Psyllid ID: psy1156


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-
MVVRKTPTRSSQYYTSHIRQSSSTKQKALLAEKRNPLLEKVKNTKLTCFKANNIYSNVNNGIIDSTSLTDKSISVDCLNESITESDTSTLFKRSKSNDNVIYSHTSNDENEWGPSNAKDNQDQWPSRDATGDKNTCIDRIKAISDKYFKSNKIIVKLYSNNKKSTTRRQRSFSFGALPGLDNLKDNPLYNEEEDYDDSDSGIVNSSTNSSVVDDHYDFRATRKENCRRLSFDRTQIINKCLRTSCNDSFSSLQTCSSPQSLLLPTLECSASKCDSPTISTRSTVTSNSEKPSFLDKFRNSPSKSENGQLPNFQIQSYGYDSPILSSRSQNSSMISEKYNLDVPNIFNRNSGSQSLLEIPAYQNSSDYHSMMEISELSSENSEDSQEGQTMVRVNRRDFNEELGIYIAKIKNSSEGNIGGFVVAHIVSGGLAEKEGCLELGDEIISVNGQRLRGLTMTQAKSIISSGPLNMDLLISRTSLKKSNAENEYNESHSREKKSKETRFSLDKQNDFESSNEQDKNNQKRLFQKNCHSINNKLLRKAIISTGSISGDEEETILTSTNFCTLPRRPRSAICTFHTIVFEKGPGKKGLGFTIVGGKDSPRGAIGIFIKSILDNGQAAEDGRLKEGDEILAINGQVCHDLTHLEAISLFKTIKNGSISLHICRRLKSKKT
ccccccccccccEEEcccccccHHHHHHHHHHHHcHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccccccEEEEccccccccccccEEEEEEccccHHHHccccccccEEEEEccEEcccccHHHHHHHHHHccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccccccccEEEEcccccccccccEEEEEEccccHHHHccccccccEEEEEccEEcccccHHHHHHHHHccccccEEEEEEEEcccccc
cEEEEcccccccccccHHcHHHHHHHHHHHHHHHccHHHHHcccEEEEEccccccccccccccccHHHHcccccHHHHHHcccHHcHHHHHHHHcccccEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcHHHHHHHEcccccccccccccccccccccHHHHcccccccHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccHHHHHHHccccccccccccccccccccccccccccccHHHcccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccccEEEEEccccccccccccEEEEEEccccccccccccccccEEEEEcccccccccHHHHHHHHHHccccEEEEEEEccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccccEEEEEccccccccccEEEEEEEccccHHHHHcccccccEEEEEccEEcccccHHHHHHHHHHccccEEEEEEEcccccccc
mvvrktptrssqyytshirqssSTKQKALLAEKRNpllekvkntkltcfkanniysnvnngiidstsltdksisvdclnesitesdtstlfkrsksndnviyshtsndenewgpsnakdnqdqwpsrdatgdknTCIDRIKAISDKYFKSNKIIVKLYSnnkksttrrqrsfsfgalpgldnlkdnplyneeedyddsdsgivnsstnssvvddhydfratRKENCRRLSFDRTQIINKCLrtscndsfsslqtcsspqslllptlecsaskcdsptistrstvtsnsekpsfldkfrnspsksengqlpnfqiqsygydspilssrsqnssmisekynldvpnifnrnsgsqslleipayqnssdyhSMMEISelssensedsqegqTMVRVNRRDFNEELGIYIAKIknssegniGGFVVAHIVsgglaekegcLELGDEIISVNGQRLRGLTMTQAKsiissgplnmDLLISRTslkksnaeneyneshsrekksketrfsldkqndfessneqdknnqKRLFQKNCHSINNKLLRKAIIStgsisgdeeetiltstnfctlprrprsaictfhtivfekgpgkkglgftivggkdsprgAIGIFIKSIldngqaaedgrlkegDEILAIngqvchdlTHLEAISLFKTIKNGSISLHICRRLKSKKT
mvvrktptrssqyytshirqssstkqKALLAEkrnpllekvkntkltcfkanniysnvnnGIIDSTSLTDKSISVDCLNEsitesdtstlfkrsksndNVIYSHtsndenewgpsnakdnqdqwpsrdatgdkntCIDRIKAisdkyfksnkIIVKLysnnkksttrrqrsfsfgalpgldnlKDNPLYNEEedyddsdsgivnsstnssvvddhydfratrkencrrlsfDRTQIINKCLRTSCNDSFSSLQTCSSPQSLLLPTLECSASKCDsptistrstvtsnsekpsfLDKFRNSPSKSENGQLPNFQIQSYGYDSPILSSRSQNSSMISEKYNLDVPNIFNRNSGSQSLLEIPAYQNSSDYHSMMEISELssensedsqegqtMVRVNRRDFNEELGIYIAKiknssegniGGFVVAHIVSGGLAEKEGCLELGDEIISVNGQRLRGLTMTQAKsiissgplnmDLLISRTSlkksnaeneyneshsrekksketrfsldkqndfessneqdknnqkrlfQKNCHSINNKLLRKAIISTgsisgdeeetILTStnfctlprrprSAICTFHTivfekgpgkkgLGFTIVGGKDSPRGAIGIFIKSILDNGQAAEDGRLKEGDEILAINGQVCHDLTHLEAISLfktikngsislhicrrlkskkt
MVVRKTPTRSSQYYTSHIRQSSSTKQKALLAEKRNPLLEKVKNTKLTCFKANNIYSNVNNGIIDSTSLTDKSISVDCLNESITESDTSTLFKRSKSNDNVIYSHTSNDENEWGPSNAKDNQDQWPSRDATGDKNTCIDRIKAISDKYFKSNKIIVKLYSNNKKSTTRRQRSFSFGALPGLDNLKDNPLYNeeedyddsdsgivnsstnssvvddHYDFRATRKENCRRLSFDRTQIINKCLRTSCNDSFSSLQTCSSPQSLLLPTLECSASKCDSPTISTRSTVTSNSEKPSFLDKFRNSPSKSENGQLPNFQIQSYGYDSPILSSRSQNSSMISEKYNLDVPNIFNRNSGSQSLLEIPAYQNSSDYHSMMEISELSSENSEDSQEGQTMVRVNRRDFNEELGIYIAKIKNSSEGNIGGFVVAHIVSGGLAEKEGCLELGDEIISVNGQRLRGLTMTQAKSIISSGPLNMDLLISRTSLKKSNAENEYNESHSREKKSKETRFSLDKQNDFESSNEQDKNNQKRLFQKNCHSINNKLLRKAIISTGSISGDEEETILTSTNFCTLPRRPRSAICTFHTIVFEKGPGKKGLGFTIVGGKDSPRGAIGIFIKSILDNGQAAEDGRLKEGDEILAINGQVCHDLTHLEAISLFKTIKNGSISLHICRRLKSKKT
************************************LLEKVKNTKLTCFKANNIYSNVNNGIIDSTSLTDKSISVDCLN*******************************************************TCIDRIKAISDKYFKSNKIIVKLYS******************************************************DHYDFRATRKENCRRLSFDRTQIINKCLRTSCNDSFS*************************************************************************************************************************************************RDFNEELGIYIAKIKNSSEGNIGGFVVAHIVSGGLAEKEGCLELGDEIISVNGQRLRGLTMTQAKSIIS***L*MDLL******************************************************KNCHSINNKLLRKAIISTGSISGDEEETILTSTNFCTLPRRPRSAICTFHTIVFEKGPGKKGLGFTIVGGKDSPRGAIGIFIKSILDNGQAAEDGRLKEGDEILAINGQVCHDLTHLEAISLFKTIKNGSISLHICRR******
****************************************V***************************************************************************************************************************************************************************************************************************************************************************************************************************************************************VNRRDFNEELGIYIAKIKNSSEGNIGGFVVAHIVSGGLAEKEGCLELGDEIISVNGQRLRGLTMTQAKSIISSGPLNMDLLIS*****************************************************************************************************HTIVFEKGPGKKGLGFTIVGGKDSPRGAIGIFIKSILDNGQAAEDGRLKEGDEILAINGQVCHDLTHLEAISLFKTIKNGSISLH***R******
**************************KALLAEKRNPLLEKVKNTKLTCFKANNIYSNVNNGIIDSTSLTDKSISVDCLNESITESDTSTLFKRSKSNDNVIYSHTSNDENEWGPSNAKDNQDQWPSRDATGDKNTCIDRIKAISDKYFKSNKIIVKLYSNNKKSTTRRQRSFSFGALPGLDNLKDNPLYNEEEDYDDSDSGIVNSSTNSSVVDDHYDFRATRKENCRRLSFDRTQIINKCLRTSCNDSFSSLQTCSSPQSLLLPTLECSA*********************SFLDKFRNSPSKSENGQLPNFQIQSYGYDSPILSSRSQNSSMISEKYNLDVPNIFNRNSGSQSLLEIPAYQNSSDYHSMME*****************MVRVNRRDFNEELGIYIAKIKNSSEGNIGGFVVAHIVSGGLAEKEGCLELGDEIISVNGQRLRGLTMTQAKSIISSGPLNMDLLISRTSLKK*****************************************KRLFQKNCHSINNKLLRKAIISTGSISGDEEETILTSTNFCTLPRRPRSAICTFHTIVFEKGPGKKGLGFTIVGGKDSPRGAIGIFIKSILDNGQAAEDGRLKEGDEILAINGQVCHDLTHLEAISLFKTIKNGSISLHICRRLKSKKT
***************S*IRQSSSTKQKALLAEKRNPLLEKVKNTKLTCFKAN*********************SVDCLNESITESDTSTLFKRSKSN**************************WPSRD**GDKNTCIDRIKAISDKYFKSNKIIVKLYSNNK******QRSFSFGALPGLDNLKDNPLYN****************************************************************************************************************************************************************************************************GQTMVRVNRRDFNEELGIYIAKIKNSSEGNIGGFVVAHIVSGGLAEKEGCLELGDEIISVNGQRLRGLTMTQAKSIISSGPLNMDLLISRTS******************************NDFE************************************************************ICTFHTIVFEKGPGKKGLGFTIVGGKDSPRGAIGIFIKSILDNGQAAEDGRLKEGDEILAINGQVCHDLTHLEAISLFKTIKNGSISLHICRRL*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVVRKTPTRSSQYYTSHIRQSSSTKQKALLAEKRNPLLEKVKNTKLTCFKANNIYSNVNNGIIDSTSLTDKSISVDCLNESITESDTSTLFKRSKSNDNVIYSHTSNDENEWGPSNAKDNQDQWPSRDATGDKNTCIDRIKAISDKYFKSNKIIVKLYSNNKKSTTRRQRSFSFGALPGLDNLKDNPLYNEEEDYDDSDSGIVNSSTNSSVVDDHYDFRATRKENCRRLSFDRTQIINKCLRTSCNDSFSSLQTCSSPQSLLLPTLECSASKCDSPTISTRSTVTSNSEKPSFLDKFRNSPSKSENGQLPNFQIQSYGYDSPILSSRSQNSSMISEKYNLDVPNIFNRNSGSQSLLEIPAYQNSSDYHSMMEISELSSENSEDSQEGQTMVRVNRRDFNEELGIYIAKIKNSSEGNIGGFVVAHIVSGGLAEKEGCLELGDEIISVNGQRLRGLTMTQAKSIISSGPLNMDLLISRTSLKKSNAENEYNESHSREKKSKETRFSLDKQNDFESSNEQDKNNQKRLFQKNCHSINNKLLRKAIISTGSISGDEEETILTSTNFCTLPRRPRSAICTFHTIVFEKGPGKKGLGFTIVGGKDSPRGAIGIFIKSILDNGQAAEDGRLKEGDEILAINGQVCHDLTHLEAISLFKTIKNGSISLHICRRLKSKKT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query671 2.2.26 [Sep-21-2011]
Q9QZR8 2766 PDZ domain-containing pro yes N/A 0.383 0.092 0.329 4e-25
O15018 2839 PDZ domain-containing pro yes N/A 0.143 0.033 0.505 7e-19
O759702070 Multiple PDZ domain prote no N/A 0.298 0.096 0.276 6e-17
Q14005 1332 Pro-interleukin-16 OS=Hom no N/A 0.129 0.065 0.545 1e-16
Q8VBX62055 Multiple PDZ domain prote no N/A 0.122 0.039 0.482 1e-16
Q68DX3 1309 FERM and PDZ domain-conta no N/A 0.372 0.190 0.264 3e-16
O54824 1322 Pro-interleukin-16 OS=Mus no N/A 0.114 0.058 0.589 2e-15
O551642054 Multiple PDZ domain prote no N/A 0.122 0.039 0.482 5e-15
Q8NI35 1801 InaD-like protein OS=Homo no N/A 0.356 0.132 0.278 3e-12
Q3T0C9145 Synaptojanin-2-binding pr no N/A 0.137 0.634 0.432 6e-12
>sp|Q9QZR8|PDZD2_RAT PDZ domain-containing protein 2 OS=Rattus norvegicus GN=Pdzd2 PE=1 SV=1 Back     alignment and function desciption
 Score =  117 bits (292), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 96/291 (32%), Positives = 144/291 (49%), Gaps = 34/291 (11%)

Query: 402 LGIYIAKIKNSSEGNIGGFVVAHIVSGGLAEKEGCLELGDEIISVNGQRLRGLTMTQAKS 461
           LGI ++  + S   +    VV  +  GG A ++G L LGDE++ +NG  L GL+  +A +
Sbjct: 344 LGIQVSGGRGSKR-SPHAIVVTQVKEGGAAHRDGRLSLGDELLVINGHLLVGLSHEEAVA 402

Query: 462 IISSGPLNMDLLISRTSLKKSNAENEYNESHSREKKSK-------------ETRFS--LD 506
           I+ S    + L+++    K   +E   +   S E K               ++R S  + 
Sbjct: 403 ILRSATGMVQLVVAS---KMPGSEESQDVGSSEESKGNLESPKQGNCKTKLKSRLSGGVH 459

Query: 507 KQNDFESSNE-QDKNNQKRLFQKNCHSINNKL-LRKAIISTGSISGDEEETI-------L 557
           +    E  NE   +N   R+          K  L + + STG+    +E  I       L
Sbjct: 460 RLESVEEYNELMVRNGDPRIRMLEVSRDGRKHSLPQLLDSTGT---SQEYHIVKKSTRSL 516

Query: 558 TSTNFCTLPRRPRSAICTFHTIVFEKGPGKKGLGFTIVGGKDSPRGAIGIFIKSILDNGQ 617
           ++T+  +  R  R ++ +   +  EKG   KGLGF+I GG+D  RG +GIF+K+I  NG 
Sbjct: 517 STTHVESPWRLIRPSVISIIGLYKEKG---KGLGFSIAGGRDCIRGQMGIFVKTIFPNGS 573

Query: 618 AAEDGRLKEGDEILAINGQVCHDLTHLEAISLFKTIKNGSISLHICRRLKS 668
           AAEDGRLKEGDEIL +NG     LT  EAI  FK I++G   L +  +L S
Sbjct: 574 AAEDGRLKEGDEILDVNGIPIKGLTFQEAIHTFKQIRSGLFVLTVRTKLLS 624





Rattus norvegicus (taxid: 10116)
>sp|O15018|PDZD2_HUMAN PDZ domain-containing protein 2 OS=Homo sapiens GN=PDZD2 PE=1 SV=4 Back     alignment and function description
>sp|O75970|MPDZ_HUMAN Multiple PDZ domain protein OS=Homo sapiens GN=MPDZ PE=1 SV=2 Back     alignment and function description
>sp|Q14005|IL16_HUMAN Pro-interleukin-16 OS=Homo sapiens GN=IL16 PE=1 SV=4 Back     alignment and function description
>sp|Q8VBX6|MPDZ_MOUSE Multiple PDZ domain protein OS=Mus musculus GN=Mpdz PE=1 SV=2 Back     alignment and function description
>sp|Q68DX3|FRPD2_HUMAN FERM and PDZ domain-containing protein 2 OS=Homo sapiens GN=FRMPD2 PE=1 SV=3 Back     alignment and function description
>sp|O54824|IL16_MOUSE Pro-interleukin-16 OS=Mus musculus GN=Il16 PE=1 SV=3 Back     alignment and function description
>sp|O55164|MPDZ_RAT Multiple PDZ domain protein OS=Rattus norvegicus GN=Mpdz PE=1 SV=1 Back     alignment and function description
>sp|Q8NI35|INADL_HUMAN InaD-like protein OS=Homo sapiens GN=INADL PE=1 SV=3 Back     alignment and function description
>sp|Q3T0C9|SYJ2B_BOVIN Synaptojanin-2-binding protein OS=Bos taurus GN=SYNJ2BP PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query671
328780558768 PREDICTED: hypothetical protein LOC10057 0.867 0.757 0.333 5e-81
340709940769 PREDICTED: hypothetical protein LOC10065 0.685 0.598 0.389 7e-80
383852366756 PREDICTED: uncharacterized protein LOC10 0.678 0.601 0.387 8e-80
350399259769 PREDICTED: hypothetical protein LOC10075 0.703 0.613 0.392 3e-79
380028145767 PREDICTED: uncharacterized protein LOC10 0.695 0.608 0.387 3e-79
242014196756 pdz domain protein arc, putative [Pedicu 0.409 0.363 0.467 4e-74
156548426750 PREDICTED: hypothetical protein LOC10012 0.646 0.578 0.354 6e-73
189233639557 PREDICTED: similar to arc CG6741-PB [Tri 0.371 0.447 0.485 1e-70
357611875 872 putative pdz domain protein arc [Danaus 0.694 0.534 0.312 8e-68
307190906 781 PDZ domain-containing protein 2 [Campono 0.368 0.316 0.494 7e-66
>gi|328780558|ref|XP_003249819.1| PREDICTED: hypothetical protein LOC100578420 [Apis mellifera] Back     alignment and taxonomy information
 Score =  308 bits (790), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 244/732 (33%), Positives = 358/732 (48%), Gaps = 150/732 (20%)

Query: 25  KQKALLAEKRNPLLEKVKNTKLTCFKANNIYSNVNNGIIDST--------SLTDKSISVD 76
           K++  + EKRNPLL++VKNT+L+ FK  +          +           L   S++ +
Sbjct: 84  KERRRVCEKRNPLLDRVKNTRLSFFKDRDSDEEEQEEDEEPEKLQFRSMCELNQHSLTRN 143

Query: 77  CLNESITESDTSTLF----------KRSKS------------------------------ 96
               S+ ESD   +           +RSKS                              
Sbjct: 144 EFRRSVCESDLKEIIEEEKTQAKRKRRSKSQSRLPHRKQQEDRSSFLGLRSSAGQKMATL 203

Query: 97  NDNVIYSHTSNDENEWGPSNAKDNQDQWPSR--------------DATGDKNTCIDRI-- 140
           +D++I          W  S       Q P R              DAT    +  D I  
Sbjct: 204 SDDIIEETVGQQNRRWRKSREFVQDHQPPRRSSMDHVLEGSTSTEDATFKDGSQFDSITP 263

Query: 141 --------KAISDKYFKSN--KIIVKLYSNNKKSTTRRQ-RSFSFGALPGLDNLKDNPLY 189
                   +A+ D+Y KS+  K+I K+Y    K   RR+ RSFS+G LPGL+ L+ NPLY
Sbjct: 264 SSCLAAKFRAMQDRYLKSSTSKLIAKIYKKEGKDKERRRLRSFSYGTLPGLEELRTNPLY 323

Query: 190 NEEEDYDDSDSGIVNSSTNSSVVDDHYDFRATRKENCRRLSFDRTQIINKCLRTSCNDSF 249
            EE+D DD+DSGI+++ + +S + D                 DR       L T+ NDS 
Sbjct: 324 -EEQDQDDNDSGILDNDSATSSLLD-----------------DRCSSSASGLLTTLNDS- 364

Query: 250 SSLQTCSSPQSLLLPTLECSASKCDSPTISTRSTVTSNSEKPSFLDKF---------RNS 300
            SL   S PQ   LP  + S+S  D         V   ++  S LD +         R  
Sbjct: 365 -SLN--SPPQ---LPPRKPSSSIVD---------VERTAKMFSSLDVYCGRNEGRGCRKD 409

Query: 301 PSKSENGQLPNFQIQSYGYDSPILSSRSQNSSMISEKYNLDVPNIFNRNSGSQSLLEIPA 360
            S+    +  + QI     ++ ++  + ++SS +SE+      N+  R +    L     
Sbjct: 410 MSRFNALEDSSSQI-CQAANNELIDRQDRDSSKLSEE-----KNVIERLNSKDCL----- 458

Query: 361 YQNSSDYHSMMEISELSSENSEDSQEGQTMVRVNRRDFNEELGIYIAKIKNSSEGNIGGF 420
              S +Y S    S LS   +        +V++ R   ++ LGI+IAK   SS G    +
Sbjct: 459 --RSENYQS----SRLSVIRNRSYTTETMVVKLPRESSDQCLGIFIAKTAESSPG----Y 508

Query: 421 VVAHIVSGGLAEKEGCLELGDEIISVNGQRLRGLTMTQAKSIISSG--PLNMDLLISRTS 478
           +VAH+V  GLA+KEG L +GDEI+ VNG+RLRGL+M +A+ I+ SG  P ++D+++SR S
Sbjct: 509 LVAHVVPNGLADKEGTLRIGDEILIVNGKRLRGLSMAEARKILGSGNGPGDVDIVVSRYS 568

Query: 479 LKKSNAENEYNESHSREKKSKETRFSLDKQNDFESSNEQDKNNQKRLFQKNCHSINNKLL 538
               + +     S   E    E    +  +N   +   + +    R  +  C+   +   
Sbjct: 569 AVDQSPKKLTESSVDYENVHMENGHGVIVENSPGTHFRKHQTKHHRDRKNECNRTGSS-- 626

Query: 539 RKAIISTGSISGDEEETILTSTNFCTLPRRPRSAICTFHTIVFEKGPGKKGLGFTIVGGK 598
            KA++  G+ S +        +NFCTLPRRPR+ + TF T+VF+KGPGKK LGFTIVGG 
Sbjct: 627 DKAVVENGTSSQN-------VSNFCTLPRRPRNTVSTFLTVVFQKGPGKKSLGFTIVGGS 679

Query: 599 DSPRGAIGIFIKSILDNGQAAEDGRLKEGDEILAINGQVCHDLTHLEAISLFKTIKNGSI 658
           DSP+G+IGIFIKS+L  GQAAEDGRL+ GDEILA+NG VCHDLTH +A+ LF+ IK G +
Sbjct: 680 DSPKGSIGIFIKSVLPGGQAAEDGRLRAGDEILAVNGHVCHDLTHRKAVQLFRNIKTGPV 739

Query: 659 SLHICRRLKSKK 670
           +LH+CRR+K+K+
Sbjct: 740 ALHLCRRIKNKE 751




Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|340709940|ref|XP_003393557.1| PREDICTED: hypothetical protein LOC100650950 [Bombus terrestris] Back     alignment and taxonomy information
>gi|383852366|ref|XP_003701699.1| PREDICTED: uncharacterized protein LOC100880562 [Megachile rotundata] Back     alignment and taxonomy information
>gi|350399259|ref|XP_003485471.1| PREDICTED: hypothetical protein LOC100750183 [Bombus impatiens] Back     alignment and taxonomy information
>gi|380028145|ref|XP_003697769.1| PREDICTED: uncharacterized protein LOC100871550 [Apis florea] Back     alignment and taxonomy information
>gi|242014196|ref|XP_002427779.1| pdz domain protein arc, putative [Pediculus humanus corporis] gi|212512237|gb|EEB15041.1| pdz domain protein arc, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|156548426|ref|XP_001604728.1| PREDICTED: hypothetical protein LOC100121142 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|189233639|ref|XP_001813427.1| PREDICTED: similar to arc CG6741-PB [Tribolium castaneum] gi|270014407|gb|EFA10855.1| hypothetical protein TcasGA2_TC001632 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357611875|gb|EHJ67690.1| putative pdz domain protein arc [Danaus plexippus] Back     alignment and taxonomy information
>gi|307190906|gb|EFN74730.1| PDZ domain-containing protein 2 [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query671
FB|FBgn00000081329 a "arc" [Drosophila melanogast 0.147 0.074 0.535 6.6e-27
RGD|619958 2766 Pdzd2 "PDZ domain containing 2 0.396 0.096 0.336 2.8e-22
UNIPROTKB|F1NBK4 1141 F1NBK4 "Uncharacterized protei 0.132 0.078 0.6 6.8e-19
RGD|31052054 Mpdz "multiple PDZ domain prot 0.122 0.039 0.482 1.2e-18
MGI|MGI:13434892055 Mpdz "multiple PDZ domain prot 0.122 0.039 0.482 1.2e-18
UNIPROTKB|D4A2W42068 Mpdz "Multiple PDZ domain prot 0.122 0.039 0.482 1.3e-18
UNIPROTKB|F1MMT32056 F1MMT3 "Uncharacterized protei 0.122 0.039 0.458 1.7e-18
UNIPROTKB|O759702070 MPDZ "Multiple PDZ domain prot 0.122 0.039 0.470 2.1e-18
UNIPROTKB|F1SMP51588 MPDZ "Uncharacterized protein" 0.175 0.074 0.359 1.7e-17
UNIPROTKB|O15018 2839 PDZD2 "PDZ domain-containing p 0.274 0.064 0.355 1.3e-16
FB|FBgn0000008 a "arc" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 274 (101.5 bits), Expect = 6.6e-27, Sum P(3) = 6.6e-27
 Identities = 53/99 (53%), Positives = 69/99 (69%)

Query:   571 SAICTFHTIVFEKGPGKKGLGFTIVGGKDSPRGAIGIFIKSILDNGQAAEDGRLKEGDEI 630
             S  CT  TI F KGPG K LGF+IVGG+DSP+G +GIF+K++  +GQAA+DG L+ GDEI
Sbjct:  1225 SGRCTPKTITFFKGPGLKSLGFSIVGGRDSPKGNMGIFVKTVFPSGQAADDGTLQAGDEI 1284

Query:   631 LAINGQVCHDLTHLEAISLFKTIKNGSISLHICRRLKSK 669
             + ING     ++H E I LFK ++ G+I L I RR   K
Sbjct:  1285 VEINGNSVQGMSHAETIGLFKNVREGTIVLKILRRKLQK 1323


GO:0005912 "adherens junction" evidence=IDA
GO:0048749 "compound eye development" evidence=IMP
GO:0016324 "apical plasma membrane" evidence=IDA
GO:0003674 "molecular_function" evidence=ND
RGD|619958 Pdzd2 "PDZ domain containing 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NBK4 F1NBK4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|3105 Mpdz "multiple PDZ domain protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1343489 Mpdz "multiple PDZ domain protein" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|D4A2W4 Mpdz "Multiple PDZ domain protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MMT3 F1MMT3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O75970 MPDZ "Multiple PDZ domain protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SMP5 MPDZ "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|O15018 PDZD2 "PDZ domain-containing protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query671
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 4e-21
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 2e-18
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 6e-13
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 1e-12
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 7e-12
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 4e-11
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 2e-07
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 3e-06
cd0098885 cd00988, PDZ_CTP_protease, PDZ domain of C-termina 5e-05
cd0098979 cd00989, PDZ_metalloprotease, PDZ domain of bacter 7e-05
cd0098885 cd00988, PDZ_CTP_protease, PDZ domain of C-termina 8e-05
cd0098979 cd00989, PDZ_metalloprotease, PDZ domain of bacter 6e-04
pfam1318081 pfam13180, PDZ_2, PDZ domain 6e-04
cd0098790 cd00987, PDZ_serine_protease, PDZ domain of tryspi 0.001
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
 Score = 87.6 bits (218), Expect = 4e-21
 Identities = 35/87 (40%), Positives = 47/87 (54%), Gaps = 6/87 (6%)

Query: 577 HTIVFEKGPGKKGLGFTIVGGKDSPRGAIGIFIKSILDNGQAAEDGRLKEGDEILAINGQ 636
            T+   K PG  GLGF++ GGKDS  G   IF+  +   G  AE G L+ GD IL +NG 
Sbjct: 2   RTVTLRKDPGG-GLGFSLRGGKDSGGG---IFVSRVEPGG-PAERGGLRVGDRILEVNGV 56

Query: 637 VCHDLTHLEAISLFKTIKNGSISLHIC 663
               LTH EA+ L K   +  ++L + 
Sbjct: 57  SVEGLTHEEAVELLKNSGD-EVTLTVR 82


May be responsible for specific protein-protein interactions, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of PDZ domains an N-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in proteases. Length = 82

>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|238488 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>gnl|CDD|238489 cd00989, PDZ_metalloprotease, PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>gnl|CDD|238488 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>gnl|CDD|238489 cd00989, PDZ_metalloprotease, PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>gnl|CDD|221961 pfam13180, PDZ_2, PDZ domain Back     alignment and domain information
>gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 671
KOG3209|consensus984 99.92
KOG3209|consensus 984 99.87
KOG3580|consensus 1027 99.8
KOG3580|consensus 1027 99.78
PRK10139455 serine endoprotease; Provisional 99.57
KOG3605|consensus829 99.57
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 99.55
PRK10942473 serine endoprotease; Provisional 99.55
KOG3571|consensus626 99.54
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 99.44
PRK10779 449 zinc metallopeptidase RseP; Provisional 99.43
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 99.34
KOG3550|consensus207 99.28
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 99.27
KOG3550|consensus207 99.13
KOG3549|consensus 505 99.02
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 99.0
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.98
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 98.93
KOG3551|consensus 506 98.91
KOG3551|consensus 506 98.91
KOG3549|consensus 505 98.89
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 98.88
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 98.86
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 98.85
KOG3553|consensus124 98.83
KOG1892|consensus 1629 98.78
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.75
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.74
KOG3571|consensus 626 98.71
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 98.66
KOG1892|consensus 1629 98.64
KOG3553|consensus124 98.57
KOG3606|consensus358 98.52
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.5
KOG3552|consensus 1298 98.49
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.47
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.46
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 98.35
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 98.28
KOG3651|consensus 429 98.26
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 98.25
KOG0609|consensus 542 98.22
KOG3651|consensus 429 98.21
PLN00049 389 carboxyl-terminal processing protease; Provisional 98.21
KOG3542|consensus 1283 98.18
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 98.18
TIGR00225 334 prc C-terminal peptidase (prc). A C-terminal pepti 98.17
KOG3552|consensus 1298 98.15
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.15
COG0793 406 Prc Periplasmic protease [Cell envelope biogenesis 98.15
KOG3606|consensus358 98.14
KOG4371|consensus1332 98.1
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.06
KOG3605|consensus829 98.02
PRK11186 667 carboxy-terminal protease; Provisional 97.95
KOG0609|consensus 542 97.93
TIGR00225334 prc C-terminal peptidase (prc). A C-terminal pepti 97.92
PLN00049389 carboxyl-terminal processing protease; Provisional 97.91
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 97.9
KOG3542|consensus 1283 97.88
TIGR01713259 typeII_sec_gspC general secretion pathway protein 97.87
COG0793406 Prc Periplasmic protease [Cell envelope biogenesis 97.82
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 97.79
PRK10139 455 serine endoprotease; Provisional 97.72
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 97.72
TIGR02037 428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 97.67
PRK10898353 serine endoprotease; Provisional 97.65
PRK11186 667 carboxy-terminal protease; Provisional 97.64
PRK10898353 serine endoprotease; Provisional 97.63
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 97.6
TIGR01713259 typeII_sec_gspC general secretion pathway protein 97.55
PRK10942473 serine endoprotease; Provisional 97.54
TIGR02860 402 spore_IV_B stage IV sporulation protein B. SpoIVB, 97.37
PRK10779 449 zinc metallopeptidase RseP; Provisional 97.36
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 97.31
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 97.19
KOG3938|consensus334 97.17
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 97.17
KOG3834|consensus 462 96.94
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 96.89
COG0265347 DegQ Trypsin-like serine proteases, typically peri 96.88
KOG3938|consensus 334 96.83
KOG1421|consensus 955 96.78
KOG0606|consensus 1205 96.63
KOG1421|consensus955 96.39
TIGR02860402 spore_IV_B stage IV sporulation protein B. SpoIVB, 96.29
KOG4407|consensus 1973 96.28
COG0265347 DegQ Trypsin-like serine proteases, typically peri 96.23
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 96.22
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 96.2
KOG3532|consensus 1051 96.02
KOG1738|consensus 638 96.0
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 95.99
KOG3129|consensus231 95.75
COG3975558 Predicted protease with the C-terminal PDZ domain 95.66
COG3975558 Predicted protease with the C-terminal PDZ domain 95.56
KOG1738|consensus 638 95.52
KOG3129|consensus231 95.43
PRK09681276 putative type II secretion protein GspC; Provision 95.21
KOG0606|consensus 1205 95.18
COG3480 342 SdrC Predicted secreted protein containing a PDZ d 94.71
COG3031275 PulC Type II secretory pathway, component PulC [In 93.95
KOG3532|consensus 1051 93.82
PRK09681276 putative type II secretion protein GspC; Provision 93.79
KOG1320|consensus473 93.52
PF1281278 PDZ_1: PDZ-like domain 92.24
COG3480342 SdrC Predicted secreted protein containing a PDZ d 92.1
KOG4371|consensus1332 90.18
KOG1320|consensus473 89.84
COG3031275 PulC Type II secretory pathway, component PulC [In 89.37
COG0750 375 Predicted membrane-associated Zn-dependent proteas 85.35
>KOG3209|consensus Back     alignment and domain information
Probab=99.92  E-value=3.1e-24  Score=238.11  Aligned_cols=231  Identities=28%  Similarity=0.389  Sum_probs=157.7

Q ss_pred             CCCeEEEEEEeCCCCCcccEEEeeecCCCCCCcCcEEEEEEcCCChhhhcCCCCCCCEEEccCCeeccCCCHHHHHHHHh
Q psy1156         385 QEGQTMVRVNRRDFNEELGIYIAKIKNSSEGNIGGFVVAHIVSGGLAEKEGCLELGDEIISVNGQRLRGLTMTQAKSIIS  464 (671)
Q Consensus       385 ~~~~~~V~L~k~~~~~~LGfsI~gg~~~~~g~~~GI~Vs~V~pGspA~raG~L~~GD~IlaVNG~~V~~~s~~~av~~L~  464 (671)
                      ..+...|.|.+. .+++|||.|......+     +.-|.+|.+||||+++|+|++||+|++|||+++..++|.+.+.+++
T Consensus       751 ~~~~yDV~lhR~-ENeGFGFVi~sS~~kp-----~sgiGrIieGSPAdRCgkLkVGDrilAVNG~sI~~lsHadiv~LIK  824 (984)
T KOG3209|consen  751 PSGPYDVVLHRK-ENEGFGFVIMSSQNKP-----ESGIGRIIEGSPADRCGKLKVGDRILAVNGQSILNLSHADIVSLIK  824 (984)
T ss_pred             CCCCeeeEEecc-cCCceeEEEEecccCC-----CCCccccccCChhHhhccccccceEEEecCeeeeccCchhHHHHHH
Confidence            345678999874 5799999999776543     3339999999999999999999999999999999999999999999


Q ss_pred             cCCCeEEEEEEeCCcccccccccccccccccccccccccccccCCcccCCcccchhhhhhhccccccccchhhhhhcccc
Q psy1156         465 SGPLNMDLLISRTSLKKSNAENEYNESHSREKKSKETRFSLDKQNDFESSNEQDKNNQKRLFQKNCHSINNKLLRKAIIS  544 (671)
Q Consensus       465 ~~g~~V~L~V~R~~~~~~~a~~~~~~~~s~~~~~~~~~ss~d~e~~~~ssp~~~k~s~~~~~q~~~~s~~~~~~r~~v~s  544 (671)
                      .+|-.|+|+|.-.........     ..+.++.+.+....+..++              ...+...++...++       
T Consensus       825 daGlsVtLtIip~ee~~~~~~-----~~sa~~~s~~t~~~~~~q~--------------~glp~~~~s~~~~~-------  878 (984)
T KOG3209|consen  825 DAGLSVTLTIIPPEEAGPPTS-----MTSAEKQSPFTQNGPYEQQ--------------YGLPGPRPSVYEEH-------  878 (984)
T ss_pred             hcCceEEEEEcChhccCCCCC-----CcchhhcCcccccCCHhHc--------------cCCCCCCccccccC-------
Confidence            999999999976443211100     0000111111110000000              00000000000000       


Q ss_pred             cCCCCCchhhhhhccCCccCCCCCCCCcccceeeEEEeeCCCCCcccEEEecCCCCCCCCcceeEEEeCCCCHHhHhCCC
Q psy1156         545 TGSISGDEEETILTSTNFCTLPRRPRSAICTFHTIVFEKGPGKKGLGFTIVGGKDSPRGAIGIFIKSILDNGQAAEDGRL  624 (671)
Q Consensus       545 ~~s~s~d~~~s~~~s~~~~~lP~~p~s~~~~~~~V~L~K~~g~~~LGfsL~Gg~ds~~g~~GVfIssV~pgSpAaraGrL  624 (671)
                        . .++...-        ..-.........+++|+|+|+.  .+|||+|+||...   .+++||-+++++|||.++|+|
T Consensus       879 --p-qpdt~~~--------~~~~~r~~qn~~~~~VelErG~--kGFGFSiRGGrey---nM~LfVLRlAeDGPA~rdGrm  942 (984)
T KOG3209|consen  879 --P-QPDTFQG--------LSINDRMSQNGDLYTVELERGA--KGFGFSIRGGREY---NMDLFVLRLAEDGPAIRDGRM  942 (984)
T ss_pred             --C-CCccccc--------eeccccccccCCeeEEEeeccc--cccceEeeccccc---ccceEEEEeccCCCccccCce
Confidence              0 0000000        0000111233467899999997  8999999999654   589999999999999999999


Q ss_pred             CCCCEEEEECCeecCCCCHHHHHHHHHhcCCCcEEEEEEe
Q psy1156         625 KEGDEILAINGQVCHDLTHLEAISLFKTIKNGSISLHICR  664 (671)
Q Consensus       625 r~GDrILeVNG~sV~~lSheEAV~lLK~sg~~~VtL~V~R  664 (671)
                      ++||+|++|||++..+|+|..|+++||+-+ ..|.|++.|
T Consensus       943 ~VGDqi~eINGesTkgmtH~rAIelIk~gg-~~vll~Lr~  981 (984)
T KOG3209|consen  943 RVGDQITEINGESTKGMTHDRAIELIKQGG-RRVLLLLRR  981 (984)
T ss_pred             eecceEEEecCcccCCCcHHHHHHHHHhCC-eEEEEEecc
Confidence            999999999999999999999999999854 344444443



>KOG3209|consensus Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>KOG3550|consensus Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>KOG3550|consensus Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query671
2fne_A117 The Crystal Structure Of The 13th Pdz Domain Of Mpd 2e-16
2o2t_A117 The Crystal Structure Of The 1st Pdz Domain Of Mpdz 2e-12
2jik_A101 Crystal Structure Of Pdz Domain Of Synaptojanin-2 B 1e-11
2eno_A120 Solution Structure Of The Pdz Domain From Human Syn 2e-11
2jin_A102 Crystal Structure Of Pdz Domain Of Synaptojanin-2 B 1e-10
2xkx_A 721 Single Particle Analysis Of Psd-95 In Negative Stai 7e-10
2xkx_A 721 Single Particle Analysis Of Psd-95 In Negative Stai 5e-09
2dm8_A116 Solution Structure Of The Eighth Pdz Domain Of Huma 1e-09
3zrt_A199 Crystal Structure Of Human Psd-95 Pdz1-2 Length = 1 3e-09
2wl7_A102 Crystal Structure Of The Psd93 Pdz1 Domain Length = 6e-09
2ka9_A189 Solution Structure Of Psd-95 Pdz12 Complexed With C 9e-09
3gsl_A196 Crystal Structure Of Psd-95 Tandem Pdz Domains 1 An 1e-08
1iu0_A91 The First Pdz Domain Of Psd-95 Length = 91 2e-08
1rgr_A99 Cyclic Peptides Targeting Pdz Domains Of Psd-95: St 2e-08
1kef_A93 Pdz1 Of Sap90 Length = 93 2e-08
2opg_A98 The Crystal Structure Of The 10th Pdz Domain Of Mpd 2e-08
2byg_A117 2nd Pdz Domain Of Discs Large Homologue 2 Length = 2e-08
2qg1_A92 Crystal Structure Of The 11th Pdz Domain Of Mpdz (M 2e-08
3rl7_B107 Crytal Structure Of Hdlg1-Pdz1 Complexed With Apc L 3e-08
1zok_A93 Pdz1 Domain Of Synapse Associated Protein 97 Length 3e-08
2daz_A124 Solution Structure Of The 7th Pdz Domain Of Inad-Li 4e-08
1um1_A110 Solution Structure Of Rsgi Ruh-007, Pdz Domain In H 5e-08
2iwo_A120 12th Pdz Domain Of Multiple Pdz Domain Protein Mpdz 5e-08
4amh_A106 Influence Of Circular Permutation On The Folding Pa 6e-08
3rl8_A105 Crytal Structure Of Hdlg1-Pdz2 Complexed With Apc L 7e-08
1qlc_A95 Solution Structure Of The Second Pdz Domain Of Post 9e-08
2aww_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 1e-07
2i0l_A84 X-Ray Crystal Structure Of Sap97 Pdz2 Bound To The 1e-07
1wfv_A103 Solution Structure Of The Fifth Pdz Domain Of Human 1e-07
2g2l_A105 Crystal Structure Of The Second Pdz Domain Of Sap97 1e-07
2oqs_A97 Structure Of The HdlgSAP97 PDZ2 IN COMPLEX WITH HPV 1e-07
2ogp_A97 Solution Structure Of The Second Pdz Domain Of Par- 1e-07
2x7z_A99 Crystal Structure Of The Sap97 Pdz2 I342w C378a Mut 1e-07
2koj_A111 Solution Structure Of Mouse Par-3 Pdz2 (Residues 45 2e-07
2i04_A85 X-Ray Crystal Structure Of Magi-1 Pdz1 Bound To The 2e-07
2kpk_A129 Magi-1 Pdz1 Length = 129 2e-07
2awx_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 2e-07
2awu_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 2e-07
4g69_A100 Structure Of The Human Discs Large 1 Pdz2 - Adenoma 2e-07
2kom_A121 Solution Structure Of Humar Par-3b Pdz2 (Residues 4 3e-07
2fe5_A94 The Crystal Structure Of The Second Pdz Domain Of H 3e-07
1ueq_A123 Solution Structure Of The First Pdz Domain Of Human 4e-07
1tp3_A119 Pdz3 Domain Of Psd-95 Protein Complexed With Kketpv 4e-07
2db5_A128 Solution Structure Of The First Pdz Domain Of Inad- 7e-07
1vj6_A102 Pdz2 From Ptp-Bl In Complex With The C-Terminal Lig 7e-07
1gm1_A94 Second Pdz Domain (Pdz2) Of Ptp-Bl Length = 94 8e-07
3i4w_A104 Crystal Structure Of The Third Pdz Domain Of Psd-95 8e-07
1be9_A119 The Third Pdz Domain From The Synaptic Protein Psd- 9e-07
2koh_A111 Nmr Structure Of Mouse Par3-Pdz3 In Complex With Ve 9e-07
2i1n_A102 Crystal Structure Of The 1st Pdz Domain Of Human Dl 9e-07
2k1z_A104 Solution Structure Of Par-3 Pdz3 Length = 104 9e-07
2r4h_B112 Crystal Structure Of A C1190s Mutant Of The 6th Pdz 9e-07
3k82_A98 Crystal Structure Of The Third Pdz Domain Of Psd-95 1e-06
1uhp_A107 Solution Structure Of Rsgi Ruh-005, A Pdz Domain In 1e-06
3jxt_A104 Crystal Structure Of The Third Pdz Domain Of Sap-10 1e-06
1um7_A113 Solution Structure Of The Third Pdz Domain Of Synap 1e-06
2he2_A102 Crystal Structure Of The 3rd Pdz Domain Of Human Di 1e-06
1uju_A111 Solution Structure Of The Fourth Pdz Domain Of Huma 2e-06
1i16_A130 Structure Of Interleukin 16: Implications For Funct 3e-06
1wha_A105 Solution Structure Of The Second Pdz Domain Of Huma 3e-06
3pdz_A96 Solution Structure Of The Pdz2 Domain From Human Ph 3e-06
1d5g_A96 Solution Structure Of The Pdz2 Domain From Human Ph 3e-06
2djt_A104 Solution Structures Of The Pdz Domain Of Human Unna 3e-06
1wg6_A127 Solution Structure Of Pdz Domain In Protein Xp_1108 3e-06
3axa_A106 Crystal Structure Of Afadin Pdz Domain In Complex W 3e-06
1xz9_A101 Structure Of Af-6 Pdz Domain Length = 101 4e-06
1t2m_A101 Solution Structure Of The Pdz Domain Of Af-6 Length 5e-06
2ain_A93 Solution Structure Of The Af-6 Pdz Domain Complexed 5e-06
1wi2_A104 Solution Structure Of The Pdz Domain From Riken Cdn 6e-06
1ozi_A99 The Alternatively Spliced Pdz2 Domain Of Ptp-Bl Len 7e-06
1x6d_A119 Solution Structures Of The Pdz Domain Of Human Inte 8e-06
1ihj_A98 Crystal Structure Of The N-Terminal Pdz Domain Of I 8e-06
2dlu_A111 Solution Structure Of The Second Pdz Domain Of Huma 1e-05
2h2c_A107 Crystal Structure Of Zo-1 Pdz1 Bound To A Phage-Der 2e-05
3cbx_A105 The Dvl2 Pdz Domain In Complex With The C1 Inhibito 2e-05
2h2b_A107 Crystal Structure Of Zo-1 Pdz1 Bound To A Phage-der 2e-05
3cby_A108 The Dvl2 Pdz Domain In Complex With The N1 Inhibito 2e-05
3cc0_A108 The Dvl2 Pdz Domain In Complex With The N3 Inhibito 2e-05
1mc7_A95 Solution Structure Of Mdvl1 Pdz Domain Length = 95 3e-05
3cbz_A108 The Dvl2 Pdz Domain In Complex With The N2 Inhibito 3e-05
2kaw_A90 Nmr Structure Of The Mdvl1 Pdz Domain In Complex Wi 4e-05
1ujd_A117 Solution Structure Of Rsgi Ruh-003, A Pdz Domain Of 4e-05
2rrm_A100 Interplay Between Phosphatidyl-Inositol-Phosphates 4e-05
2h3m_A97 Crystal Structure Of Zo-1 Pdz1 Length = 97 4e-05
2rey_A100 Crystal Structure Of The Pdz Domain Of Human Dishev 4e-05
3k1r_A192 Structure Of Harmonin Npdz1 In Complex With The Sam 5e-05
2i0i_A85 X-Ray Crystal Structure Of Sap97 Pdz3 Bound To The 5e-05
2csj_A117 Solution Structure Of N-Terminal Pdz Domain From Mo 5e-05
1u3b_A185 Auto-Inhibition Mechanism Of X11sMINTS FAMILY SCAFF 6e-05
2fcf_A103 The Crystal Structure Of The 7th Pdz Domain Of Mpdz 6e-05
2iwq_A123 7th Pdz Domain Of Multiple Pdz Domain Protein Mpdz 7e-05
2dkr_A93 Solution Structure Of The Pdz Domain From Human Lin 7e-05
1uf1_A128 Solution Structure Of The Second Pdz Domain Of Huma 8e-05
2vwr_A95 Crystal Structure Of The Second Pdz Domain Of Numb- 9e-05
1pdr_A99 Crystal Structure Of The Third Pdz Domain From The 9e-05
1uep_A103 Solution Structure Of The Third Pdz Domain Of Human 9e-05
1u38_A89 Auto-Inhibition Mechanism Of X11sMINTS FAMILY SCAFF 1e-04
1wh1_A124 Solution Structure Of The Fourth Pdz Domain Of Kiaa 1e-04
2d92_A108 Solution Structure Of The Fifth Pdz Domain Of Inad- 1e-04
1q7x_A108 Solution Structure Of The Alternatively Spliced Pdz 1e-04
1uez_A101 Solution Structure Of The First Pdz Domain Of Human 2e-04
2fn5_A94 Nmr Structure Of The Neurabin Pdz Domain (502-594) 2e-04
2lc6_A128 Solution Structure Of Par-6 Q144cL164C Length = 128 2e-04
1rzx_A98 Crystal Structure Of A Par-6 Pdz-Peptide Complex Le 2e-04
1ry4_A128 Nmr Structure Of The Crib-Pdz Module Of Par-6 Lengt 3e-04
1x8s_A102 Structure Of The Par-6 Pdz Domain With A Pals1 Inte 3e-04
1x45_A98 Solution Structure Of The First Pdz Domain Of Amylo 3e-04
1l6o_A95 Xenopus Dishevelled Pdz Domain Length = 95 4e-04
1wf8_A107 Solution Structure Of The Pdz Domain Of Spinophilin 4e-04
2f0a_A98 Crystal Structure Of Monomeric Uncomplexed Form Of 4e-04
3fy5_A91 Dishevelled Pdz Domain Homodimer Length = 91 4e-04
3b76_A118 Crystal Structure Of The Third Pdz Domain Of Human 4e-04
3r0h_A206 Structure Of Inad Pdz45 In Complex With Ng2 Peptide 4e-04
1v6b_A118 Solution Structure Of The Third Pdz Domain Of Mouse 5e-04
2iwn_A97 3rd Pdz Domain Of Multiple Pdz Domain Protein Mpdz 6e-04
2g5m_B113 Spinophilin Pdz Domain Length = 113 7e-04
3hvq_C170 Crystal Structure Of A Complex Between Protein Phos 8e-04
3hpm_A111 Oxidized Dimeric Pick1 Pdz C46g Mutant In Complex W 8e-04
>pdb|2FNE|A Chain A, The Crystal Structure Of The 13th Pdz Domain Of Mpdz Length = 117 Back     alignment and structure

Iteration: 1

Score = 84.3 bits (207), Expect = 2e-16, Method: Composition-based stats. Identities = 40/85 (47%), Positives = 60/85 (70%), Gaps = 3/85 (3%) Query: 578 TIVFEKGPGKKGLGFTIVGGKDSPRGAIGIFIKSILDNGQAAEDGRLKEGDEILAINGQV 637 +I E+GP GLGF+IVGG SP G + I++K++ G A+EDGRLK GD+I+A+NGQ Sbjct: 28 SITLERGP--DGLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQS 85 Query: 638 CHDLTHLEAISLFKTIKNGSISLHI 662 +TH EA+++ K K G+++L + Sbjct: 86 LEGVTHEEAVAILKRTK-GTVTLMV 109
>pdb|2O2T|A Chain A, The Crystal Structure Of The 1st Pdz Domain Of Mpdz Length = 117 Back     alignment and structure
>pdb|2JIK|A Chain A, Crystal Structure Of Pdz Domain Of Synaptojanin-2 Binding Protein Length = 101 Back     alignment and structure
>pdb|2ENO|A Chain A, Solution Structure Of The Pdz Domain From Human Synaptojanin 2 Binding Protein Length = 120 Back     alignment and structure
>pdb|2JIN|A Chain A, Crystal Structure Of Pdz Domain Of Synaptojanin-2 Binding Protein Length = 102 Back     alignment and structure
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure
>pdb|2DM8|A Chain A, Solution Structure Of The Eighth Pdz Domain Of Human Inad- Like Protein Length = 116 Back     alignment and structure
>pdb|3ZRT|A Chain A, Crystal Structure Of Human Psd-95 Pdz1-2 Length = 199 Back     alignment and structure
>pdb|2WL7|A Chain A, Crystal Structure Of The Psd93 Pdz1 Domain Length = 102 Back     alignment and structure
>pdb|2KA9|A Chain A, Solution Structure Of Psd-95 Pdz12 Complexed With Cypin Peptide Length = 189 Back     alignment and structure
>pdb|3GSL|A Chain A, Crystal Structure Of Psd-95 Tandem Pdz Domains 1 And 2 Length = 196 Back     alignment and structure
>pdb|1IU0|A Chain A, The First Pdz Domain Of Psd-95 Length = 91 Back     alignment and structure
>pdb|1RGR|A Chain A, Cyclic Peptides Targeting Pdz Domains Of Psd-95: Structural Basis For Enhanced Affinity And Enzymatic Stability Length = 99 Back     alignment and structure
>pdb|1KEF|A Chain A, Pdz1 Of Sap90 Length = 93 Back     alignment and structure
>pdb|2OPG|A Chain A, The Crystal Structure Of The 10th Pdz Domain Of Mpdz Length = 98 Back     alignment and structure
>pdb|2BYG|A Chain A, 2nd Pdz Domain Of Discs Large Homologue 2 Length = 117 Back     alignment and structure
>pdb|2QG1|A Chain A, Crystal Structure Of The 11th Pdz Domain Of Mpdz (Mupp1) Length = 92 Back     alignment and structure
>pdb|3RL7|B Chain B, Crytal Structure Of Hdlg1-Pdz1 Complexed With Apc Length = 107 Back     alignment and structure
>pdb|1ZOK|A Chain A, Pdz1 Domain Of Synapse Associated Protein 97 Length = 93 Back     alignment and structure
>pdb|2DAZ|A Chain A, Solution Structure Of The 7th Pdz Domain Of Inad-Like Protein Length = 124 Back     alignment and structure
>pdb|1UM1|A Chain A, Solution Structure Of Rsgi Ruh-007, Pdz Domain In Human Cdna Length = 110 Back     alignment and structure
>pdb|2IWO|A Chain A, 12th Pdz Domain Of Multiple Pdz Domain Protein Mpdz (Casp Target) Length = 120 Back     alignment and structure
>pdb|4AMH|A Chain A, Influence Of Circular Permutation On The Folding Pathway Of A Pdz Domain Length = 106 Back     alignment and structure
>pdb|3RL8|A Chain A, Crytal Structure Of Hdlg1-Pdz2 Complexed With Apc Length = 105 Back     alignment and structure
>pdb|1QLC|A Chain A, Solution Structure Of The Second Pdz Domain Of Postsynaptic Density-95 Length = 95 Back     alignment and structure
>pdb|2AWW|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378g With C-Terminal Glur-A Peptide Length = 105 Back     alignment and structure
>pdb|2I0L|A Chain A, X-Ray Crystal Structure Of Sap97 Pdz2 Bound To The C- Terminal Peptide Of Hpv18 E6. Length = 84 Back     alignment and structure
>pdb|1WFV|A Chain A, Solution Structure Of The Fifth Pdz Domain Of Human Membrane Associated Guanylate Kinase Inverted-2 (Kiaa0705 Protein) Length = 103 Back     alignment and structure
>pdb|2G2L|A Chain A, Crystal Structure Of The Second Pdz Domain Of Sap97 In Complex With A Glur-A C-Terminal Peptide Length = 105 Back     alignment and structure
>pdb|2OQS|A Chain A, Structure Of The HdlgSAP97 PDZ2 IN COMPLEX WITH HPV-18 Papillomavirus E6 Peptide Length = 97 Back     alignment and structure
>pdb|2OGP|A Chain A, Solution Structure Of The Second Pdz Domain Of Par-3 Length = 97 Back     alignment and structure
>pdb|2X7Z|A Chain A, Crystal Structure Of The Sap97 Pdz2 I342w C378a Mutant Protein Domain Length = 99 Back     alignment and structure
>pdb|2KOJ|A Chain A, Solution Structure Of Mouse Par-3 Pdz2 (Residues 450-558) Length = 111 Back     alignment and structure
>pdb|2I04|A Chain A, X-Ray Crystal Structure Of Magi-1 Pdz1 Bound To The C- Terminal Peptide Of Hpv18 E6 Length = 85 Back     alignment and structure
>pdb|2KPK|A Chain A, Magi-1 Pdz1 Length = 129 Back     alignment and structure
>pdb|2AWX|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378s Length = 105 Back     alignment and structure
>pdb|2AWU|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378g Length = 105 Back     alignment and structure
>pdb|4G69|A Chain A, Structure Of The Human Discs Large 1 Pdz2 - Adenomatous Polyposis Coli Cytoskeletal Polarity Complex Length = 100 Back     alignment and structure
>pdb|2KOM|A Chain A, Solution Structure Of Humar Par-3b Pdz2 (Residues 451-549) Length = 121 Back     alignment and structure
>pdb|2FE5|A Chain A, The Crystal Structure Of The Second Pdz Domain Of Human Dlg3 Length = 94 Back     alignment and structure
>pdb|1UEQ|A Chain A, Solution Structure Of The First Pdz Domain Of Human Atrophin-1 Interacting Protein 1 (Kiaa0705 Protein) Length = 123 Back     alignment and structure
>pdb|1TP3|A Chain A, Pdz3 Domain Of Psd-95 Protein Complexed With Kketpv Peptide Ligand Length = 119 Back     alignment and structure
>pdb|2DB5|A Chain A, Solution Structure Of The First Pdz Domain Of Inad-Like Protein Length = 128 Back     alignment and structure
>pdb|1VJ6|A Chain A, Pdz2 From Ptp-Bl In Complex With The C-Terminal Ligand From The Apc Protein Length = 102 Back     alignment and structure
>pdb|1GM1|A Chain A, Second Pdz Domain (Pdz2) Of Ptp-Bl Length = 94 Back     alignment and structure
>pdb|3I4W|A Chain A, Crystal Structure Of The Third Pdz Domain Of Psd-95 Length = 104 Back     alignment and structure
>pdb|1BE9|A Chain A, The Third Pdz Domain From The Synaptic Protein Psd-95 In Complex With A C-Terminal Peptide Derived From Cript. Length = 119 Back     alignment and structure
>pdb|2KOH|A Chain A, Nmr Structure Of Mouse Par3-Pdz3 In Complex With Ve-Cadherin C-Terminus Length = 111 Back     alignment and structure
>pdb|2I1N|A Chain A, Crystal Structure Of The 1st Pdz Domain Of Human Dlg3 Length = 102 Back     alignment and structure
>pdb|2K1Z|A Chain A, Solution Structure Of Par-3 Pdz3 Length = 104 Back     alignment and structure
>pdb|2R4H|B Chain B, Crystal Structure Of A C1190s Mutant Of The 6th Pdz Domain Of Human Membrane Associated Guanylate Kinase Length = 112 Back     alignment and structure
>pdb|3K82|A Chain A, Crystal Structure Of The Third Pdz Domain Of Psd-95 Length = 98 Back     alignment and structure
>pdb|1UHP|A Chain A, Solution Structure Of Rsgi Ruh-005, A Pdz Domain In Human Cdna, Kiaa1095 Length = 107 Back     alignment and structure
>pdb|3JXT|A Chain A, Crystal Structure Of The Third Pdz Domain Of Sap-102 In Complex With A Fluorogenic Peptide-Based Ligand Length = 104 Back     alignment and structure
>pdb|1UM7|A Chain A, Solution Structure Of The Third Pdz Domain Of Synapse- Associated Protein 102 Length = 113 Back     alignment and structure
>pdb|2HE2|A Chain A, Crystal Structure Of The 3rd Pdz Domain Of Human Discs Large Homologue 2, Dlg2 Length = 102 Back     alignment and structure
>pdb|1UJU|A Chain A, Solution Structure Of The Fourth Pdz Domain Of Human Scribble (Kiaa0147 Protein) Length = 111 Back     alignment and structure
>pdb|1I16|A Chain A, Structure Of Interleukin 16: Implications For Function, Nmr, 20 Structures Length = 130 Back     alignment and structure
>pdb|1WHA|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Scribble (Kiaa0147 Protein) Length = 105 Back     alignment and structure
>pdb|3PDZ|A Chain A, Solution Structure Of The Pdz2 Domain From Human Phosphatase Hptp1e Length = 96 Back     alignment and structure
>pdb|1D5G|A Chain A, Solution Structure Of The Pdz2 Domain From Human Phosphatase Hptp1e Complexed With A Peptide Length = 96 Back     alignment and structure
>pdb|2DJT|A Chain A, Solution Structures Of The Pdz Domain Of Human Unnamed Protein Product Length = 104 Back     alignment and structure
>pdb|1WG6|A Chain A, Solution Structure Of Pdz Domain In Protein Xp_110852 Length = 127 Back     alignment and structure
>pdb|3AXA|A Chain A, Crystal Structure Of Afadin Pdz Domain In Complex With The C-Terminal Peptide From Nectin-3 Length = 106 Back     alignment and structure
>pdb|1XZ9|A Chain A, Structure Of Af-6 Pdz Domain Length = 101 Back     alignment and structure
>pdb|1T2M|A Chain A, Solution Structure Of The Pdz Domain Of Af-6 Length = 101 Back     alignment and structure
>pdb|2AIN|A Chain A, Solution Structure Of The Af-6 Pdz Domain Complexed With The C-Terminal Peptide From The Bcr Protein Length = 93 Back     alignment and structure
>pdb|1WI2|A Chain A, Solution Structure Of The Pdz Domain From Riken Cdna 2700099c19 Length = 104 Back     alignment and structure
>pdb|1OZI|A Chain A, The Alternatively Spliced Pdz2 Domain Of Ptp-Bl Length = 99 Back     alignment and structure
>pdb|1X6D|A Chain A, Solution Structures Of The Pdz Domain Of Human Interleukin- 16 Length = 119 Back     alignment and structure
>pdb|1IHJ|A Chain A, Crystal Structure Of The N-Terminal Pdz Domain Of Inad In Complex With A Norpa C-Terminal Peptide Length = 98 Back     alignment and structure
>pdb|2DLU|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Inad- Like Protein Length = 111 Back     alignment and structure
>pdb|2H2C|A Chain A, Crystal Structure Of Zo-1 Pdz1 Bound To A Phage-Derived Ligand (Wrrttwv) Length = 107 Back     alignment and structure
>pdb|3CBX|A Chain A, The Dvl2 Pdz Domain In Complex With The C1 Inhibitory Peptide Length = 105 Back     alignment and structure
>pdb|2H2B|A Chain A, Crystal Structure Of Zo-1 Pdz1 Bound To A Phage-derived Ligand (wrrttyl) Length = 107 Back     alignment and structure
>pdb|3CBY|A Chain A, The Dvl2 Pdz Domain In Complex With The N1 Inhibitory Peptide Length = 108 Back     alignment and structure
>pdb|3CC0|A Chain A, The Dvl2 Pdz Domain In Complex With The N3 Inhibitory Peptide Length = 108 Back     alignment and structure
>pdb|1MC7|A Chain A, Solution Structure Of Mdvl1 Pdz Domain Length = 95 Back     alignment and structure
>pdb|3CBZ|A Chain A, The Dvl2 Pdz Domain In Complex With The N2 Inhibitory Peptide Length = 108 Back     alignment and structure
>pdb|2KAW|A Chain A, Nmr Structure Of The Mdvl1 Pdz Domain In Complex With Its Inhibitor Length = 90 Back     alignment and structure
>pdb|1UJD|A Chain A, Solution Structure Of Rsgi Ruh-003, A Pdz Domain Of Hypothetical Kiaa0559 Protein From Human Cdna Length = 117 Back     alignment and structure
>pdb|2RRM|A Chain A, Interplay Between Phosphatidyl-Inositol-Phosphates And Claudins Upon Binding To The 1st Pdz Domain Of Zonula Occludens 1 Length = 100 Back     alignment and structure
>pdb|2H3M|A Chain A, Crystal Structure Of Zo-1 Pdz1 Length = 97 Back     alignment and structure
>pdb|2REY|A Chain A, Crystal Structure Of The Pdz Domain Of Human Dishevelled 2 (Homologous To Drosophila Dsh) Length = 100 Back     alignment and structure
>pdb|3K1R|A Chain A, Structure Of Harmonin Npdz1 In Complex With The Sam-Pbm Of Sans Length = 192 Back     alignment and structure
>pdb|2I0I|A Chain A, X-Ray Crystal Structure Of Sap97 Pdz3 Bound To The C- Terminal Peptide Of Hpv18 E6 Length = 85 Back     alignment and structure
>pdb|2CSJ|A Chain A, Solution Structure Of N-Terminal Pdz Domain From Mouse Tjp2 Length = 117 Back     alignment and structure
>pdb|1U3B|A Chain A, Auto-Inhibition Mechanism Of X11sMINTS FAMILY SCAFFOLD Proteins Revealed By The Closed Conformation Of The Tandem Pdz Domains Length = 185 Back     alignment and structure
>pdb|2FCF|A Chain A, The Crystal Structure Of The 7th Pdz Domain Of Mpdz (Mupp-1) Length = 103 Back     alignment and structure
>pdb|2IWQ|A Chain A, 7th Pdz Domain Of Multiple Pdz Domain Protein Mpdz Length = 123 Back     alignment and structure
>pdb|2DKR|A Chain A, Solution Structure Of The Pdz Domain From Human Lin-7 Homolog B Length = 93 Back     alignment and structure
>pdb|1UF1|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Kiaa1526 Protein Length = 128 Back     alignment and structure
>pdb|2VWR|A Chain A, Crystal Structure Of The Second Pdz Domain Of Numb-Binding Protein 2 Length = 95 Back     alignment and structure
>pdb|1PDR|A Chain A, Crystal Structure Of The Third Pdz Domain From The Human Homolog Of Discs Large Protein Length = 99 Back     alignment and structure
>pdb|1UEP|A Chain A, Solution Structure Of The Third Pdz Domain Of Human Atrophin-1 Interacting Protein 1 (Kiaa0705 Protein) Length = 103 Back     alignment and structure
>pdb|1U38|A Chain A, Auto-Inhibition Mechanism Of X11sMINTS FAMILY SCAFFOLD Proteins Revealed By The Closed Conformation Of The Tandem Pdz Domains Length = 89 Back     alignment and structure
>pdb|1WH1|A Chain A, Solution Structure Of The Fourth Pdz Domain Of Kiaa1095 Protein Length = 124 Back     alignment and structure
>pdb|2D92|A Chain A, Solution Structure Of The Fifth Pdz Domain Of Inad-Like Protein Length = 108 Back     alignment and structure
>pdb|1Q7X|A Chain A, Solution Structure Of The Alternatively Spliced Pdz2 Domain (Pdz2b) Of Ptp-Bas (Hptp1e) Length = 108 Back     alignment and structure
>pdb|1UEZ|A Chain A, Solution Structure Of The First Pdz Domain Of Human Kiaa1526 Protein Length = 101 Back     alignment and structure
>pdb|2FN5|A Chain A, Nmr Structure Of The Neurabin Pdz Domain (502-594) Length = 94 Back     alignment and structure
>pdb|2LC6|A Chain A, Solution Structure Of Par-6 Q144cL164C Length = 128 Back     alignment and structure
>pdb|1RZX|A Chain A, Crystal Structure Of A Par-6 Pdz-Peptide Complex Length = 98 Back     alignment and structure
>pdb|1RY4|A Chain A, Nmr Structure Of The Crib-Pdz Module Of Par-6 Length = 128 Back     alignment and structure
>pdb|1X8S|A Chain A, Structure Of The Par-6 Pdz Domain With A Pals1 Internal Ligand Length = 102 Back     alignment and structure
>pdb|1X45|A Chain A, Solution Structure Of The First Pdz Domain Of Amyloid Beta A4 Precursor Protein-Binding Family A, Member 1 Length = 98 Back     alignment and structure
>pdb|1L6O|A Chain A, Xenopus Dishevelled Pdz Domain Length = 95 Back     alignment and structure
>pdb|1WF8|A Chain A, Solution Structure Of The Pdz Domain Of SpinophilinNEURABINII PROTEIN Length = 107 Back     alignment and structure
>pdb|2F0A|A Chain A, Crystal Structure Of Monomeric Uncomplexed Form Of Xenopus Dishevelled Pdz Domain Length = 98 Back     alignment and structure
>pdb|3FY5|A Chain A, Dishevelled Pdz Domain Homodimer Length = 91 Back     alignment and structure
>pdb|3B76|A Chain A, Crystal Structure Of The Third Pdz Domain Of Human Ligand-of-numb Protein-x (lnx1) In Complex With The C-terminal Peptide From The Coxsackievirus And Adenovirus Receptor Length = 118 Back     alignment and structure
>pdb|3R0H|A Chain A, Structure Of Inad Pdz45 In Complex With Ng2 Peptide Length = 206 Back     alignment and structure
>pdb|1V6B|A Chain A, Solution Structure Of The Third Pdz Domain Of Mouse Harmonin Length = 118 Back     alignment and structure
>pdb|2IWN|A Chain A, 3rd Pdz Domain Of Multiple Pdz Domain Protein Mpdz (Casp Target) Length = 97 Back     alignment and structure
>pdb|2G5M|B Chain B, Spinophilin Pdz Domain Length = 113 Back     alignment and structure
>pdb|3HVQ|C Chain C, Crystal Structure Of A Complex Between Protein Phosphatase 1 Alpha (Pp1) And The Pp1 Binding And Pdz Domains Of Neurabin Length = 170 Back     alignment and structure
>pdb|3HPM|A Chain A, Oxidized Dimeric Pick1 Pdz C46g Mutant In Complex With The C Tail Peptide Of Glur2 Length = 111 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query671
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 1e-34
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 1e-12
2fne_A117 Multiple PDZ domain protein; structural protein, s 8e-34
2fne_A117 Multiple PDZ domain protein; structural protein, s 2e-12
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 1e-33
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 6e-11
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 2e-33
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 6e-11
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 6e-33
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 4e-12
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 7e-33
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 6e-13
2o2t_A117 Multiple PDZ domain protein; structural protein, s 2e-32
2o2t_A117 Multiple PDZ domain protein; structural protein, s 2e-12
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 2e-32
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 9e-12
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 6e-32
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 6e-13
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 2e-31
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 3e-09
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 4e-31
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 2e-12
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 5e-31
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 4e-12
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 7e-31
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 6e-12
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 7e-31
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 6e-11
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 1e-30
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 2e-09
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 1e-30
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 4e-12
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 3e-30
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 1e-09
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 4e-30
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 1e-12
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 4e-30
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 2e-10
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 4e-30
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 5e-10
2byg_A117 Channel associated protein of synapse-110; DLG2, P 8e-30
2byg_A117 Channel associated protein of synapse-110; DLG2, P 2e-10
2awx_A105 Synapse associated protein 97; membrane protein, s 9e-30
2awx_A105 Synapse associated protein 97; membrane protein, s 1e-10
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 9e-30
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 2e-10
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 1e-29
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 2e-09
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 4e-29
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 6e-11
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 4e-29
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 5e-12
2djt_A104 Unnamed protein product; PDZ domain, structural ge 5e-29
2djt_A104 Unnamed protein product; PDZ domain, structural ge 2e-10
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 7e-29
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 1e-09
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 2e-28
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 9e-11
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 2e-28
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 1e-11
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 2e-28
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 7e-13
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 2e-28
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 2e-10
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 3e-28
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 3e-11
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 3e-28
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 7e-12
2opg_A98 Multiple PDZ domain protein; structural protein, s 3e-28
2opg_A98 Multiple PDZ domain protein; structural protein, s 7e-12
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 3e-28
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 3e-13
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 4e-28
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 3e-11
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 4e-28
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 1e-13
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 4e-28
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 1e-10
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 5e-28
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 2e-10
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 8e-28
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 6e-13
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 2e-27
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 5e-12
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 2e-27
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 3e-11
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 4e-27
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 5e-16
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 5e-27
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 7e-12
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 5e-27
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 2e-11
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 5e-27
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 1e-12
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 1e-26
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 6e-11
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 1e-26
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 4e-13
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 1e-26
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 3e-10
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 1e-26
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 4e-09
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 2e-26
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 2e-11
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 2e-26
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 5e-11
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 4e-26
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 7e-12
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 6e-26
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 5e-09
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 1e-25
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 8e-12
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 1e-25
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 5e-11
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 2e-25
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 1e-10
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 2e-25
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 9e-11
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 2e-25
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 4e-13
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 3e-25
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 3e-11
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 1e-24
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 3e-11
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 1e-24
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 6e-11
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 1e-24
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 3e-09
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 1e-24
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 1e-09
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 2e-24
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 2e-10
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 3e-24
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 3e-10
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 4e-24
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 2e-11
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 5e-24
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 4e-12
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 7e-24
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 2e-12
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 1e-23
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 2e-10
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 2e-23
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 1e-09
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 2e-23
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 1e-22
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 2e-12
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 5e-12
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 5e-23
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 4e-13
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 6e-23
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 6e-11
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 6e-23
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 3e-12
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 1e-22
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 1e-12
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 2e-22
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 2e-04
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 3e-22
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 2e-11
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 4e-22
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 7e-11
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 5e-22
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 3e-09
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 5e-22
2qt5_A 200 Glutamate receptor-interacting protein 1; PDZ-pept 3e-19
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 1e-14
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 5e-14
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 6e-22
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 3e-10
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 9e-22
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 3e-09
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 1e-21
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 5e-21
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 3e-12
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 5e-09
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 1e-21
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 8e-15
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 2e-21
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 2e-17
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 6e-11
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 1e-09
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 1e-08
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 2e-21
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 6e-15
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 3e-21
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 1e-15
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 4e-21
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 3e-09
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 4e-21
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 7e-14
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 5e-21
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 9e-08
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 1e-20
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 4e-20
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 1e-14
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 2e-13
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 2e-20
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 1e-07
2eeh_A100 PDZ domain-containing protein 7; structural genomi 2e-20
2eeh_A100 PDZ domain-containing protein 7; structural genomi 2e-10
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 3e-20
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 8e-10
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 5e-20
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 1e-11
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 7e-20
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 5e-09
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 7e-20
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 3e-09
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 9e-20
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 2e-14
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 1e-19
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 8e-10
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 2e-19
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 2e-05
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 3e-19
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 1e-09
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 4e-19
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 4e-09
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 5e-19
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 3e-08
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 6e-19
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 4e-09
3k1r_A192 Harmonin; protein-protein complex, alternative spl 6e-19
3k1r_A192 Harmonin; protein-protein complex, alternative spl 1e-09
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 1e-18
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 8e-08
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 1e-18
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 3e-08
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 1e-18
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 1e-09
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 1e-18
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 3e-09
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 2e-18
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 9e-09
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 3e-18
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 2e-13
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 3e-18
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 3e-08
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 3e-18
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 2e-10
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 3e-18
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 3e-06
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 4e-18
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 7e-08
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 5e-18
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 2e-10
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 7e-18
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 3e-12
2eaq_A90 LIM domain only protein 7; conserved hypothetical 8e-18
2eaq_A90 LIM domain only protein 7; conserved hypothetical 2e-09
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 8e-18
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 1e-08
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 8e-18
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 1e-05
2v90_A96 PDZ domain-containing protein 3; membrane, protein 1e-17
2v90_A96 PDZ domain-containing protein 3; membrane, protein 2e-07
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 2e-17
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 1e-07
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 2e-17
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 1e-07
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 2e-17
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 4e-14
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 5e-17
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 1e-09
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 5e-17
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 1e-07
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 8e-17
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 5e-05
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 1e-16
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 2e-07
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 2e-16
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 1e-08
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 3e-05
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 4e-05
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 3e-16
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 6e-07
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 3e-16
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 1e-07
3khf_A99 Microtubule-associated serine/threonine-protein ki 4e-16
3khf_A99 Microtubule-associated serine/threonine-protein ki 1e-05
2eei_A106 PDZ domain-containing protein 1; regulatory factor 5e-16
2eei_A106 PDZ domain-containing protein 1; regulatory factor 1e-07
2ego_A96 General receptor for phosphoinositides 1- associat 1e-15
2ego_A96 General receptor for phosphoinositides 1- associat 9e-08
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 2e-15
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 4e-05
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 2e-15
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 6e-08
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 3e-15
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 1e-14
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 5e-15
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 4e-12
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 5e-15
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 1e-05
2d90_A102 PDZ domain containing protein 1; structural genomi 7e-15
2d90_A102 PDZ domain containing protein 1; structural genomi 9e-06
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 6e-14
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 6e-08
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 7e-14
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 8e-09
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 1e-13
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 4e-06
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 2e-13
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 3e-09
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 3e-13
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 1e-07
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 3e-13
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 2e-08
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 7e-13
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 3e-06
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 2e-12
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 7e-06
2qbw_A 195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 2e-12
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 2e-05
2krg_A 216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 4e-12
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 6e-04
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 6e-12
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 1e-08
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 1e-11
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 2e-09
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 2e-07
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 2e-07
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 2e-11
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 7e-09
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 2e-10
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 2e-10
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 8e-08
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 2e-10
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 5e-08
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 2e-05
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 6e-04
4fgm_A597 Aminopeptidase N family protein; structural genomi 7e-04
2hga_A125 Conserved protein MTH1368; GFT structural genomics 8e-04
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
 Score =  127 bits (320), Expect = 1e-34
 Identities = 32/113 (28%), Positives = 52/113 (46%), Gaps = 2/113 (1%)

Query: 558 TSTNFCTLPRRPRSAICTFHTIVFEKGPGKKGLGFTIVGGKDSPRGAIGIFIKSILDNGQ 617
            S +  +      +A  T  T+  EK     GLGF++ GGK S  G   + I  I     
Sbjct: 12  ASASAASDVSVESTAEATVCTVTLEKMSA--GLGFSLEGGKGSLHGDKPLTINRIFKGAA 69

Query: 618 AAEDGRLKEGDEILAINGQVCHDLTHLEAISLFKTIKNGSISLHICRRLKSKK 670
           + +   ++ GDEIL + G     LT  EA ++ K + +G +++ I R+    K
Sbjct: 70  SEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSK 122


>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Length = 195 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Length = 195 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Length = 113 Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Length = 597 Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Length = 125 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query671
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.93
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.92
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.91
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.88
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.88
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.84
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 99.79
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 99.79
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 99.71
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 99.68
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 99.58
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.55
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.52
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.52
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 99.5
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.5
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.5
2fne_A117 Multiple PDZ domain protein; structural protein, s 99.5
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.49
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 99.49
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 99.49
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 99.49
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.49
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 99.48
2awx_A105 Synapse associated protein 97; membrane protein, s 99.48
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 99.48
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 99.48
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.47
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 99.47
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.47
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 99.47
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 99.47
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.46
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 99.46
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.45
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 99.45
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 99.45
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 99.45
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 99.45
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 99.44
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.44
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.44
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.44
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 99.44
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 99.44
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.44
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.43
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.43
2o2t_A117 Multiple PDZ domain protein; structural protein, s 99.43
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 99.43
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.43
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.43
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 99.42
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.42
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 99.42
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 99.42
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 99.42
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.42
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.41
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.41
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 99.41
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.41
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 99.4
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 99.4
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 99.4
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 99.4
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 99.4
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 99.4
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.4
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.4
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.4
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.4
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 99.39
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.39
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.39
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 99.39
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 99.39
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.39
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 99.38
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 99.38
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 99.38
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.38
2djt_A104 Unnamed protein product; PDZ domain, structural ge 99.38
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 99.38
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 99.38
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 99.38
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.38
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 99.38
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.38
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 99.37
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 99.37
2ego_A96 General receptor for phosphoinositides 1- associat 99.37
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 99.37
2awx_A105 Synapse associated protein 97; membrane protein, s 99.37
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 99.37
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 99.37
2fne_A117 Multiple PDZ domain protein; structural protein, s 99.37
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.37
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 99.36
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.36
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 99.36
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 99.36
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.36
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 99.36
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 99.36
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 99.36
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.36
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.35
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 99.35
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.35
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 99.35
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 99.35
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 99.35
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 99.35
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 99.35
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 99.35
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 99.35
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 99.34
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 99.34
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 99.34
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 99.34
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 99.34
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 99.34
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 99.34
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 99.34
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.34
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 99.34
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 99.33
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.33
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.33
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 99.33
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 99.33
2d90_A102 PDZ domain containing protein 1; structural genomi 99.33
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 99.33
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 99.33
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 99.32
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 99.32
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 99.32
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.32
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.32
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 99.32
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 99.32
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 99.32
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 99.32
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.32
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 99.32
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 99.32
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.32
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 99.32
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 99.32
2o2t_A117 Multiple PDZ domain protein; structural protein, s 99.32
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 99.32
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.32
2eei_A106 PDZ domain-containing protein 1; regulatory factor 99.32
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 99.31
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 99.31
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 99.31
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 99.31
2eeh_A100 PDZ domain-containing protein 7; structural genomi 99.31
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 99.31
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.31
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 99.31
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.31
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.31
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.31
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.31
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.31
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.3
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.3
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.3
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 99.3
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 99.3
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 99.3
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.3
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 99.3
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.3
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 99.3
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.29
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 99.29
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.29
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 99.29
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 99.29
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 99.29
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 99.29
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 99.29
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 99.29
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 99.29
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 99.29
2ego_A96 General receptor for phosphoinositides 1- associat 99.29
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 99.28
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 99.28
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.28
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 99.28
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 99.28
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 99.28
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 99.27
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 99.27
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.27
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 99.27
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 99.27
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 99.27
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.27
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 99.27
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 99.27
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 99.27
3khf_A99 Microtubule-associated serine/threonine-protein ki 99.26
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 99.26
2djt_A104 Unnamed protein product; PDZ domain, structural ge 99.26
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 99.26
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 99.26
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 99.26
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 99.26
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 99.26
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.25
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 99.25
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 99.25
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 99.24
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 99.24
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 99.24
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 99.24
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 99.24
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 99.24
2d90_A102 PDZ domain containing protein 1; structural genomi 99.24
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 99.23
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 99.23
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 99.23
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 99.23
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 99.23
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 99.23
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 99.23
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 99.23
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 99.23
3k1r_A192 Harmonin; protein-protein complex, alternative spl 99.22
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 99.22
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 99.22
2eeh_A100 PDZ domain-containing protein 7; structural genomi 99.22
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 99.22
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 99.22
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 99.21
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 99.21
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 99.21
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 99.21
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 99.2
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 99.2
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 99.2
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 99.2
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 99.2
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 99.2
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 99.2
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 99.2
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 99.19
3k1r_A192 Harmonin; protein-protein complex, alternative spl 99.19
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 99.19
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 99.19
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.18
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 99.18
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 99.18
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.18
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 99.18
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 99.17
2eei_A106 PDZ domain-containing protein 1; regulatory factor 99.17
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 99.17
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 99.17
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 99.17
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 99.17
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 99.17
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 99.16
3khf_A99 Microtubule-associated serine/threonine-protein ki 99.16
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 99.15
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 99.15
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.15
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 99.14
2qt5_A 200 Glutamate receptor-interacting protein 1; PDZ-pept 99.14
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 99.14
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 99.14
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 99.14
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 99.14
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 99.14
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 99.14
2qbw_A 195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.13
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.13
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 99.12
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 99.12
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.11
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 99.11
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 99.11
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 99.11
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 99.11
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 99.11
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 99.1
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 98.69
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 99.1
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 99.1
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 99.09
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 99.09
2eaq_A90 LIM domain only protein 7; conserved hypothetical 99.09
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 99.09
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 99.08
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 99.08
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 99.07
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 99.06
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 99.06
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.05
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 99.05
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 99.04
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 99.04
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 99.04
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 98.61
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 99.04
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 99.03
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 99.02
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 99.01
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 99.01
2krg_A 216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 99.01
2eaq_A90 LIM domain only protein 7; conserved hypothetical 99.0
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.0
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 98.99
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 98.98
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 98.98
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 98.97
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 98.97
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 98.97
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 98.97
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.9
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.9
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 98.87
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 98.87
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.83
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 98.83
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 98.81
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 98.8
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.52
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 98.51
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.5
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.5
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.47
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.47
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 98.47
2kl1_A94 YLBL protein; structure genomics, structural genom 98.44
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 98.4
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 98.36
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 98.31
3rle_A 209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.31
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 98.24
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 98.2
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.18
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 98.15
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 98.15
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.14
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.11
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 98.1
1fc6_A388 Photosystem II D1 protease; D1 C-terminal processi 98.1
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 98.05
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 98.04
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 98.04
2hga_A125 Conserved protein MTH1368; GFT structural genomics 98.03
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.01
2kl1_A94 YLBL protein; structure genomics, structural genom 98.01
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 98.01
4fgm_A597 Aminopeptidase N family protein; structural genomi 97.99
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 97.98
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 97.97
3k50_A 403 Putative S41 protease; structural genomics, joint 97.94
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 97.91
4fgm_A597 Aminopeptidase N family protein; structural genomi 97.9
3pv2_A 451 DEGQ; trypsin fold, PDZ domain, chaperone protease 97.9
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 97.87
4a8c_A 436 Periplasmic PH-dependent serine endoprotease DEGQ; 97.85
3k50_A403 Putative S41 protease; structural genomics, joint 97.84
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 97.76
2hga_A125 Conserved protein MTH1368; GFT structural genomics 97.63
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 97.59
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 97.59
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 97.39
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 97.27
1k32_A 1045 Tricorn protease; protein degradation, substrate g 97.24
1k32_A1045 Tricorn protease; protein degradation, substrate g 96.87
4fln_A 539 Protease DO-like 2, chloroplastic; protease, DEG, 96.76
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
Probab=99.93  E-value=1.6e-24  Score=209.93  Aligned_cols=185  Identities=29%  Similarity=0.485  Sum_probs=153.5

Q ss_pred             CeEEEEEEeCCCCCcccEEEeeecCCCC-CCcCcEEEEEEcCCChhhhcCCCCCCCEEEccCCeeccCCCHHHHHHHHhc
Q psy1156         387 GQTMVRVNRRDFNEELGIYIAKIKNSSE-GNIGGFVVAHIVSGGLAEKEGCLELGDEIISVNGQRLRGLTMTQAKSIISS  465 (671)
Q Consensus       387 ~~~~V~L~k~~~~~~LGfsI~gg~~~~~-g~~~GI~Vs~V~pGspA~raG~L~~GD~IlaVNG~~V~~~s~~~av~~L~~  465 (671)
                      +++.|+|.+..  ++|||+|.++.+.+. +...|++|..|.++|||+++|+|++||+|++|||+++.++++.+++.+++.
T Consensus         5 ~~~~v~l~~~~--~~lG~~i~~g~~~~~~~~~~g~~V~~V~~~spA~~aG~l~~GD~I~~vng~~v~~~~~~~~~~~~~~   82 (196)
T 3gsl_A            5 EYEEITLERGN--SGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKE   82 (196)
T ss_dssp             EEEEEEEECBT--TBSSEEEECCTTSCTTSSCCCEEEEEECTTSHHHHHCCCCTTCEEEEETTEECTTCCHHHHHHHHHT
T ss_pred             EEEEEEEEECC--CCCCEEEEcccCCcccCCCCCEEEEEECCCChHHhcCCCCCCCEEEEECCEECCCCCHHHHHHHHHh
Confidence            56788998854  789999999876532 112789999999999999999999999999999999999999999999998


Q ss_pred             CCCeEEEEEEeCCcccccccccccccccccccccccccccccCCcccCCcccchhhhhhhccccccccchhhhhhccccc
Q psy1156         466 GPLNMDLLISRTSLKKSNAENEYNESHSREKKSKETRFSLDKQNDFESSNEQDKNNQKRLFQKNCHSINNKLLRKAIIST  545 (671)
Q Consensus       466 ~g~~V~L~V~R~~~~~~~a~~~~~~~~s~~~~~~~~~ss~d~e~~~~ssp~~~k~s~~~~~q~~~~s~~~~~~r~~v~s~  545 (671)
                      .+..+.|+|.|.+....                                                               
T Consensus        83 ~g~~v~l~v~r~~~~~~---------------------------------------------------------------   99 (196)
T 3gsl_A           83 AGSIVRLYVMRRKPPAE---------------------------------------------------------------   99 (196)
T ss_dssp             SCSEEEEEEEEECCCCE---------------------------------------------------------------
T ss_pred             CCCcEEEEEEecCCCcc---------------------------------------------------------------
Confidence            89999999988432000                                                               


Q ss_pred             CCCCCchhhhhhccCCccCCCCCCCCcccceeeEEEeeCCCCCcccEEEecCCCCCC--CCcceeEEEeCCCCHHhHhCC
Q psy1156         546 GSISGDEEETILTSTNFCTLPRRPRSAICTFHTIVFEKGPGKKGLGFTIVGGKDSPR--GAIGIFIKSILDNGQAAEDGR  623 (671)
Q Consensus       546 ~s~s~d~~~s~~~s~~~~~lP~~p~s~~~~~~~V~L~K~~g~~~LGfsL~Gg~ds~~--g~~GVfIssV~pgSpAaraGr  623 (671)
                                                   ....+.+.+..  .+|||.+.++.....  ...|++|..|.++|+|+++|+
T Consensus       100 -----------------------------~~~~v~l~~~~--~~lG~~~~~~~~~~~~~~~~gv~V~~V~~gs~A~~aG~  148 (196)
T 3gsl_A          100 -----------------------------KVMEIKLIKGP--KGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGR  148 (196)
T ss_dssp             -----------------------------EEEEEEEEEBT--TBSCEEEEESBTSCSBTTBCCEEEEEECTTSHHHHHCC
T ss_pred             -----------------------------ccEEEEEecCC--CCceEEEEccCCCcCCCCCCCEEEEEECCCChHHhcCC
Confidence                                         11245666665  589999988765432  245899999999999999999


Q ss_pred             CCCCCEEEEECCeecCCCCHHHHHHHHHhcCCCcEEEEEEeCCCC
Q psy1156         624 LKEGDEILAINGQVCHDLTHLEAISLFKTIKNGSISLHICRRLKS  668 (671)
Q Consensus       624 Lr~GDrILeVNG~sV~~lSheEAV~lLK~sg~~~VtL~V~Rr~~~  668 (671)
                      |++||+|++|||++|.++++.+++.+|+..+ +.|.|+|.|+...
T Consensus       149 L~~GD~Il~Vng~~v~~~~~~~~~~~l~~~~-~~v~l~v~R~~~~  192 (196)
T 3gsl_A          149 LQIGDKILAVNSVGLEDVMHEDAVAALKNTY-DVVYLKVAKPSNA  192 (196)
T ss_dssp             CCTTCEEEEETTEECSSCBHHHHHHHHHSCC-EEEEEEEEEESCC
T ss_pred             CCCCCEEEEECCCcCCCCCHHHHHHHHHcCC-CeEEEEEeCCCCc
Confidence            9999999999999999999999999999874 7899999987643



>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 671
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 4e-22
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 3e-13
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 5e-22
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 2e-10
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 6e-22
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 2e-11
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 2e-21
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 1e-10
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 3e-21
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 1e-09
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 3e-21
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 2e-11
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 3e-21
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 3e-11
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 2e-20
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 2e-09
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 2e-20
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 2e-09
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 3e-20
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-09
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 5e-20
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 7e-13
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 6e-20
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 8e-10
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 7e-20
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 2e-09
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 1e-19
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 1e-10
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 2e-19
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 3e-11
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 3e-19
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 1e-12
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 6e-19
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 2e-08
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 1e-18
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 8e-12
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 1e-18
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 2e-08
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-18
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-08
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 2e-18
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 5e-10
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 2e-18
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 5e-12
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 3e-18
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 3e-10
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 4e-18
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 2e-11
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 4e-18
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 3e-09
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 5e-18
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 5e-10
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 6e-18
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 7e-09
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 1e-17
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 3e-11
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-17
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 9e-09
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 1e-17
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 4e-10
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 1e-17
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 4e-14
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 2e-17
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 7e-09
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 3e-17
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 1e-09
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 4e-17
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 5e-09
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 5e-17
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 1e-08
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 5e-17
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 1e-07
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 9e-17
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 4e-11
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 1e-16
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 2e-11
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 2e-16
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 1e-09
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 2e-16
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 9e-11
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 5e-16
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 7e-16
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 2e-07
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 1e-15
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 2e-09
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 2e-15
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 5e-06
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 2e-15
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 2e-10
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 2e-15
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 4e-10
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 2e-15
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 4e-11
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 2e-15
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 4e-09
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 3e-15
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 3e-10
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 3e-15
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 4e-09
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 4e-15
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 5e-07
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 5e-15
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-08
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 6e-15
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 8e-15
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 5e-06
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 2e-14
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 7e-08
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 2e-14
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 1e-05
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 2e-14
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 6e-08
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-14
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 4e-06
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 2e-14
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 1e-08
d1vaea_111 b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T 7e-12
d2z9ia188 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium 5e-08
d1fc6a392 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal 3e-07
d1r6ja_82 b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [Ta 5e-07
d1r6ja_82 b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [Ta 5e-05
d2i6va187 b.36.1.5 (A:219-305) General secretion pathway pro 3e-04
d1k32a191 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Th 0.001
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure

class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Regulating synaptic membrane exocytosis protein 1, RIMS1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 89.2 bits (221), Expect = 4e-22
 Identities = 23/91 (25%), Positives = 38/91 (41%), Gaps = 1/91 (1%)

Query: 575 TFHTIVFEKGPGKKGLGFTIVGGKDSPRGAIGIFIKSILDNGQAAEDGRLKEGDEILAIN 634
             +            LG  +VGGK +  G +G FI  +     A   G L+ GDE+L  N
Sbjct: 17  ILNKRTTMPKDSGALLGLKVVGGKMTDLGRLGAFITKVKKGSLADVVGHLRAGDEVLEWN 76

Query: 635 GQVCHDLTHLEAISLFKTIKNG-SISLHICR 664
           G+     T+ E  ++    K+   + + + R
Sbjct: 77  GKPLPGATNEEVYNIILESKSEPQVEIIVSR 107


>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Length = 92 Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Length = 87 Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 91 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query671
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.72
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.7
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.7
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.7
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.68
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.67
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.67
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.66
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.65
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.65
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.64
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.64
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.64
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.64
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.63
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.63
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.63
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.63
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.63
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.63
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.62
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.61
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.61
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.61
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.6
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.6
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.6
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.59
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.59
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.59
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.59
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.59
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.58
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.58
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.57
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.57
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.57
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 99.57
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 99.57
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.57
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.57
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.57
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 99.57
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.57
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.57
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.57
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.56
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.55
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.55
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.55
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.55
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.54
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.54
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.53
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.53
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 99.53
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.53
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.53
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.53
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.52
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.52
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 99.52
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.52
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 99.52
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 99.52
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.52
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 99.51
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.51
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 99.51
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.51
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.5
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 99.5
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1y7na179 Amyloid beta A4 precursor protein-binding family A 99.5
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.5
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 99.49
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 99.49
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.49
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.49
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.48
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.48
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.48
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.46
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.46
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.46
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.46
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.46
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.45
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.45
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 99.45
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.44
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.43
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 99.43
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 99.42
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.42
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.42
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 99.42
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.42
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 99.42
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.42
d1y7na179 Amyloid beta A4 precursor protein-binding family A 99.41
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 99.4
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.4
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.38
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 99.38
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 99.38
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.37
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.37
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 99.36
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 99.36
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 99.34
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 99.33
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.32
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 99.3
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.3
d1fc6a392 Photosystem II D1 C-terminal processing protease { 99.28
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.26
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.25
d1fc6a392 Photosystem II D1 C-terminal processing protease { 99.17
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 99.11
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 98.94
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.83
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 98.83
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.65
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 98.65
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.59
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 98.45
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.45
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 98.44
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 98.4
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.39
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 98.32
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.32
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.19
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.11
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 97.98
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Synaptic protein PSD-95
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.72  E-value=1.8e-17  Score=143.09  Aligned_cols=89  Identities=38%  Similarity=0.665  Sum_probs=79.8

Q ss_pred             eeeEEEeeCCCCCcccEEEecCCCCCC--CCcceeEEEeCCCCHHhHhCCCCCCCEEEEECCeecCCCCHHHHHHHHHhc
Q psy1156         576 FHTIVFEKGPGKKGLGFTIVGGKDSPR--GAIGIFIKSILDNGQAAEDGRLKEGDEILAINGQVCHDLTHLEAISLFKTI  653 (671)
Q Consensus       576 ~~~V~L~K~~g~~~LGfsL~Gg~ds~~--g~~GVfIssV~pgSpAaraGrLr~GDrILeVNG~sV~~lSheEAV~lLK~s  653 (671)
                      +++|+|.|..  .+|||+|.|+.+.+.  ...||||.+|.++|+|+++|+|++||+|++|||++|.+++|.+|+++|+++
T Consensus         2 ~~~V~l~k~~--~glG~~i~gg~~~~~~~~~~gi~I~~V~~gg~A~~~G~L~~GD~Il~VNg~~v~~~s~~e~~~~l~~~   79 (93)
T d1rgra_           2 YEEITLERGN--SGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEA   79 (93)
T ss_dssp             EEEEEEECCS--SCCSEEECCCSSSCSCTTCCCCCEEEECTTSHHHHHCCCCTTCEEEEETTEECSSSCHHHHHHHHHHT
T ss_pred             CEEEEEEeCC--CcCCEEEEeecCCCCcCCCCCEEEEEECCCChHHhcCCCCcCcEEEEECCEECCCCCHHHHHHHHHcC
Confidence            4689999875  789999999876543  356999999999999999999999999999999999999999999999988


Q ss_pred             CCCcEEEEEEeCCC
Q psy1156         654 KNGSISLHICRRLK  667 (671)
Q Consensus       654 g~~~VtL~V~Rr~~  667 (671)
                      + +.|.|+|.|+.+
T Consensus        80 ~-~~v~L~v~R~~p   92 (93)
T d1rgra_          80 G-SIVRLYVMRRKP   92 (93)
T ss_dssp             T-TEEEEEEECSCC
T ss_pred             C-CEEEEEEEeCCC
Confidence            5 799999998764



>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure