ0013889 small nuclear ribonucleoprotein; Provisional 99.57
KOG1781|consensus108 99.56
cd0172581 LSm2 The eukaryotic Sm and Sm-like (LSm) proteins 99.56
KOG1783|consensus77 99.49
KOG1775|consensus84 99.45
KOG1774|consensus88 99.33
KOG3460|consensus91 99.21
KOG3168|consensus 177 99.17
KOG1784|consensus96 98.99
KOG3448|consensus96 98.93
KOG1782|consensus129 98.84
KOG3293|consensus134 98.82
KOG3172|consensus119 98.5
cd0173966 LSm11_C The eukaryotic Sm and Sm-like (LSm) protei 98.36
KOG3428|consensus109 98.13
PF1443877 SM-ATX: Ataxin 2 SM domain; PDB: 1M5Q_1. 97.93
PF06372 166 Gemin6: Gemin6 protein; InterPro: IPR009422 This f 97.16
PF1270196 LSM14: Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC 96.83
cd0171661 Hfq Hfq, an abundant, ubiquitous RNA-binding prote 96.8
TIGR0238361 Hfq RNA chaperone Hfq. This model represents the R 96.74
PRK14638150 hypothetical protein; Provisional 96.73
PF0223748 BPL_C: Biotin protein ligase C terminal domain; In 96.68
PRK14639140 hypothetical protein; Provisional 96.44
PRK02001152 hypothetical protein; Validated 96.41
PRK0039579 hfq RNA-binding protein Hfq; Provisional 96.41
KOG3459|consensus114 96.37
cd0173561 LSm12_N LSm12 belongs to a family of Sm-like prote 96.31
cd0173674 LSm14_N LSm14 (also known as RAP55) belongs to a f 96.03
COG192377 Hfq Uncharacterized host factor I protein [General 95.94
PRK14640152 hypothetical protein; Provisional 95.8
cd0173483 YlxS_C YxlS is a Bacillus subtilis gene of unknown 95.69
PRK14633150 hypothetical protein; Provisional 95.51
PRK14642197 hypothetical protein; Provisional 95.22
PRK14645154 hypothetical protein; Provisional 95.09
PRK00092154 ribosome maturation protein RimP; Reviewed 94.97
PRK14632172 hypothetical protein; Provisional 94.95
PRK14636176 hypothetical protein; Provisional 94.86
PRK14644136 hypothetical protein; Provisional 94.74
PRK14634155 hypothetical protein; Provisional 94.73
PRK14643164 hypothetical protein; Provisional 94.61
PRK14646155 hypothetical protein; Provisional 94.59
PF02576141 DUF150: Uncharacterised BCR, YhbC family COG0779; 94.48
PRK14647159 hypothetical protein; Provisional 94.39
COG0779153 Uncharacterized protein conserved in bacteria [Fun 94.13
PRK14091165 RNA-binding protein Hfq; Provisional 93.91
PRK14631174 hypothetical protein; Provisional 93.85
PRK14637151 hypothetical protein; Provisional 93.79
PF1109580 Gemin7: Gem-associated protein 7 (Gemin7); InterPr 93.63
PRK14091165 RNA-binding protein Hfq; Provisional 93.61
PRK14641173 hypothetical protein; Provisional 93.27
PRK14630143 hypothetical protein; Provisional 91.14
PRK14635162 hypothetical protein; Provisional 90.18
PF1084266 DUF2642: Protein of unknown function (DUF2642); In 89.53
PRK06955300 biotin--protein ligase; Provisional 86.87
PF03614165 Flag1_repress: Repressor of phase-1 flagellin; Int 85.88
PRK10898 353 serine endoprotease; Provisional 83.02
TIGR02038 351 protease_degS periplasmic serine pepetdase DegS. T 82.45
PF11607101 DUF3247: Protein of unknown function (DUF3247); In 81.64
PRK11886319 bifunctional biotin--[acetyl-CoA-carboxylase] synt 81.62
PF1456342 DUF4444: Domain of unknown function (DUF4444); PDB 81.58
PRK13325 592 bifunctional biotin--[acetyl-CoA-carboxylase] liga 80.04
>PRK00737 small nuclear ribonucleoprotein; Provisional Back     alignment and domain information
Probab=99.86  E-value=2.2e-21  Score=109.40  Aligned_cols=61  Identities=31%  Similarity=0.511  Sum_probs=54.1

Q ss_pred             CCCCCchhHHhcCCCEEEEEECCCeEEEEEEEEecCccceEecceEEEecCCceeeeeEee
Q psy11512          1 MSKSHPPELKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEYRKDNTVHNIGMVE   61 (62)
Q Consensus         1 m~~~~~~~L~~~l~k~V~V~l~~g~~~~G~L~~~D~~mNlvL~~~~e~~~~~~~~~lG~v~   61 (62)
                      |+..+...|.++++++|.|+++||++|.|+|.|||+|||++|+||.|...++..+.+|.++
T Consensus         1 ~~~~P~~~L~~~~~k~V~V~lk~g~~~~G~L~~~D~~mNlvL~d~~e~~~~~~~~~lg~v~   61 (72)
T PRK00737          1 MAQRPLDVLNNALNSPVLVRLKGGREFRGELQGYDIHMNLVLDNAEEIQDGEVVRKLGKVV   61 (72)
T ss_pred             CCcchHHHHHHhCCCEEEEEECCCCEEEEEEEEEcccceeEEeeEEEEcCCCeEeEcCcEE
Confidence            7755555689999999999999999999999999999999999999987766677888764



>cd01719 Sm_G The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01729 LSm7 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01731 archaeal_Sm1 The archaeal sm1 proteins: The Sm proteins are conserved in all three domains of life and are always associated with U-rich RNA sequences Back     alignment and domain information
>cd01726 LSm6 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01732 LSm5 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01722 Sm_F The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>KOG1780|consensus Back     alignment and domain information
>cd06168 LSm9 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01730 LSm3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01717 Sm_B The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01727 LSm8 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01728 LSm1 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>smart00651 Sm snRNP Sm proteins Back     alignment and domain information
>PF01423 LSM: LSM domain ; InterPro: IPR001163 This family is found in Lsm (like-Sm) proteins and in bacterial Lsm-related Hfq proteins Back     alignment and domain information
>COG1958 LSM1 Small nuclear ribonucleoprotein (snRNP) homolog [Transcription] Back     alignment and domain information
>cd00600 Sm_like The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01718 Sm_E The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01720 Sm_D2 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01721 Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>KOG3482|consensus Back     alignment and domain information
>cd01723 LSm4 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01724 Sm_D1 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01733 LSm10 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>PTZ00138 small nuclear ribonucleoprotein; Provisional Back     alignment and domain information
>KOG1781|consensus Back     alignment and domain information
>cd01725 LSm2 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>KOG1783|consensus Back     alignment and domain information
>KOG1775|consensus Back     alignment and domain information
>KOG1774|consensus Back     alignment and domain information
>KOG3460|consensus Back     alignment and domain information
>KOG3168|consensus Back     alignment and domain information
>KOG1784|consensus Back     alignment and domain information
>KOG3448|consensus Back     alignment and domain information
>KOG1782|consensus Back     alignment and domain information
>KOG3293|consensus Back     alignment and domain information
>KOG3172|consensus Back     alignment and domain information
>cd01739 LSm11_C The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>KOG3428|consensus Back     alignment and domain information
>PF14438 SM-ATX: Ataxin 2 SM domain; PDB: 1M5Q_1 Back     alignment and domain information
>PF06372 Gemin6: Gemin6 protein; InterPro: IPR009422 This family consists of several mammalian Gemin6 proteins Back     alignment and domain information
>PF12701 LSM14: Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC8_A 2VXF_A 2VXE_A Back     alignment and domain information
>cd01716 Hfq Hfq, an abundant, ubiquitous RNA-binding protein, functions as a pleiotrophic regulator of RNA metabolism in prokaryotes, required for transcription of some transcripts and degradation of others Back     alignment and domain information
>TIGR02383 Hfq RNA chaperone Hfq Back     alignment and domain information
>PRK14638 hypothetical protein; Provisional Back     alignment and domain information
>PF02237 BPL_C: Biotin protein ligase C terminal domain; InterPro: IPR003142 This C-terminal domain has an SH3-like barrel fold, the function of which is unknown Back     alignment and domain information
>PRK14639 hypothetical protein; Provisional Back     alignment and domain information
>PRK02001 hypothetical protein; Validated Back     alignment and domain information
>PRK00395 hfq RNA-binding protein Hfq; Provisional Back     alignment and domain information
>KOG3459|consensus Back     alignment and domain information
>cd01735 LSm12_N LSm12 belongs to a family of Sm-like proteins that associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01736 LSm14_N LSm14 (also known as RAP55) belongs to a family of Sm-like proteins that associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>COG1923 Hfq Uncharacterized host factor I protein [General function prediction only] Back     alignment and domain information
>PRK14640 hypothetical protein; Provisional Back     alignment and domain information
>cd01734 YlxS_C YxlS is a Bacillus subtilis gene of unknown function with two domains that each have an alpha/beta fold Back     alignment and domain information
>PRK14633 hypothetical protein; Provisional Back     alignment and domain information
>PRK14642 hypothetical protein; Provisional Back     alignment and domain information
>PRK14645 hypothetical protein; Provisional Back     alignment and domain information
>PRK00092 ribosome maturation protein RimP; Reviewed Back     alignment and domain information
>PRK14632 hypothetical protein; Provisional Back     alignment and domain information
>PRK14636 hypothetical protein; Provisional Back     alignment and domain information
>PRK14644 hypothetical protein; Provisional Back     alignment and domain information
>PRK14634 hypothetical protein; Provisional Back     alignment and domain information
>PRK14643 hypothetical protein; Provisional Back     alignment and domain information
>PRK14646 hypothetical protein; Provisional Back     alignment and domain information
>PF02576 DUF150: Uncharacterised BCR, YhbC family COG0779; InterPro: IPR003728 The RimP protein facilitates maturation of the 30S ribsomal subunit, and is required for the efficient production of translationally competent ribosmomes [] Back     alignment and domain information
>PRK14647 hypothetical protein; Provisional Back     alignment and domain information
>COG0779 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK14091 RNA-binding protein Hfq; Provisional Back     alignment and domain information
>PRK14631 hypothetical protein; Provisional Back     alignment and domain information
>PRK14637 hypothetical protein; Provisional Back     alignment and domain information
>PF11095 Gemin7: Gem-associated protein 7 (Gemin7); InterPro: IPR020338 Gem-associated protein 7 (Gemin7) is a component of the survival of motor neuron complex, which functions in the assembly of spliceosomal small nuclear ribonucleoproteins Back     alignment and domain information
>PRK14091 RNA-binding protein Hfq; Provisional Back     alignment and domain information
>PRK14641 hypothetical protein; Provisional Back     alignment and domain information
>PRK14630 hypothetical protein; Provisional Back     alignment and domain information
>PRK14635 hypothetical protein; Provisional Back     alignment and domain information
>PF10842 DUF2642: Protein of unknown function (DUF2642); InterPro: IPR020139 This entry contains proteins with no known function Back     alignment and domain information
>PRK06955 biotin--protein ligase; Provisional Back     alignment and domain information
>PF03614 Flag1_repress: Repressor of phase-1 flagellin; InterPro: IPR003223 Flagellin is the subunit which polymerises to form the filaments of bacterial flagella Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PF11607 DUF3247: Protein of unknown function (DUF3247); InterPro: IPR021649 This family of proteins is the protein product of the gene XC5848 from Xanthomonas campestris Back     alignment and domain information
>PRK11886 bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin operon repressor; Provisional Back     alignment and domain information
>PF14563 DUF4444: Domain of unknown function (DUF4444); PDB: 3BFM_A Back     alignment and domain information
>PRK13325 bifunctional biotin--[acetyl-CoA-carboxylase] ligase/pantothenate kinase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query62
3cw1_G76 Crystal Structure Of Human Spliceosomal U1 Snrnp Le 8e-20
3swn_C117 Structure Of The Lsm657 Complex: An Assembly Interm 2e-05
4emk_C113 Crystal Structure Of Splsm567 Length = 113 1e-04
>pdb|3CW1|G Chain G, Crystal Structure Of Human Spliceosomal U1 Snrnp Length = 76 Back     alignment and structure

Iteration: 1

Score = 91.7 bits (226), Expect = 8e-20, Method: Compositional matrix adjust. Identities = 43/60 (71%), Positives = 49/60 (81%) Query: 1 MSKSHPPELKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEYRKDNTVHNIGMV 60 MSK+HPPELKKFMDKK++LKLN R+V GILRGFDPFMNLV+DE VE +NIGMV Sbjct: 1 MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMV 60
>pdb|3SWN|C Chain C, Structure Of The Lsm657 Complex: An Assembly Intermediate Of The Lsm1 7 And Lsm2 8 Rings Length = 117 Back     alignment and structure
>pdb|4EMK|C Chain C, Crystal Structure Of Splsm567 Length = 113 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query62
3s6n_G76 Small nuclear ribonucleoprotein G; SMN complex, SM 3e-24
1th7_A81 SnRNP-2, small nuclear riboprotein protein; archae 9e-24
1i4k_A77 Putative snRNP SM-like protein; core snRNP domain, 8e-20
4emk_B75 U6 snRNA-associated SM-like protein LSM6; SM fold, 4e-19
1h64_175 SnRNP SM-like protein; SM fold, spliceosome, snRNP 2e-17
4emk_C113 U6 snRNA-associated SM-like protein LSM7; SM fold, 1e-16
1i8f_A81 Putative snRNP SM-like protein; beta barrel-like S 3e-16
1mgq_A83 SM-like protein; LSM, RNA-binding, archea, RNA bin 4e-16
1d3b_B91 Protein (small nuclear ribonucleoprotein associat 2e-15
3bw1_A96 SMX4 protein, U6 snRNA-associated SM-like protein 4e-14
1ljo_A77 Archaeal SM-like protein AF-SM2; snRNP, core snRNP 1e-13
3s6n_F86 Small nuclear ribonucleoprotein F; SMN complex, SM 2e-13
4emg_A93 Probable U6 snRNA-associated SM-like protein LSM3; 3e-11
1n9r_A93 SMF, small nuclear ribonucleoprotein F, snRNP-F, S 3e-11
4emk_A94 U6 snRNA-associated SM-like protein LSM5; SM fold, 1e-10
2fwk_A121 U6 snRNA-associated SM-like protein LSM5; structur 3e-10
3s6n_E92 Small nuclear ribonucleoprotein E; SMN complex, SM 2e-07
3pgw_B 231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 6e-07
4emh_A105 Probable U6 snRNA-associated SM-like protein LSM4; 3e-06
1b34_A119 Protein (small nuclear ribonucleoprotein SM D1); s 7e-06
2y9a_D126 Small nuclear ribonucleoprotein SM D3; splicing-RN 1e-05
1d3b_A75 Protein (small nuclear ribonucleoprotein SM D3); s 2e-05
>3s6n_G Small nuclear ribonucleoprotein G; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_G 2y9c_G 2y9d_G 3cw1_G 3pgw_G* 2y9a_G Length = 76 Back     alignment and structure
 Score = 84.7 bits (210), Expect = 3e-24
 Identities = 43/60 (71%), Positives = 49/60 (81%)

Query: 1  MSKSHPPELKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEYRKDNTVHNIGMV 60
          MSK+HPPELKKFMDKK++LKLN  R+V GILRGFDPFMNLV+DE VE       +NIGMV
Sbjct: 1  MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMV 60


>1th7_A SnRNP-2, small nuclear riboprotein protein; archaea, SM protein, SM fold, SS-SM1, RNA binding protein; 1.68A {Sulfolobus solfataricus} SCOP: b.38.1.1 Length = 81 Back     alignment and structure
>1i4k_A Putative snRNP SM-like protein; core snRNP domain, RNA binding protein; HET: CIT; 2.50A {Archaeoglobus fulgidus} SCOP: b.38.1.1 PDB: 1i5l_A* Length = 77 Back     alignment and structure
>4emk_B U6 snRNA-associated SM-like protein LSM6; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_B Length = 75 Back     alignment and structure
>1h64_1 SnRNP SM-like protein; SM fold, spliceosome, snRNP core; 1.9A {Pyrococcus abyssi} SCOP: b.38.1.1 PDB: 1m8v_A* Length = 75 Back     alignment and structure
>4emk_C U6 snRNA-associated SM-like protein LSM7; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_C Length = 113 Back     alignment and structure
>1i8f_A Putative snRNP SM-like protein; beta barrel-like SMAP monomers form 35-stranded beta-sheet I heptamer, structural genomics; 1.75A {Pyrobaculum aerophilum} SCOP: b.38.1.1 PDB: 1lnx_A* Length = 81 Back     alignment and structure
>1mgq_A SM-like protein; LSM, RNA-binding, archea, RNA binding protein; 1.70A {Methanothermobacterthermautotrophicus} SCOP: b.38.1.1 PDB: 1i81_A 1loj_A* 1jbm_A 1jri_A Length = 83 Back     alignment and structure
>1d3b_B Protein (small nuclear ribonucleoprotein associat B); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_A 2y9b_A 2y9c_A 2y9d_A Length = 91 Back     alignment and structure
>3bw1_A SMX4 protein, U6 snRNA-associated SM-like protein LSM3; RNA-binding protein, SM protein, ring, HOMO octamer, mRNA processing; 2.50A {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>1ljo_A Archaeal SM-like protein AF-SM2; snRNP, core snRNP domain, RNA binding protein, unknown F; 1.95A {Archaeoglobus fulgidus} SCOP: b.38.1.1 Length = 77 Back     alignment and structure
>3s6n_F Small nuclear ribonucleoprotein F; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_F 2y9c_F 2y9d_F 3cw1_F 3pgw_F* 2y9a_F Length = 86 Back     alignment and structure
>4emg_A Probable U6 snRNA-associated SM-like protein LSM3; SM fold, mRNA decay, LSM proteins, RNA binding protein; 2.70A {Schizosaccharomyces pombe} Length = 93 Back     alignment and structure
>1n9r_A SMF, small nuclear ribonucleoprotein F, snRNP-F, SM protein F; heptamer, translation; 2.80A {Saccharomyces cerevisiae} SCOP: b.38.1.1 PDB: 1n9s_A Length = 93 Back     alignment and structure
>4emk_A U6 snRNA-associated SM-like protein LSM5; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_A Length = 94 Back     alignment and structure
>2fwk_A U6 snRNA-associated SM-like protein LSM5; structural genomics, structural genomics consortium, SGC, DNA binding protein; 2.14A {Cryptosporidium parvum} SCOP: b.38.1.1 PDB: 3pgg_A Length = 121 Back     alignment and structure
>3s6n_E Small nuclear ribonucleoprotein E; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_E 2y9c_E 2y9d_E 3cw1_E 3pgw_E* 2y9a_E Length = 92 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>4emh_A Probable U6 snRNA-associated SM-like protein LSM4; SM fold, mRNA decay, PRE-mRNA splicing, LSM proteins, RNA BI protein; 2.20A {Schizosaccharomyces pombe} Length = 105 Back     alignment and structure
>1b34_A Protein (small nuclear ribonucleoprotein SM D1); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_B 2y9b_B 2y9c_B 2y9d_B 3cw1_B 3pgw_X* 3s6n_A Length = 119 Back     alignment and structure
>2y9a_D Small nuclear ribonucleoprotein SM D3; splicing-RNA complex, PRE-mRNA splicing, spliceosome, snRNP biogenesis, SM site, SM fold, heteromeric heptameric ring; 3.60A {Homo sapiens} PDB: 2y9b_D 2y9c_D 2y9d_D 3pgw_Z* 3cw1_D Length = 126 Back     alignment and structure
>1d3b_A Protein (small nuclear ribonucleoprotein SM D3); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 Length = 75 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query62
3s6n_G76 Small nuclear ribonucleoprotein G; SMN complex, SM 99.9
1h64_175 SnRNP SM-like protein; SM fold, spliceosome, snRNP 99.87
4emk_B75 U6 snRNA-associated SM-like protein LSM6; SM fold, 99.87
1i4k_A77 Putative snRNP SM-like protein; core snRNP domain, 99.86
1th7_A81 SnRNP-2, small nuclear riboprotein protein; archae 99.85
1d3b_B91 Protein (small nuclear ribonucleoprotein associat 99.84
1d3b_A75 Protein (small nuclear ribonucleoprotein SM D3); s 99.83
4emk_A94 U6 snRNA-associated SM-like protein LSM5; SM fold, 99.83
3s6n_F86 Small nuclear ribonucleoprotein F; SMN complex, SM 99.82
1ljo_A77 Archaeal SM-like protein AF-SM2; snRNP, core snRNP 99.82
1mgq_A83 SM-like protein; LSM, RNA-binding, archea, RNA bin 99.82
1i8f_A81 Putative snRNP SM-like protein; beta barrel-like S 99.81
4emk_C113 U6 snRNA-associated SM-like protein LSM7; SM fold, 99.8
1n9r_A93 SMF, small nuclear ribonucleoprotein F, snRNP-F, S 99.8
3bw1_A96 SMX4 protein, U6 snRNA-associated SM-like protein 99.8
4emg_A93 Probable U6 snRNA-associated SM-like protein LSM3; 99.79
3pgw_B 231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 99.79
3s6n_E92 Small nuclear ribonucleoprotein E; SMN complex, SM 99.76
1b34_A119 Protein (small nuclear ribonucleoprotein SM D1); s 99.76
4emh_A105 Probable U6 snRNA-associated SM-like protein LSM4; 99.76
2y9a_D126 Small nuclear ribonucleoprotein SM D3; splicing-RN 99.75
2fwk_A121 U6 snRNA-associated SM-like protein LSM5; structur 99.73
1b34_B118 Protein (small nuclear ribonucleoprotein SM D2); s 99.69
1m5q_A130 SMAP3, small nuclear ribonucleoprotein homolog, SM 99.65
1y96_A86 Gemin6, SIP2, GEM-associated protein 6; SM fold, p 99.08
1kq1_A77 HFQ, HOST factor for Q beta; hexamer, RNA binding 97.36
2qtx_A71 Uncharacterized protein MJ1435; HFQ, SM, RNA-bindi 97.34
2ylb_A74 Protein HFQ; RNA-binding protein, LSM protein, RNA 97.26
1u1s_A82 HFQ protein; SM-like bacterial protein, riken stru 97.05
3ahu_A78 Protein HFQ; SM-like motif, protein-RNA complex, t 96.99
3sb2_A79 Protein HFQ; SM-like, RNA chaperone, chaperone; 2. 96.89
2y90_A104 Protein HFQ; RNA-binding protein, SM-like, RNA cha 96.85
4a53_A125 EDC3; RNA binding protein; NMR {Schizosaccharomyce 96.22
2vxe_A88 CG10686-PA; EDC3, CAR-1, P-bodies, decapping, mRNA 96.03
1ycy_A71 Conserved hypothetical protein; structural genomic 95.99
2fb7_A95 SM-like protein, LSM-14_N (RAP55); DR.13312, BC055 95.26
1ib8_A164 Conserved protein SP14.3; nucleic acid binding pro 95.11
2vc8_A84 Enhancer of mRNA-decapping protein 3; P-BODY compo 94.49
3rux_A270 BIRA bifunctional protein; biotin-protein ligase, 93.93
3hfo_A70 SSR3341 protein; HFQ, SM, RNA-binding protein, sRN 93.26
1y96_B85 Gemin7, SIP3, GEM-associated protein 7; SM fold, p 92.97
3hfn_A72 ASL2047 protein; HFQ, SM, RNA-binding protein, sRN 91.8
2ej9_A237 Putative biotin ligase; biotin biosynthesis, monom 86.37
1bia_A321 BIRA bifunctional protein; transcription regulatio 84.12
2dxu_A235 Biotin--[acetyl-COA-carboxylase] ligase; biotin bi 82.39
2rm4_A103 CG6311-PB, DM EDC3; enhancer of mRNA decapping, P- 80.74
3bfm_A235 Biotin protein ligase-like protein of unknown FUN; 80.06
>3s6n_G Small nuclear ribonucleoprotein G; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_G 2y9c_G 2y9d_G 3cw1_G 3pgw_G* 2y9a_G Back     alignment and structure
Probab=99.90  E-value=5.8e-24  Score=119.91  Aligned_cols=61  Identities=70%  Similarity=1.096  Sum_probs=41.9

Q ss_pred             CCCCCchhHHhcCCCEEEEEECCCeEEEEEEEEecCccceEecceEEEecCCceeeeeEee
Q psy11512          1 MSKSHPPELKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEYRKDNTVHNIGMVE   61 (62)
Q Consensus         1 m~~~~~~~L~~~l~k~V~V~l~~g~~~~G~L~~~D~~mNlvL~~~~e~~~~~~~~~lG~v~   61 (62)
                      ||++++++|.++++++|+|+|+||++|+|+|.|||+|||++|+||+|+..+++.+.+|.++
T Consensus         1 ms~~~~~~L~~~~~k~V~V~Lk~gr~~~G~L~~~D~~mNlvL~~~~e~~~~~~~~~lg~v~   61 (76)
T 3s6n_G            1 MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVV   61 (76)
T ss_dssp             -------------CCEEEEEETTTEEEEEEEEEECTTCCEEEEEEEECCCC----CBSSEE
T ss_pred             CCCcchHHHHHhCCCeEEEEECCCcEEEEEEEEECCcceEEEeceEEEccCCcEeEcCEEE
Confidence            9999999999999999999999999999999999999999999999998877788888764



>1h64_1 SnRNP SM-like protein; SM fold, spliceosome, snRNP core; 1.9A {Pyrococcus abyssi} SCOP: b.38.1.1 PDB: 1m8v_A* Back     alignment and structure
>4emk_B U6 snRNA-associated SM-like protein LSM6; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_B Back     alignment and structure
>1i4k_A Putative snRNP SM-like protein; core snRNP domain, RNA binding protein; HET: CIT; 2.50A {Archaeoglobus fulgidus} SCOP: b.38.1.1 PDB: 1i5l_A* Back     alignment and structure
>1th7_A SnRNP-2, small nuclear riboprotein protein; archaea, SM protein, SM fold, SS-SM1, RNA binding protein; 1.68A {Sulfolobus solfataricus} SCOP: b.38.1.1 Back     alignment and structure
>1d3b_B Protein (small nuclear ribonucleoprotein associat B); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_A 2y9b_A 2y9c_A 2y9d_A Back     alignment and structure
>1d3b_A Protein (small nuclear ribonucleoprotein SM D3); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 Back     alignment and structure
>4emk_A U6 snRNA-associated SM-like protein LSM5; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_A Back     alignment and structure
>3s6n_F Small nuclear ribonucleoprotein F; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_F 2y9c_F 2y9d_F 3cw1_F 3pgw_F* 2y9a_F Back     alignment and structure
>1ljo_A Archaeal SM-like protein AF-SM2; snRNP, core snRNP domain, RNA binding protein, unknown F; 1.95A {Archaeoglobus fulgidus} SCOP: b.38.1.1 Back     alignment and structure
>1mgq_A SM-like protein; LSM, RNA-binding, archea, RNA binding protein; 1.70A {Methanothermobacterthermautotrophicus} SCOP: b.38.1.1 PDB: 1i81_A 1loj_A* 1jbm_A 1jri_A Back     alignment and structure
>1i8f_A Putative snRNP SM-like protein; beta barrel-like SMAP monomers form 35-stranded beta-sheet I heptamer, structural genomics; 1.75A {Pyrobaculum aerophilum} SCOP: b.38.1.1 PDB: 1lnx_A* Back     alignment and structure
>4emk_C U6 snRNA-associated SM-like protein LSM7; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_C Back     alignment and structure
>1n9r_A SMF, small nuclear ribonucleoprotein F, snRNP-F, SM protein F; heptamer, translation; 2.80A {Saccharomyces cerevisiae} SCOP: b.38.1.1 PDB: 1n9s_A Back     alignment and structure
>3bw1_A SMX4 protein, U6 snRNA-associated SM-like protein LSM3; RNA-binding protein, SM protein, ring, HOMO octamer, mRNA processing; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4emg_A Probable U6 snRNA-associated SM-like protein LSM3; SM fold, mRNA decay, LSM proteins, RNA binding protein; 2.70A {Schizosaccharomyces pombe} Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Back     alignment and structure
>3s6n_E Small nuclear ribonucleoprotein E; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_E 2y9c_E 2y9d_E 3cw1_E 3pgw_E* 2y9a_E Back     alignment and structure
>1b34_A Protein (small nuclear ribonucleoprotein SM D1); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_B 2y9b_B 2y9c_B 2y9d_B 3cw1_B 3pgw_X* 3s6n_A Back     alignment and structure
>4emh_A Probable U6 snRNA-associated SM-like protein LSM4; SM fold, mRNA decay, PRE-mRNA splicing, LSM proteins, RNA BI protein; 2.20A {Schizosaccharomyces pombe} Back     alignment and structure
>2y9a_D Small nuclear ribonucleoprotein SM D3; splicing-RNA complex, PRE-mRNA splicing, spliceosome, snRNP biogenesis, SM site, SM fold, heteromeric heptameric ring; 3.60A {Homo sapiens} PDB: 2y9b_D 2y9c_D 2y9d_D 3pgw_Z* 3cw1_D Back     alignment and structure
>2fwk_A U6 snRNA-associated SM-like protein LSM5; structural genomics, structural genomics consortium, SGC, DNA binding protein; 2.14A {Cryptosporidium parvum} SCOP: b.38.1.1 PDB: 3pgg_A Back     alignment and structure
>1b34_B Protein (small nuclear ribonucleoprotein SM D2); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_C 2y9b_C 2y9c_C 2y9d_C 3cw1_C 3pgw_Y* 3s6n_B Back     alignment and structure
>1m5q_A SMAP3, small nuclear ribonucleoprotein homolog, SM-like P; OB-like fold, B-sheet toroid, 14-MER, cadmium-binding site, translation; 2.00A {Pyrobaculum aerophilum} SCOP: b.38.1.1 Back     alignment and structure
>1y96_A Gemin6, SIP2, GEM-associated protein 6; SM fold, protein complex, RNA binding protein; 2.00A {Homo sapiens} Back     alignment and structure
>1kq1_A HFQ, HOST factor for Q beta; hexamer, RNA binding protein, translational regulator, SM motif; 1.55A {Staphylococcus aureus} SCOP: b.38.1.2 PDB: 1kq2_A Back     alignment and structure
>2qtx_A Uncharacterized protein MJ1435; HFQ, SM, RNA-binding protein, sRNA, translational regulation, RNA binding protein; 2.50A {Methanocaldococcus jannaschii} Back     alignment and structure
>2ylb_A Protein HFQ; RNA-binding protein, LSM protein, RNA chaperone; 1.15A {Salmonella enterica subsp} PDB: 2yht_A 1hk9_A 2ylc_A* 3gib_A* 3rer_A* 3qo3_A* 3res_A* Back     alignment and structure
>1u1s_A HFQ protein; SM-like bacterial protein, riken structural genomics/proteomics initiative, RSGI, structural genomics, RNA binding protein; 1.60A {Pseudomonas aeruginosa} SCOP: b.38.1.2 PDB: 1u1t_A 3qui_A* 3m4g_A 3inz_A Back     alignment and structure
>3ahu_A Protein HFQ; SM-like motif, protein-RNA complex, translation-RNA complex; 2.20A {Bacillus subtilis} PDB: 3hsb_A Back     alignment and structure
>3sb2_A Protein HFQ; SM-like, RNA chaperone, chaperone; 2.63A {Herbaspirillum seropedicae} SCOP: b.38.1.2 Back     alignment and structure
>2y90_A Protein HFQ; RNA-binding protein, SM-like, RNA chaperone; 2.25A {Escherichia coli} PDB: 3qhs_A Back     alignment and structure
>4a53_A EDC3; RNA binding protein; NMR {Schizosaccharomyces pombe} PDB: 4a54_A Back     alignment and structure
>2vxe_A CG10686-PA; EDC3, CAR-1, P-bodies, decapping, mRNA decay, LSM proteins, translational repression, transcription; NMR {Drosophila melanogaster} Back     alignment and structure
>1ycy_A Conserved hypothetical protein; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative; 2.80A {Pyrococcus furiosus} SCOP: b.38.1.4 Back     alignment and structure
>2fb7_A SM-like protein, LSM-14_N (RAP55); DR.13312, BC055387, AAH55387, stronGly BENT five-stranded antiparallel beta- sheet, structural genomics, PSI; NMR {Danio rerio} SCOP: b.38.1.5 PDB: 2vxf_A Back     alignment and structure
>1ib8_A Conserved protein SP14.3; nucleic acid binding protein, ribosomal protein, essential gene, structural genomics; NMR {Streptococcus pneumoniae} SCOP: b.38.2.1 d.52.4.1 Back     alignment and structure
>2vc8_A Enhancer of mRNA-decapping protein 3; P-BODY component, cytoplasm, SM-like protein, protein-binding; 1.31A {Homo sapiens} Back     alignment and structure
>3rux_A BIRA bifunctional protein; biotin-protein ligase, ligase-ligase inhibitor complex; HET: BS5; 1.70A {Mycobacterium tuberculosis} PDB: 3l1a_A 3l2z_A 2cgh_A Back     alignment and structure
>3hfo_A SSR3341 protein; HFQ, SM, RNA-binding protein, sRNA, translational regulation binding protein; 1.30A {Synechocystis SP} Back     alignment and structure
>1y96_B Gemin7, SIP3, GEM-associated protein 7; SM fold, protein complex, RNA binding protein; 2.00A {Homo sapiens} Back     alignment and structure
>3hfn_A ASL2047 protein; HFQ, SM, RNA-binding protein, sRNA, translational regulation binding protein; 2.31A {Nostoc SP} Back     alignment and structure
>2ej9_A Putative biotin ligase; biotin biosynthesis, monomer, X-RAY diffraction, structural genomics, NPPSFA; HET: BTN; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1bia_A BIRA bifunctional protein; transcription regulation; 2.30A {Escherichia coli} SCOP: a.4.5.1 b.34.1.1 d.104.1.2 PDB: 1bib_A* 1hxd_A* 2ewn_A* Back     alignment and structure
>2dxu_A Biotin--[acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; HET: BT5; 1.28A {Pyrococcus horikoshii} PDB: 2dzc_A 2ejg_A* 2e3y_A* 2e41_A* 2e64_A 2ejf_A* 2zgw_A* 1wqw_A* 1wpy_A* 1wq7_A 1wnl_A* 1x01_A* 2dkg_A* 2dth_A* 2dti_A* 2dto_A* 2fyk_A* 2djz_A* 2hni_A 2e10_A ... Back     alignment and structure
>2rm4_A CG6311-PB, DM EDC3; enhancer of mRNA decapping, P-BODY component, SM-like protein,, protein binding; NMR {Drosophila melanogaster} Back     alignment and structure
>3bfm_A Biotin protein ligase-like protein of unknown FUN; structural genomics, joint center for structural genomics, J protein structure initiative; HET: 2PE; 1.70A {Silicibacter SP} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 62
d1th7a176 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm prote 1e-15
d1i4k1_72 b.38.1.1 (1:) Archaeal homoheptameric Sm protein { 1e-13
d1mgqa_74 b.38.1.1 (A:) Archaeal homoheptameric Sm protein { 4e-13
d1d3bb_81 b.38.1.1 (B:) B core SNRNP protein {Human (Homo sa 4e-13
d1h641_71 b.38.1.1 (1:) Archaeal homoheptameric Sm protein { 5e-13
d1i8fa_71 b.38.1.1 (A:) Archaeal homoheptameric Sm protein { 3e-12
d1n9ra_68 b.38.1.1 (A:) Small nuclear ribonucleoprotein F, S 3e-12
d1ljoa_75 b.38.1.1 (A:) Archaeal homoheptameric Sm protein { 8e-12
d2fwka192 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like pr 8e-11
d1m5q1_127 b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Arch 3e-10
d1b34a_80 b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo s 9e-10
d1d3ba_72 b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo s 3e-09
d1b34b_93 b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo s 4e-07
>d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]} Length = 76 Back     information, alignment and structure

class: All beta proteins
fold: Sm-like fold
superfamily: Sm-like ribonucleoproteins
family: Sm motif of small nuclear ribonucleoproteins, SNRNP
domain: Archaeal homoheptameric Sm protein
species: Sulfolobus solfataricus [TaxId: 2287]
 Score = 61.7 bits (150), Expect = 1e-15
 Identities = 18/60 (30%), Positives = 34/60 (56%)

Query: 1  MSKSHPPELKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEYRKDNTVHNIGMV 60
          ++++    L + ++  V +KL  N+ V G+LR +D  MNLVL +  E + D +   +G +
Sbjct: 4  LAETAHKVLAESLNNLVLVKLKGNKEVRGMLRSYDQHMNLVLSDSEEIQSDGSGKKLGTI 63


>d1i4k1_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]} Length = 72 Back     information, alignment and structure
>d1mgqa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 74 Back     information, alignment and structure
>d1d3bb_ b.38.1.1 (B:) B core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d1h641_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 71 Back     information, alignment and structure
>d1i8fa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 71 Back     information, alignment and structure
>d1n9ra_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 68 Back     information, alignment and structure
>d1ljoa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm2 [TaxId: 2234]} Length = 75 Back     information, alignment and structure
>d2fwka1 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like protein LSM5 {Cryptosporidium parvum [TaxId: 5807]} Length = 92 Back     information, alignment and structure
>d1m5q1_ b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 127 Back     information, alignment and structure
>d1b34a_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1d3ba_ b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query62
d1th7a176 Archaeal homoheptameric Sm protein {Sulfolobus sol 99.83
d1mgqa_74 Archaeal homoheptameric Sm protein {Archaeon Metha 99.82
d1h641_71 Archaeal homoheptameric Sm protein {Archaeon Pyroc 99.82
d1i4k1_72 Archaeal homoheptameric Sm protein {Archaeon Archa 99.82
d1ljoa_75 Archaeal homoheptameric Sm protein {Archaeon Archa 99.8
d1i8fa_71 Archaeal homoheptameric Sm protein {Archaeon Pyrob 99.79
d1d3bb_81 B core SNRNP protein {Human (Homo sapiens) [TaxId: 99.78
d1n9ra_68 Small nuclear ribonucleoprotein F, Smf {Baker's ye 99.77
d1d3ba_72 D3 core SNRNP protein {Human (Homo sapiens) [TaxId 99.75
d2fwka192 U6 snRNA-associated sm-like protein LSM5 {Cryptosp 99.72
d1b34b_93 D2 core SNRNP protein {Human (Homo sapiens) [TaxId 99.67
d1b34a_80 D1 core SNRNP protein {Human (Homo sapiens) [TaxId 99.67
d1m5q1_127 Sm-Like archaeal protein Smap3 {Archaeon Pyrobacul 99.52
d1biaa247 Biotin repressor/biotin holoenzyme synthetase, C-t 96.71
d1u1sa166 Pleiotropic translational regulator Hfq {Pseudomon 96.48
d1kq1a_60 Pleiotropic translational regulator Hfq {Staphyloc 96.42
d1ib8a174 Hypothetical protein SP14.3 (SP0552) {Streptococcu 96.26
d2vxfa180 LSM14 homolog A (Lsm14a) {Zebrafish (Danio rerio) 95.89
d1ycya166 Hypothetical protein PF1955 {Pyrococcus furiosus [ 93.25
>d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
class: All beta proteins
fold: Sm-like fold
superfamily: Sm-like ribonucleoproteins
family: Sm motif of small nuclear ribonucleoproteins, SNRNP
domain: Archaeal homoheptameric Sm protein
species: Sulfolobus solfataricus [TaxId: 2287]
Probab=99.83  E-value=7.7e-21  Score=105.86  Aligned_cols=61  Identities=30%  Similarity=0.542  Sum_probs=54.9

Q ss_pred             CCCCCchhHHhcCCCEEEEEECCCeEEEEEEEEecCccceEecceEEEecCCceeeeeEee
Q psy11512          1 MSKSHPPELKKFMDKKVTLKLNANRNVTGILRGFDPFMNLVLDEGVEYRKDNTVHNIGMVE   61 (62)
Q Consensus         1 m~~~~~~~L~~~l~k~V~V~l~~g~~~~G~L~~~D~~mNlvL~~~~e~~~~~~~~~lG~v~   61 (62)
                      |+..+...|.++++++|+|+++||++|+|+|.|||+|||++|++|+|+..+++.+.+|.++
T Consensus         4 ~~~~~~~~L~~~~~~~V~V~lk~g~~~~G~L~~~D~~mNlvL~~~~e~~~~~~~~~~~~v~   64 (76)
T d1th7a1           4 LAETAHKVLAESLNNLVLVKLKGNKEVRGMLRSYDQHMNLVLSDSEEIQSDGSGKKLGTIV   64 (76)
T ss_dssp             TCHHHHHHHHHHTTSEEEEEETTTEEEEEEEEEECTTCCEEEEEEEEECSSSCEEEEEEEE
T ss_pred             ccccHHHHHHHhCCCEEEEEECCCCEEEEEEEEECCCCCEEEeEEEEEecCCcccCcceEE
Confidence            3444445699999999999999999999999999999999999999999998999999875



>d1mgqa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1h641_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1i4k1_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]} Back     information, alignment and structure
>d1ljoa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm2 [TaxId: 2234]} Back     information, alignment and structure
>d1i8fa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1d3bb_ b.38.1.1 (B:) B core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n9ra_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d3ba_ b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fwka1 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like protein LSM5 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b34a_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5q1_ b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1biaa2 b.34.1.1 (A:271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u1sa1 b.38.1.2 (A:6-71) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kq1a_ b.38.1.2 (A:) Pleiotropic translational regulator Hfq {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ib8a1 b.38.2.1 (A:91-164) Hypothetical protein SP14.3 (SP0552) {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2vxfa1 b.38.1.5 (A:6-85) LSM14 homolog A (Lsm14a) {Zebrafish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1ycya1 b.38.1.4 (A:5-70) Hypothetical protein PF1955 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure