Cleaves sequentially the 2 innermost alpha-1,3-linked glucose residues from the Glc(2)Man(9)GlcNAc(2) oligosaccharide precursor of immature glycoproteins.
Mus musculus (taxid: 10090)
EC: 3
EC: .
EC: 2
EC: .
EC: 1
EC: .
EC: 8
EC: 4
>sp|Q8TET4|GANC_HUMAN Neutral alpha-glucosidase C OS=Homo sapiens GN=GANC PE=2 SV=3
Cleaves sequentially the 2 innermost alpha-1,3-linked glucose residues from the Glc(2)Man(9)GlcNAc(2) oligosaccharide precursor of immature glycoproteins.
Macaca fascicularis (taxid: 9541)
EC: 3
EC: .
EC: 2
EC: .
EC: 1
EC: .
EC: 8
EC: 4
>sp|Q14697|GANAB_HUMAN Neutral alpha-glucosidase AB OS=Homo sapiens GN=GANAB PE=1 SV=3
Cleaves sequentially the 2 innermost alpha-1,3-linked glucose residues from the Glc(2)Man(9)GlcNAc(2) oligosaccharide precursor of immature glycoproteins.
Homo sapiens (taxid: 9606)
EC: 3
EC: .
EC: 2
EC: .
EC: 1
EC: .
EC: 8
EC: 4
>sp|Q9BE70|GANC_MACFA Neutral alpha-glucosidase C (Fragment) OS=Macaca fascicularis GN=GANC PE=2 SV=2
Cleaves sequentially the 2 innermost alpha-1,3-linked glucose residues from the Glc(2)Man(9)GlcNAc(2) oligosaccharide precursor of immature glycoproteins.
Sus scrofa (taxid: 9823)
EC: 3
EC: .
EC: 2
EC: .
EC: 1
EC: .
EC: 8
EC: 4
>sp|Q94502|GANAB_DICDI Neutral alpha-glucosidase AB OS=Dictyostelium discoideum GN=modA PE=3 SV=1
Catalytic subunit of glucosidase 2, which cleaves sequentially the 2 innermost alpha-1,3-linked glucose residues from the Glc(2)Man(9)GlcNAc(2) oligosaccharide precursor of immature glycoproteins.
cd06594, GH31_glucosidase_YihQ, YihQ is a bacteria
0.002
>gnl|CDD|133134 cd06603, GH31_GANC_GANAB_alpha, This family includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB)
Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae. Length = 339
>gnl|CDD|133135 cd06604, GH31_glucosidase_II_MalA, Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities
Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This family also includes the MalA alpha-glucosidase from Sulfolobus sulfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source. Length = 339
>gnl|CDD|216268 pfam01055, Glyco_hydro_31, Glycosyl hydrolases family 31
Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases. Length = 436
>gnl|CDD|133131 cd06600, GH31_MGAM-like, This family includes the following closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), lysosomal acid alpha-glucosidase (GAA), neutral alpha-glucosidase C (GANC), the alpha subunit of neutral alpha-glucosidase AB (GANAB), and alpha-glucosidase II
Score = 92.3 bits (229), Expect = 3e-24
Identities = 34/61 (55%), Positives = 43/61 (70%), Gaps = 1/61 (1%)
Query: 3 QVMATFEGLLKRSNYQQRPFILTRSGFAGSQRFGAIWTGDNMAEWSHLKISLPMCLSLAV 62
+ MAT EG + R FILTRSGFAGSQ++ AIWTGDN A W LK+S+P+ L L++
Sbjct: 175 EAMATAEGFRTSHP-RNRIFILTRSGFAGSQKYAAIWTGDNTASWDDLKLSIPLVLGLSI 233
Query: 63 S 63
S
Sbjct: 234 S 234
MGAM is one of the two enzymes responsible for catalyzing the last glucose-releasing step in starch digestion. SI is implicated in the digestion of dietary starch and major disaccharides such as sucrose and isomaltose, while GAA degrades glycogen in the lysosome, cleaving both alpha-1,4 and alpha-1,6 glucosidic linkages. MGAM and SI are anchored to small-intestinal brush-border epithelial cells. The absence of SI from the brush border membrane or its malfunction is associated with malabsorption disorders such as congenital sucrase-isomaltase deficiency (CSID). The domain architectures of MGAM and SI include two tandem GH31 catalytic domains, an N-terminal domain found near the membrane-bound end and a C-terminal luminal domain. Both of the tandem GH31 domains of MGAM and SI are included in this family. The domain architecture of GAA includes an N-terminal TFF (trefoil factor family) domain in addition to the GH31 catalytic domain. Deficient GAA expression causes pompe disease, an autosomal recessive genetic disorder also known as glycogen storage disease type II (GSDII). GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. Alpha-glucosidase II is a GH31 enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This family also includes the MalA alpha-glucosidase from Sulfolobus sulfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source. The MGAM-like family corresponds to subgroup 1 in the Ernst et al classification of GH31 enzymes. Length = 317
Score = 84.4 bits (209), Expect = 6e-21
Identities = 31/63 (49%), Positives = 43/63 (68%), Gaps = 1/63 (1%)
Query: 1 MLQVMATFEGLLKRSNYQQRPFILTRSGFAGSQRFGAIWTGDNMAEWSHLKISLPMCLSL 60
+L A +E L K +RPFIL+RSG+AGSQR+ A W+GDN + W L+ S+P LSL
Sbjct: 439 LLYAKAVYEAL-KELGGNERPFILSRSGYAGSQRYAAHWSGDNRSSWDSLRESIPAGLSL 497
Query: 61 AVS 63
++S
Sbjct: 498 SLS 500
Length = 772
>gnl|CDD|133121 cd06589, GH31, The enzymes of glycosyl hydrolase family 31 (GH31) occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase
Score = 75.5 bits (186), Expect = 3e-18
Identities = 29/62 (46%), Positives = 44/62 (70%), Gaps = 1/62 (1%)
Query: 2 LQVMATFEGLLKRSNYQQRPFILTRSGFAGSQRFGAIWTGDNMAEWSHLKISLPMCLSLA 61
L AT+E L K S +RPFIL+RSG+AGSQR+ +W+GDN + W +L+ +P L+++
Sbjct: 145 LYAEATYEALRKNSK-NKRPFILSRSGYAGSQRYAGMWSGDNTSTWGYLRSQIPAGLTMS 203
Query: 62 VS 63
+S
Sbjct: 204 MS 205
All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. In most cases, the pyranose moiety recognized in subsite -1 of the substrate binding site is an alpha-D-glucose, though some GH31 family members show a preference for alpha-D-xylose. Several GH31 enzymes can accommodate both glucose and xylose and different levels of discrimination between the two have been observed. Most characterized GH31 enzymes are alpha-glucosidases. In mammals, GH31 members with alpha-glucosidase activity are implicated in at least three distinct biological processes. The lysosomal acid alpha-glucosidase (GAA) is essential for glycogen degradation and a deficiency or malfunction of this enzyme causes glycogen storage disease II, also known as pompe disease. In the endoplasmic reticulum, alpha-glucosidase II catalyzes the second step in the N-linked oligosaccharide processing pathway that constitutes part of the quality control system for glycoprotein folding and maturation. The intestinal enzymes sucrase-isomaltase (SI) and maltase-glucoamylase (MGAM) play key roles in the final stage of carbohydrate digestion, making alpha-glucosidase inhibitors useful in the treatment of type 2 diabetes. GH31 alpha-glycosidases are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively. Length = 265
>gnl|CDD|133133 cd06602, GH31_MGAM_SI_GAA, This family includes the following three closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), and lysosomal acid alpha-glucosidase (GAA), also known as acid-maltase
MGAM is one of the two enzymes responsible for catalyzing the last glucose-releasing step in starch digestion. SI is implicated in the digestion of dietary starch and major disaccharides such as sucrose and isomaltose, while GAA degrades glycogen in the lysosome, cleaving both alpha-1,4 and alpha-1,6 glucosidic linkages. MGAM and SI are anchored to small-intestinal brush-border epithelial cells. The absence of SI from the brush border membrane or its malfunction is associated with malabsorption disorders such as congenital sucrase-isomaltase deficiency (CSID). The domain architectures of MGAM and SI include two tandem GH31 catalytic domains, an N-terminal domain found near the membrane-bound end, and a C-terminal luminal domain. Both of the tandem GH31 domains of MGAM and SI are included in this family. The domain architecture of GAA includes an N-terminal TFF (trefoil factor family) domain in addition to the GH31 catalytic domain. Deficient GAA expression causes pompe disease, an autosomal recessive genetic disorder also known as glycogen storage disease type II (GSDII). Length = 339
>gnl|CDD|133132 cd06601, GH31_lyase_GLase, GLases (alpha-1,4-glucan lyases) are glycosyl hydrolase family 31 (GH31) enzymes that degrade alpha-1,4-glucans and maltooligosaccharides via a nonhydrolytic pathway to yield 1,5-D-anhydrofructose from the nonreducing end
GLases cleave the bond between C1 and O1 of the nonreducing sugar residue of alpha-glucans to generate a monosaccharide product with a double bond between C1 and C2. This family corresponds to subgroup 2 in the Ernst et al classification of GH31 enzymes. Length = 332
>gnl|CDD|133129 cd06598, GH31_transferase_CtsZ, CtsZ (cyclic tetrasaccharide-synthesizing enzyme Z) is a bacterial 6-alpha-glucosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsY
CtsZ and CtsY both have a glycosyl hydrolase family 31 (GH31) catalytic domain. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. Length = 317
>gnl|CDD|133122 cd06591, GH31_xylosidase_XylS, XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate
XylS has been characterized in Sulfolobus solfataricus where it hydrolyzes isoprimeverose, the p-nitrophenyl-beta derivative of isoprimeverose, and xyloglucan oligosaccharides, and has transxylosidic activity. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The XylS family corresponds to subgroup 3 in the Ernst et al classification of GH31 enzymes. Length = 319
>gnl|CDD|133130 cd06599, GH31_glycosidase_Aec37, Glycosyl hydrolase family 31 (GH31) domain of a bacterial protein family represented by Escherichia coli protein Aec37
The gene encoding Aec37 (aec-37) is located within a genomic island (AGI-3) isolated from the extraintestinal avian pathogenic Escherichia coli strain BEN2908. The function of Aec37 and its orthologs is unknown; however, deletion of a region of the genome that includes aec-37 affects the assimilation of seven carbohydrates, decreases growth rate of the strain in minimal medium containing galacturonate or trehalose, and attenuates the virulence of E. coli BEN2908 in chickens. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. Length = 317
>gnl|CDD|133127 cd06596, GH31_CPE1046, CPE1046 is an uncharacterized Clostridium perfringens protein with a glycosyl hydrolase family 31 (GH31) domain
Score = 53.2 bits (128), Expect = 5e-10
Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 2/52 (3%)
Query: 4 VMATFEGLLKRSNYQQRPFILTRSGFAGSQRFGAIWTGDNMAEWSHLKISLP 55
V A +G+ SN RPFI+T G+AG+QR+ IWTGD W +++ +P
Sbjct: 132 VKAAADGIESNSN--ARPFIVTVDGWAGTQRYAGIWTGDQSGSWEYIRFHIP 181
The domain architecture of CPE1046 and its orthologs includes a C-terminal fibronectin type 3 (FN3) domain and a coagulation factor 5/8 type C domain in addition to the GH31 domain. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. Length = 261
>gnl|CDD|133124 cd06593, GH31_xylosidase_YicI, YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose
Score = 43.8 bits (104), Expect = 9e-07
Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 1/62 (1%)
Query: 2 LQVMATFEGLLKRSNYQQRPFILTRSGFAGSQRFGAIWTGDNMAEWSHLKISLPMCLSLA 61
L A +E K + + RS +AGSQ++ W GD + + + SL LSL
Sbjct: 183 LYNKAVYE-ATKEVKGEGEAVVWARSAWAGSQKYPVHWGGDCESTFEGMAESLRGGLSLG 241
Query: 62 VS 63
+S
Sbjct: 242 LS 243
YicI forms a homohexamer (a trimer of dimers). All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The YicI family corresponds to subgroup 4 in the Ernst et al classification of GH31 enzymes. Length = 308
>gnl|CDD|133125 cd06594, GH31_glucosidase_YihQ, YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride
Score = 35.0 bits (81), Expect = 0.002
Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 4/43 (9%)
Query: 25 TRSGFAGSQRFGAI-WTGDNMAEWSH---LKISLPMCLSLAVS 63
RSGF GSQ++ + W GD M W LK +P LS +S
Sbjct: 212 MRSGFTGSQKYSTLFWAGDQMVSWDAHDGLKSVVPGALSSGLS 254
Orthologs of YihQ that have not yet been functionally characterized are present in plants and fungi. YihQ has sequence similarity to other GH31 enzymes such as CtsZ, a 6-alpha-glucosyltransferase from Bacillus globisporus, and YicI, an alpha-xylosidase from Echerichia coli. In bacteria, YihQ (along with YihO) is important for bacterial O-antigen capsule assembly and translocation. Length = 317
>cd06601 GH31_lyase_GLase GLases (alpha-1,4-glucan lyases) are glycosyl hydrolase family 31 (GH31) enzymes that degrade alpha-1,4-glucans and maltooligosaccharides via a nonhydrolytic pathway to yield 1,5-D-anhydrofructose from the nonreducing end
Probab=99.97 E-value=5.6e-31 Score=193.36 Aligned_cols=77 Identities=34% Similarity=0.574 Sum_probs=71.5
Q ss_pred ChHhHHHHHHHHhhc--CCCCCceEEeccCCcCccccceeecCCCcCChHHHHHHHHHHHhccccCCccccccCCCCccc
Q psy11534 1 MLQVMATFEGLLKRS--NYQQRPFILTRSGFAGSQRFGAIWTGDNMAEWSHLKISLPMCLSLAVSEKKSANFVVGIGAAA 78 (81)
Q Consensus 1 ~~~~ka~~e~l~~~~--~~~~R~filsRs~~aGsqry~~~W~GD~~s~W~~L~~~i~~~l~~~lsG~~~~gsDiG~~gf~ 78 (81)
++++||+||++++.. ++ +||||||||+|+|+|||+++|+|||.++|++|+.||+++|+++|||+||||+|| |||.
T Consensus 175 ~~~~~a~~e~~~~~~~~~~-~RpfiltRS~~aGsqrY~~~WsGDn~stW~~L~~si~~~L~~~lsGip~~g~DI--GGF~ 251 (332)
T cd06601 175 YNLHKATWHGLNNLNARKN-KRNFIIGRGSYAGMQRFAGLWTGDNSSSWDFLQINIAQVLNLGMSGLPIAGSDI--GGFT 251 (332)
T ss_pred HHHHHHHHHHHHHhhcCCC-CCcEEEEecCcCccCCcCceeCCCcccCHHHHHHHHHHHHHhhhcCCCccCCcc--CCcC
Confidence 478999999998875 55 599999999999999999999999999999999999999999999999999999 5777
Q ss_pred CC
Q psy11534 79 GS 80 (81)
Q Consensus 79 g~ 80 (81)
|.
T Consensus 252 g~ 253 (332)
T cd06601 252 SY 253 (332)
T ss_pred CC
Confidence 63
GLases cleave the bond between C1 and O1 of the nonreducing sugar residue of alpha-glucans to generate a monosaccharide product with a double bond between C1 and C2. This family corresponds to subgroup 2 in the Ernst et al classification of GH31 enzymes.
>cd06596 GH31_CPE1046 CPE1046 is an uncharacterized Clostridium perfringens protein with a glycosyl hydrolase family 31 (GH31) domain
The domain architecture of CPE1046 and its orthologs includes a C-terminal fibronectin type 3 (FN3) domain and a coagulation factor 5/8 type C domain in addition to the GH31 domain. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
>cd06599 GH31_glycosidase_Aec37 Glycosyl hydrolase family 31 (GH31) domain of a bacterial protein family represented by Escherichia coli protein Aec37
The gene encoding Aec37 (aec-37) is located within a genomic island (AGI-3) isolated from the extraintestinal avian pathogenic Escherichia coli strain BEN2908. The function of Aec37 and its orthologs is unknown; however, deletion of a region of the genome that includes aec-37 affects the assimilation of seven carbohydrates, decreases growth rate of the strain in minimal medium containing galacturonate or trehalose, and attenuates the virulence of E. coli BEN2908 in chickens. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
>cd06589 GH31 The enzymes of glycosyl hydrolase family 31 (GH31) occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase
All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. In most cases, the pyranose moiety recognized in subsite -1 of the substrate binding site is an alpha-D-glucose, though some GH31 family members show a preference for alpha-D-xylose. Several GH31 enzymes can accommodate both glucose and xylose and different levels of discrimination between the two have been observed. Most characterized GH31 enzymes are alpha-glucosidases. In mammals, GH31 members with alpha-glucosidase activity are implicated in at least three distinct biological processes
>cd06600 GH31_MGAM-like This family includes the following closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), lysosomal acid alpha-glucosidase (GAA), neutral alpha-glucosidase C (GANC), the alpha subunit of neutral alpha-glucosidase AB (GANAB), and alpha-glucosidase II
MGAM is one of the two enzymes responsible for catalyzing the last glucose-releasing step in starch digestion. SI is implicated in the digestion of dietary starch and major disaccharides such as sucrose and isomaltose, while GAA degrades glycogen in the lysosome, cleaving both alpha-1,4 and alpha-1,6 glucosidic linkages. MGAM and SI are anchored to small-intestinal brush-border epithelial cells. The absence of SI from the brush border membrane or its malfunction is associated with malabsorption disorders such as congenital sucrase-isomaltase deficiency (CSID). The domain architectures of MGAM and SI include two tandem GH31 catalytic domains, an N-terminal do
>cd06598 GH31_transferase_CtsZ CtsZ (cyclic tetrasaccharide-synthesizing enzyme Z) is a bacterial 6-alpha-glucosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsY
Probab=99.94 E-value=2.3e-27 Score=172.41 Aligned_cols=77 Identities=36% Similarity=0.608 Sum_probs=71.8
Q ss_pred ChHhHHHHHHHHhhcCCCCCceEEeccCCcCccccce-eecCCCcCChHHHHHHHHHHHhccccCCccccccCCCCcccC
Q psy11534 1 MLQVMATFEGLLKRSNYQQRPFILTRSGFAGSQRFGA-IWTGDNMAEWSHLKISLPMCLSLAVSEKKSANFVVGIGAAAG 79 (81)
Q Consensus 1 ~~~~ka~~e~l~~~~~~~~R~filsRs~~aGsqry~~-~W~GD~~s~W~~L~~~i~~~l~~~lsG~~~~gsDiG~~gf~g 79 (81)
++++|++||++++..++ +|||+++||+|+|+|||++ +|+||+.++|++|+.+|+++|+++++|+|+||+|| |||.|
T Consensus 188 ~~~~~~~~e~~~~~~~~-~r~~~~~Rs~~~Gsqry~~~~WsGD~~s~W~~L~~~i~~~l~~~l~G~~~~g~DI--GGf~~ 264 (317)
T cd06598 188 HLWAKSIYEGYQQNYPN-ERPFILMRAGFAGSQRYGVIPWSGDVGRTWDGLKSQPNAALQMSMSGIDYYHSDI--GGFAG 264 (317)
T ss_pred HHHHHHHHHHHHHhcCC-CCeEEEEecCcCccccCcCCccCCCCcCCHHHHHHHHHHHHhhhccCCcccCCCc--CCcCC
Confidence 37899999999998776 5999999999999999985 89999999999999999999999999999999999 68877
Q ss_pred C
Q psy11534 80 S 80 (81)
Q Consensus 80 ~ 80 (81)
.
T Consensus 265 ~ 265 (317)
T cd06598 265 G 265 (317)
T ss_pred C
Confidence 4
CtsZ and CtsY both have a glycosyl hydrolase family 31 (GH31) catalytic domain. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
>cd06604 GH31_glucosidase_II_MalA Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities
Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This family also includes the MalA alpha-glucosidase from Sulfolobus sulfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.
>cd06591 GH31_xylosidase_XylS XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate
Probab=99.94 E-value=3e-27 Score=171.88 Aligned_cols=77 Identities=30% Similarity=0.516 Sum_probs=71.2
Q ss_pred ChHhHHHHHHHHhhcCCCCCceEEeccCCcCccccce-eecCCCcCChHHHHHHHHHHHhccccCCccccccCCCCcccC
Q psy11534 1 MLQVMATFEGLLKRSNYQQRPFILTRSGFAGSQRFGA-IWTGDNMAEWSHLKISLPMCLSLAVSEKKSANFVVGIGAAAG 79 (81)
Q Consensus 1 ~~~~ka~~e~l~~~~~~~~R~filsRs~~aGsqry~~-~W~GD~~s~W~~L~~~i~~~l~~~lsG~~~~gsDiG~~gf~g 79 (81)
++++|++||++++..++ +|||+++||+|+|+|||++ +|+||+.++|++||.+|+.+|++++||+|+||+|| |||.|
T Consensus 188 ~~~~~~~~e~~~~~~~~-~r~f~~sRs~~~Gsqry~~~~W~GD~~s~w~~L~~~i~~~l~~glsG~~~~g~Di--GGF~~ 264 (319)
T cd06591 188 LMHAKGIYEGQRAAGDE-KRVVILTRSAWAGSQRYGALVWSGDIDSSWETLRRQIAAGLNMGLSGIPWWTTDI--GGFFV 264 (319)
T ss_pred HHHHHHHHHHHHHhCCC-CCceEEEeccccccccccCceeCCCccccHHHHHHHHHHHHHHhhcCCccccCCc--CCcCC
Confidence 37899999999998765 5999999999999999995 89999999999999999999999999999999999 57765
Q ss_pred C
Q psy11534 80 S 80 (81)
Q Consensus 80 ~ 80 (81)
.
T Consensus 265 ~ 265 (319)
T cd06591 265 G 265 (319)
T ss_pred C
Confidence 3
XylS has been characterized in Sulfolobus solfataricus where it hydrolyzes isoprimeverose, the p-nitrophenyl-beta derivative of isoprimeverose, and xyloglucan oligosaccharides, and has transxylosidic activity. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The XylS family corresponds to subgroup 3 in the Ernst et al classification of GH31 enzymes.
>cd06593 GH31_xylosidase_YicI YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose
YicI forms a homohexamer (a trimer of dimers). All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The YicI family corresponds to subgroup 4 in the Ernst et al classification of GH31 enzymes.
>cd06603 GH31_GANC_GANAB_alpha This family includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB)
Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
>COG1501 Alpha-glucosidases, family 31 of glycosyl hydrolases [Carbohydrate transport and metabolism]
>cd06602 GH31_MGAM_SI_GAA This family includes the following three closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), and lysosomal acid alpha-glucosidase (GAA), also known as acid-maltase
MGAM is one of the two enzymes responsible for catalyzing the last glucose-releasing step in starch digestion. SI is implicated in the digestion of dietary starch and major disaccharides such as sucrose and isomaltose, while GAA degrades glycogen in the lysosome, cleaving both alpha-1,4 and alpha-1,6 glucosidic linkages. MGAM and SI are anchored to small-intestinal brush-border epithelial cells. The absence of SI from the brush border membrane or its malfunction is associated with malabsorption disorders such as congenital sucrase-isomaltase deficiency (CSID). The domain architectures of MGAM and SI include two tandem GH31 catalytic domains, an N-terminal domain found near the membrane-bound end, and a C-terminal luminal domain. Both of
>cd06597 GH31_transferase_CtsY CtsY (cyclic tetrasaccharide-synthesizing enzyme Y) is a bacterial 3-alpha-isomaltosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ
CtsY and CtsZ both have a glycosyl hydrolase family 31 (GH31) catalytic domain. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
>cd06594 GH31_glucosidase_YihQ YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride
Orthologs of YihQ that have not yet been functionally characterized are present in plants and fungi. YihQ has sequence similarity to other GH31 enzymes such as CtsZ, a 6-alpha-glucosyltransferase from Bacillus globisporus, and YicI, an alpha-xylosidase from Echerichia coli. In bacteria, YihQ (along with YihO) is important for bacterial O-antigen capsule assembly and translocation.
>cd06595 GH31_xylosidase_XylS-like This family represents an uncharacterized glycosyl hydrolase family 31 (GH31) enzyme found in bacteria and eukaryotes that is related to the XylS xylosidase of Sulfolobus solfataricus
Alpha-xylosidases catalyze the release of an alpha-xylose residue from the non-reducing end of alpha-xyloside substrates. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Glycoside hydrolase family 31 GH31 from CAZY comprises enzymes with several known activities; alpha-glucosidase (3.2.1.20 from EC), alpha-galactosidase (3.2.1.22 from EC); glucoamylase (3.2.1.3 from EC), sucrase-isomaltase (3.2.1.48 from EC); isomaltase (3.2.1.10 from EC); alpha-xylosidase (3.2.1 from EC); alpha-glucan lyase (4.2.2.13 from EC). Glycoside hydrolase family 31 groups a number of glycosyl hydrolases on the basis of sequence similarities [, , ] An aspartic acid has been implicated [] in the catalytic activity of sucrase, isomaltase, and lysosomal alpha-glucosidase.; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 3L4U_A 3L4X_A 3L4W_A 3L4V_A 3CTT_A 2QMJ_A 2QLY_A 3L4Z_A 3L4Y_A 3L4T_A ....
>cd06592 GH31_glucosidase_KIAA1161 KIAA1161 is an uncharacterized Homo sapiens protein with a glycosyl hydrolase family 31 (GH31) domain that is homologous to the Escherichia coli YihQ glucosidase
Orthologs of KIA1161 are found in eukaryotes and prokaryotes. In bacteria, YihQ (along with YihO) is important for bacterial O-antigen capsule assembly and translocation. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
>pdb|3PHA|A Chain A, The Crystal Structure Of The W169y Mutant Of Alpha-Glucosidase (Gh31 Family) From Ruminococcus Obeum Atcc 29174 In Complex With Acarbose Length = 667
>pdb|3NSX|A Chain A, The Crystal Structure Of The The Crystal Structure Of The D420a Mutant Of The Alpha-Glucosidase (Family 31) From Ruminococcus Obeum Atcc 29174 Length = 666
