Psyllid ID: psy11618


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380-
LITDDSFSPVTIYGAENPLGVEVPFGPYLPEYNELYCKYIKYIHEKFGPNFEYDQLLFSYVSPKDRVTYYNVLKTKYEKCPDFWPYIKYIHEKFGPNFEYDQLLFSYVSPKDRVIYYNVLKTKYEKCPDFWPYPRLEKERYNIYRSVIYPPDMTPYVKSGDCFDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTPIHSRIPGMSSVLSLSEFDHAYLAEPSQFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAKLGYNGWGYDETLKYFVKSEDYRSVIYNESKAVHGTQGYLPVGLFKNKENNIIREIFETSAQELGYPCPKDMNDRYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRTNLYVLKRSKVTKVIINDQNVATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLSNMHSYCYCLAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLSNAGLWSFTGYIDTLQNTARPDLEIHLLYFQQNDIRNMCKIKRAYDFNDEVQTAYVNLNKRTDMGVISMSLVNPKSCGKVTLKSADPLAPPCIDTGILSEPEDLATLIRGTDYITRLEQTEAIRLAGGTLMSLNLEACSQYPWRSTHSWTCYIRHLTTTTSNPVGTVMMGNADDPNAVVTPDLKVKGIKGLRVADISVLPNAIITQSDAISFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLFLLLLFLLSSFSSSSSSSFSYSSSSSSSSFSPLSPLFDFRTIRPTYS
cccccccccEEEEccccccccccccccccccHHHHHHHHHHHHHHHHccccccccEEEEcccccccEEEEEHHHcccccccccccccccccccccccccccccEEEEccccccHHHHccccccccccccccccccccHHHHcccccccccccccccccccccccEEEEccccHHHHHHHHcccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccHHHHHHcccccccccccHHHHHHHccccccccccccccccccccccEEccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccEEEEccEEEEEEEccccEEEEEEEEEcccEEEEEEEcEEEEEcccccccHHHHHHHccccHHHHHHcccccEEcccccccccccccccccEEEcccccccccccHHHHHHHHHHccccccccccccHHccccccccccccccccccccccccccccccEEEcccccccccccHHHHHHHHHHcccccccccccEEEEEEEcccccccccEEEEEccccccccHHHHHHHHcccccHHHHHHHHHcccccccEEEEEEcccccccEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHcccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccEEEcccccEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEcccccccccccccccccccccccccc
cccccccccEEEEccccccccEcccccccHHHHHHHHHHHHHHHHHccccccHcEEEEEEEcccccEEEEEHcccccccccccHHHHHHHHHHccccccHcHEEEEEEccccEEEEEEEEcccccccccccccccccccccEEEEEccccccccccccccccccEEEEEcccHHHHHHHHcccccccEEEEEEccccccccEcccHHHHHHcccccccEEEccccccHHHcccccEcccccccEEccccHHHHEEEEcccHHHHHHHHHcccccccHHHHHHHHHHHccccccccccccccccccccEEEcccccccccHHHHHHHHHHHHcccccccccccccccccEEEEEEEcccccccHHHHHHHcHHHHcccccEEEEEEEEEEEEEccccEEEEEEEEEEccEEEEEEEEEEEEEccccccHHHHHHHccEEcHHHHHHccccccEEccccccEEccEEEEEEEEEcHHcccHHHHHHHHHHHHHHHcccccHHHccccccHHHHHHccccEEccccccccHHHHccccEEEEEccccccccHHHHHHHHHHHHHccccccccHHHHHEEEEEcccccccccEEEEEEEcccccccccEEEEccccccHHHHHHccccccccccEEEEEEccccccccEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHcccccccccccccccccccHHHHHHHHHHHccccEccccccccccccccccEEccccEEEcccccEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEcccccccccccccccccccccccccc
litddsfspvtiygaenplgvevpfgpylpeyNELYCKYIKYIHekfgpnfeydqllfsyvspkdrvTYYNVLKTkyekcpdfwpYIKYIHekfgpnfeydqllfsyvspkdrvIYYNVLKtkyekcpdfwpyprlekeryniyrsviyppdmtpyvksgdcfdIIIVGASAAGCVLANRLSEVSSLKVLLIEaggdtpihsripgmssvlslsefdhaylaepsqfaglgvrNARIKItagkglggssAVQNILYqrgtsydyenfaklgyngwgydetlkyfvksedyRSVIYNeskavhgtqgylpvglfknkenNIIREIFETSaqelgypcpkdmndryvdvgfaelpgmtryglrfsaadayltpiagkrtnlyvlkrsKVTKVIINDQNVATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLLsgigpkahldevkipvkqdlrvgenlklnaqftgpvmafsaplkrtVYSQEMVFKYLVNrigplsnmHSYCYCLAhldevkipvkqdlrvgenlklnaqftgpvmafsaplkrtVYSQEMVFKYLVNRigplsnaglwsFTGYIDtlqntarpdLEIHLLYFQQNDIRNMCKIKRAYDFNDEVQTAYVNLNKRTDMGVismslvnpkscgkvtlksadplappcidtgilsepedlatlirGTDYITRLEQTEAIRLAGGTLMSlnleacsqypwrsthswtcYIRHlttttsnpvgtvmmgnaddpnavvtpdlkvkgikglrvadisvlpnaiitQSDAISFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLFLLLLFLLSsfsssssssfsyssssssssfsplsplfdfrtirptys
litddsfspvtiygaenplgvevPFGPYLPEYNELYCKYIKYIHEKFGPNFEYDQLLFSYVSPKDRVTYYNVLKTKYEKCPDFWPYIKYIHEKFGPNFEYDQLLFSYVSPKDRVIYYNVLktkyekcpdfwpyprlEKERYNIYRSVIYPPDMTPYVKSGDCFDIIIVGASAAGCVLANRLSEVSSLKVLLIEAggdtpihsrIPGMSSVLSLSEFDHAYLAEPSQFAGLGVRNARIKItagkglggssaVQNILYQRGTSYDYENFAKLGYNGWGYDETLKYFVKSEDYRSVIYNESkavhgtqgylpvgLFKNKENNIIREIFETSAQELGYPCPKDMNDRYVDVGFAELPGMTRYGLRFSAADAyltpiagkrtnlyvlkrskvtkviindqnvatgveyvnskgetvRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLSNMHSYCYCLAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLSNAGLWSFTGYIDTLQNTARPDLEIHLLYFQQNDIRNMCKIKRAYDFNDEVQTAYVNLNKRTDMGVISMSLVNPKSCGKVTLKSADPLAPPCIDTGILSEPEDLATLIRGTDYITRLEQTEAIRLAGGTLMSLNLEACSQYPWRSTHSWTCYIRHLTTTTSNPVGTVMMGNADDPNAVVTPDLKVKGIKGLRVADISVLPNAIITQSDAISFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLFLLLLFLLSSFSSSSSSSFSYSsssssssfsplsplfdfrtirptys
LITDDSFSPVTIYGAENPLGVEVPFGPYLPEYNELYCKYIKYIHEKFGPNFEYDQLLFSYVSPKDRVTYYNVLKTKYEKCPDFWPYIKYIHEKFGPNFEYDQLLFSYVSPKDRVIYYNVLKTKYEKCPDFWPYPRLEKERYNIYRSVIYPPDMTPYVKSGDCFDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTPIHSRIPGMSSVLSLSEFDHAYLAEPSQFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAKLGYNGWGYDETLKYFVKSEDYRSVIYNESKAVHGTQGYLPVGLFKNKENNIIREIFETSAQELGYPCPKDMNDRYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRTNLYVLKRSKVTKVIINDQNVATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLSNMHSYCYCLAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLSNAGLWSFTGYIDTLQNTARPDLEIHLLYFQQNDIRNMCKIKRAYDFNDEVQTAYVNLNKRTDMGVISMSLVNPKSCGKVTLKSADPLAPPCIDTGILSEPEDLATLIRGTDYITRLEQTEAIRLAGGTLMSLNLEACSQYPWRSTHSWTCYIRHLTTTTSNPVGTVMMGNADDPNAVVTPDLKVKGIKGLRVADISVLPNAIITQSDAISflllflfllllflllflflllfllllflilplflllflfllllflllflflllfllllflilplflllflfllllflllflflllfllllflilplflllflfllllflllflflllfllllflilplflllflfllllflllflflllfllllflilplflllflfllllflllflflllfllllflilplflllflfllllflllflflllfllllflilplflllflfllllflllflflllfllllflilplflllflfllllflllflflllfllllflilplflllflfllllflllflflllfllllflilplflllflfllllflllflflllfllllflilplflllflfllllflllflflllfllllflilplflllflfllllflllflflllfllllflilplflllflfllllflllflflllfllllflilplflllflfllllflllflflllfllllflilplflllflfllllflllflflllfllllflilplflllflfllllflllflflllfllllflilplflllflfllllflfllllfllssfsssssssfsyssssssssfsPLSPLFDFRTIRPTYS
********PVTIYGAENPLGVEVPFGPYLPEYNELYCKYIKYIHEKFGPNFEYDQLLFSYVSPKDRVTYYNVLKTKYEKCPDFWPYIKYIHEKFGPNFEYDQLLFSYVSPKDRVIYYNVLKTKYEKCPDFWPYPRLEKERYNIYRSVIYPPDMTPYVKSGDCFDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTPIHSRIPGMSSVLSLSEFDHAYLAEPSQFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAKLGYNGWGYDETLKYFVKSEDYRSVIYNESKAVHGTQGYLPVGLFKNKENNIIREIFETSAQELGYPCPKDMNDRYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRTNLYVLKRSKVTKVIINDQNVATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLSNMHSYCYCLAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLSNAGLWSFTGYIDTLQNTARPDLEIHLLYFQQNDIRNMCKIKRAYDFNDEVQTAYVNLNKRTDMGVISMSLVNPKSCGKVTLKSADPLAPPCIDTGILSEPEDLATLIRGTDYITRLEQTEAIRLAGGTLMSLNLEACSQYPWRSTHSWTCYIRHLTTTTSNPVGTVMMGNADDPNAVVTPDLKVKGIKGLRVADISVLPNAIITQSDAISFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLFLLLLFLLS**************************************
*****SFSPVTIYGAENPLGVEVPFGPYLPEYNELYCKYIKYIHEKFGPNFEYDQLLFSYVSPKDRVTYYNVLKTKYEKCPDFWPYIKYIHEKFGPNFEYDQLLFSYVSPKDRVIYYNVLKTKYEKCPDFWPYPRLEKERYNIY************VKSGDCFDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTPIHSRIPGMSSVLSLSEFDHAYLAEPSQFAG*GVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAKLGYNGWGYDETLKYFVKSEDYRSVIYNESKAVHGTQGYLPVGLFKNKENNIIREIFETSAQELGYPCPKDMNDRYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRTNLYVLKRSKVTKVIINDQNVATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLSNMHSYCYCLAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLSNAGLWSFTGYIDTLQNTARPDLEIHLLYFQQNDIRNMCKIKRAYDFNDEVQTAYVNLNKRTDMGVISMSLVNPKSCGKVTLKSADPLAPPCIDTGILSEPEDLATLIRGTDYITRLEQTEAIRLAGGTLMSLNLEACSQYPWRSTHSWTCYIRHLTTTTSNPVGTVMMGNADDPNAVVTPDLKVKGIKGLRVADISVLPNAIITQSDAISFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLFLLLLFLLS**************************LFDFRTIRP***
LITDDSFSPVTIYGAENPLGVEVPFGPYLPEYNELYCKYIKYIHEKFGPNFEYDQLLFSYVSPKDRVTYYNVLKTKYEKCPDFWPYIKYIHEKFGPNFEYDQLLFSYVSPKDRVIYYNVLKTKYEKCPDFWPYPRLEKERYNIYRSVIYPPDMTPYVKSGDCFDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTPIHSRIPGMSSVLSLSEFDHAYLAEPSQFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAKLGYNGWGYDETLKYFVKSEDYRSVIYNESKAVHGTQGYLPVGLFKNKENNIIREIFETSAQELGYPCPKDMNDRYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRTNLYVLKRSKVTKVIINDQNVATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLSNMHSYCYCLAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLSNAGLWSFTGYIDTLQNTARPDLEIHLLYFQQNDIRNMCKIKRAYDFNDEVQTAYVNLNKRTDMGVISMSLVNPKSCGKVTLKSADPLAPPCIDTGILSEPEDLATLIRGTDYITRLEQTEAIRLAGGTLMSLNLEACSQYPWRSTHSWTCYIRHLTTTTSNPVGTVMMGNADDPNAVVTPDLKVKGIKGLRVADISVLPNAIITQSDAISFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLFLLLLFLLSSF*********************LSPLFDFRTIRPTYS
****DSFSPVTIYGAENPLGVEVPFGPYLPEYNELYCKYIKYIHEKFGPNFEYDQLLFSYVSPKDRVTYYNVLKTKYEKCPDFWPYIKYIHEKFGPNFEYDQLLFSYVSPKDRVIYYNVLKTKYEKCPDFWPYPRLEKERYNIYRSVIYPPDMTPYVKSGDCFDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTPIHSRIPGMSSVLSLSEFDHAYLAEPSQFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAKLGYNGWGYDETLKYFVKSEDYRSVIYNESKAVHGTQGYLPVGLFKNKENNIIREIFETSAQELGYPCPKDMNDRYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRTNLYVLKRSKVTKVIINDQNVATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLSNMHSYCYCLAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLSNAGLWSFTGYIDTLQNTARPDLEIHLLYFQQNDIRNMCKIKRAYDFNDEVQTAYVNLNKRTDMGVISMSLVNPKSCGKVTLKSADPLAPPCIDTGILSEPEDLATLIRGTDYITRLEQTEAIRLAGGTLMSLNLEACSQYPWRSTHSWTCYIRHLTTTTSNPVGTVMMGNADDPNAVVTPDLKVKGIKGLRVADISVLPNAIITQSDAISFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLFLLLLFLL**************************PLFDFRTIRPT*S
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LITDDSFSPVTIYGAENPLGVEVPFGPYLPEYNELYCKYIKYIHEKFGPNFEYDQLLFSYVSPKDRVTYYNVLKTKYEKCPDFWPYIKYIHEKFGPNFEYDQLLFSYVSPKDRVIYYNVLKTKYEKCPDFWPYPRLEKERYNIYRSVIYPPDMTPYVKSGDCFDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTPIHSRIPGMSSVLSLSEFDHAYLAEPSQFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAKLGYNGWGYDETLKYFVKSEDYRSVIYNESKAVHGTQGYLPVGLFKNKENNIIREIFETSAQELGYPCPKDMNDRYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRTNLYVLKRSKVTKVIINDQNVATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLSNMHSYCYCLAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLSNAGLWSFTGYIDTLQNTARPDLEIHLLYFQQNDIRNMCKIKRAYDFNDEVQTAYVNLNKRTDMGVISMSLVNPKSCGKVTLKSADPLAPPCIDTGILSEPEDLATLIRGTDYITRLEQTEAIRLAGGTLMSLNLEACSQYPWRSTHSWTCYIRHLTTTTSNPVGTVMMGNADDPNAVVTPDLKVKGIKGLRVADISVLPNAIITQSDAISFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLLLFLFLLLFLLLLFLILPLFLLLFLFLLLLFLFLLLLFLLSSFSSSSSSSFSYSSSSSSSSFSPLSPLFDFRTIRPTYS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1381 2.2.26 [Sep-21-2011]
P18172625 Glucose dehydrogenase [ac no N/A 0.207 0.459 0.390 3e-38
P18173625 Glucose dehydrogenase [ac no N/A 0.209 0.462 0.382 2e-37
Q47944531 L-sorbose 1-dehydrogenase yes N/A 0.202 0.527 0.395 3e-36
Q6LGH5568 Choline dehydrogenase OS= yes N/A 0.202 0.492 0.391 5e-35
Q6FDF9553 Choline dehydrogenase OS= yes N/A 0.206 0.515 0.377 2e-33
Q1QXE1560 Choline dehydrogenase OS= yes N/A 0.206 0.508 0.387 2e-33
Q1IG70565 Choline dehydrogenase OS= yes N/A 0.207 0.507 0.384 3e-33
A5WA97565 Choline dehydrogenase OS= yes N/A 0.207 0.507 0.377 4e-32
A7N2P9569 Choline dehydrogenase OS= yes N/A 0.207 0.502 0.366 5e-32
B0KN19565 Choline dehydrogenase OS= yes N/A 0.207 0.507 0.377 7e-32
>sp|P18172|DHGL_DROPS Glucose dehydrogenase [acceptor] OS=Drosophila pseudoobscura pseudoobscura GN=Gld PE=3 SV=4 Back     alignment and function desciption
 Score =  161 bits (408), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 119/305 (39%), Positives = 173/305 (56%), Gaps = 18/305 (5%)

Query: 163 FDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTPIHSRIPGMSSVLSLSEFDHAYLA 222
           +D I++G  +AG V+A+RLSEV   KVLLIEAGGD P+ ++IP M      S+ D+ Y  
Sbjct: 65  YDFIVIGGGSAGSVVASRLSEVPQWKVLLIEAGGDEPVGAQIPSMFLNFIGSDIDYRYNT 124

Query: 223 EPSQFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAKLGYNGWGYDETLK 282
           EP + A L     R     GK LGG+S +  ++Y RG   DY+++A  G  GW Y + L 
Sbjct: 125 EPERMACLSSMEQRCYWPRGKVLGGTSVMNGMMYIRGNREDYDDWAAQGNPGWSYQDVLP 184

Query: 283 YFVKSED--YRSVIYNESKAVHGTQGYLPVGLFKNKENNIIREIFETSAQELGYPCPKDM 340
           +F KSED      +  E    H   G LPVG F    N  +      + +E+G+   +D+
Sbjct: 185 FFKKSEDNLELDAVGTE---YHAKGGLLPVGKF--PYNPPLSYALLKAGEEMGFSV-QDL 238

Query: 341 NDRYVDVGF--AELPGMTRYGLRFSAADAYLTPIAGKRTNLYVLKRSKVTKVIIN--DQN 396
           N +    GF  A++    R G+R+S+A A+L P A  R NL++L  + VTKV+I+   +N
Sbjct: 239 NGQNS-TGFMIAQM--TARNGIRYSSARAFLRP-ARMRNNLHILLNTTVTKVLIHPGTKN 294

Query: 397 VATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKI-PVKQDLR 455
           V  GVE  +  G   ++   KEVI++ GA+ + Q+LLLSG+GPK  L +V + PV     
Sbjct: 295 V-VGVEVSDQFGSMRKILVKKEVIVSGGAVNSPQILLLSGVGPKEDLQKVNVRPVHHLPG 353

Query: 456 VGENL 460
           VG+NL
Sbjct: 354 VGKNL 358





Drosophila pseudoobscura pseudoobscura (taxid: 46245)
EC: 1EC: .EC: 1EC: .EC: 9EC: 9EC: .EC: 1EC: 0
>sp|P18173|DHGL_DROME Glucose dehydrogenase [acceptor] OS=Drosophila melanogaster GN=Gld PE=3 SV=3 Back     alignment and function description
>sp|Q47944|SDH_GLUOY L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans PE=3 SV=1 Back     alignment and function description
>sp|Q6LGH5|BETA_PHOPR Choline dehydrogenase OS=Photobacterium profundum GN=betA PE=3 SV=1 Back     alignment and function description
>sp|Q6FDF9|BETA_ACIAD Choline dehydrogenase OS=Acinetobacter sp. (strain ADP1) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|Q1QXE1|BETA1_CHRSD Choline dehydrogenase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|Q1IG70|BETA_PSEE4 Choline dehydrogenase OS=Pseudomonas entomophila (strain L48) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|A5WA97|BETA_PSEP1 Choline dehydrogenase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|A7N2P9|BETA_VIBHB Choline dehydrogenase OS=Vibrio harveyi (strain ATCC BAA-1116 / BB120) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|B0KN19|BETA_PSEPG Choline dehydrogenase OS=Pseudomonas putida (strain GB-1) GN=betA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1381
242018486635 glucose dehydrogenase precursor, putativ 0.394 0.858 0.345 2e-72
328779380683 PREDICTED: glucose dehydrogenase [accept 0.430 0.871 0.311 7e-59
1936763651147 PREDICTED: hypothetical protein LOC10015 0.260 0.313 0.413 5e-58
307203797673 Glucose dehydrogenase [acceptor] [Harpeg 0.417 0.857 0.321 2e-56
340730155615 PREDICTED: glucose dehydrogenase [accept 0.383 0.860 0.309 1e-55
340730088591 PREDICTED: glucose dehydrogenase [accept 0.383 0.895 0.319 2e-55
345488938633 PREDICTED: glucose dehydrogenase [accept 0.215 0.470 0.416 2e-53
345488948616 PREDICTED: glucose dehydrogenase [accept 0.234 0.525 0.402 4e-53
405978093621 Glucose dehydrogenase [acceptor] [Crasso 0.217 0.483 0.438 6e-53
350425619615 PREDICTED: glucose dehydrogenase [accept 0.383 0.860 0.304 1e-52
>gi|242018486|ref|XP_002429706.1| glucose dehydrogenase precursor, putative [Pediculus humanus corporis] gi|212514709|gb|EEB16968.1| glucose dehydrogenase precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  281 bits (718), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 221/639 (34%), Positives = 321/639 (50%), Gaps = 94/639 (14%)

Query: 146 SVIYPPDMTPYVKSGDCFDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTPIHSRIP 205
           SV YP D    + +G  FD II+GA +AG V+ANRLSE  +  VLLIEAGG     S IP
Sbjct: 45  SVDYPEDKWKSLVNGQNFDFIIIGAGSAGSVVANRLSENPNWSVLLIEAGGSPTPTSEIP 104

Query: 206 G--MSSVLSLSEFDHAYLAEPSQFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYD 263
           G  +SS+ +  + D  Y  E      LG+   +     GK LGG+S +  ++Y RG   D
Sbjct: 105 GLWISSLKT--KMDWNYKLEKMTNCCLGMIEEKCLSPRGKVLGGTSVINAMIYVRGNPED 162

Query: 264 YENFAKLGYNGWGYDETLKYFVKSEDYRS---VIYNE-----SKAVHGTQGYLPVGLFKN 315
           Y  +  +G  GW Y   LKYF +SE       V  NE     SK  H ++G L V  F  
Sbjct: 163 YNEWENMGNEGWAYKNILKYFKRSEKMSGFNFVDENEISKLVSKKYHSSKGLLNVEHFGK 222

Query: 316 KEN-NIIREIFETSAQELGYPCPKDMNDRYVDVGFAELPGMTRYGLRFSAADAYLTPIAG 374
           + N + ++ +     +ELG     D+N R+  +GF E    T  G R + A  +L PI G
Sbjct: 223 RPNVDYLKNVIFDGVEELGEFYVSDVNGRF-QLGFTEPQTTTENGRRANTAKTFLNPIKG 281

Query: 375 KRTNLYVLKRSKVTKVIINDQNVATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLL 434
            R NL ++K S   K+I+ D+    GV+ V S GE  RV  +KEVIL+AG+I   QLL+L
Sbjct: 282 -RKNLLIVKNSMAHKLIL-DRKRVIGVQ-VESNGEMKRVFVHKEVILSAGSINTPQLLML 338

Query: 435 SGIGPKAHLDEVKIPVKQDLR-VGENLKLNAQFTGPVMAFSAPLKRTVYSQEMVFKYLVN 493
           SGIGP+ HL+ + IPV  ++  VG+NL                       Q+ V  Y   
Sbjct: 339 SGIGPRQHLESLNIPVVHEMNGVGQNL-----------------------QDHVVTY--- 372

Query: 494 RIGPLS-NMHSYCYCLAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSAPLKRTVYSQ 552
            + P+S N H              P K   R G++L                        
Sbjct: 373 -VAPISINKHK-------------PDKMS-RPGDDL------------------------ 393

Query: 553 EMVFKYLVNRIGPLSNAGLWSFT-----GYIDTLQNTARPDLEIHLLYFQQNDIRNMCKI 607
                +L++  GP S     SFT     G+++T +N+  PD++ H +YF  ND  ++ K 
Sbjct: 394 SHYHDFLLHGTGPYS-----SFTNLDVVGFVNTFKNSTLPDVQYHFMYFYLNDTESVKKF 448

Query: 608 KRAYDFNDEVQTAYVNLNKRTDMGVISMSLVNPKSCGKVTLKSADPLAPPCIDTGILSEP 667
            R  +   E+   YV + +  ++ +IS +L+ PKS G++ LKS++P   P I    L+ P
Sbjct: 449 TRVLNLKPEIGNEYVKIVRDANLLLISTTLLRPKSTGRIELKSSNPYDSPKIIGNYLNVP 508

Query: 668 EDLATLIRGTDYITRLEQTEAIRLAGGTLMSLNLEACSQYPWRSTHSWTCYIRHLTTTTS 727
            DL TLIRG +++  L +T+++++    L  + L+ CS   ++S   WTC IRHL+T   
Sbjct: 509 GDLDTLIRGVEFVVSLSETKSLKMRESNLERIRLKNCSSEKFKSREYWTCLIRHLSTNLY 568

Query: 728 NPVGTVMMGNADDPNAVVTPDLKVKGIKGLRVADISVLP 766
           +PVGT  MG   D  +VV   LKV G+  LR+AD S++P
Sbjct: 569 HPVGTCKMGPKKDSTSVVDSKLKVHGLTNLRIADGSIMP 607




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328779380|ref|XP_396549.3| PREDICTED: glucose dehydrogenase [acceptor] [Apis mellifera] Back     alignment and taxonomy information
>gi|193676365|ref|XP_001949532.1| PREDICTED: hypothetical protein LOC100159632 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307203797|gb|EFN82733.1| Glucose dehydrogenase [acceptor] [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|340730155|ref|XP_003403352.1| PREDICTED: glucose dehydrogenase [acceptor]-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|340730088|ref|XP_003403320.1| PREDICTED: glucose dehydrogenase [acceptor]-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|345488938|ref|XP_001600775.2| PREDICTED: glucose dehydrogenase [acceptor]-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|345488948|ref|XP_001600924.2| PREDICTED: glucose dehydrogenase [acceptor]-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|405978093|gb|EKC42507.1| Glucose dehydrogenase [acceptor] [Crassostrea gigas] Back     alignment and taxonomy information
>gi|350425619|ref|XP_003494178.1| PREDICTED: glucose dehydrogenase [acceptor]-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1381
FB|FBgn0030593623 CG9512 [Drosophila melanogaste 0.213 0.473 0.386 5.5e-86
FB|FBgn0030598626 CG9503 [Drosophila melanogaste 0.261 0.576 0.362 1.6e-82
FB|FBgn0039415616 CG6142 [Drosophila melanogaste 0.243 0.545 0.384 4.6e-76
FB|FBgn0030589622 CG9519 [Drosophila melanogaste 0.211 0.469 0.403 4.6e-71
FB|FBgn0001112625 Gld "Glucose dehydrogenase" [D 0.231 0.512 0.369 2e-69
UNIPROTKB|Q47YL1539 CPS_3434 "Oxidoreductase, GMC 0.209 0.536 0.416 2.2e-58
TIGR_CMR|CPS_3434539 CPS_3434 "oxidoreductase, GMC 0.209 0.536 0.416 2.2e-58
FB|FBgn0030590703 CG9518 [Drosophila melanogaste 0.240 0.472 0.399 1.4e-53
TIGR_CMR|CPS_4010561 CPS_4010 "choline dehydrogenas 0.209 0.516 0.373 6e-53
TIGR_CMR|SPO_2359535 SPO_2359 "oxidoreductase, GMC 0.231 0.598 0.361 1.2e-51
FB|FBgn0030593 CG9512 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 503 (182.1 bits), Expect = 5.5e-86, Sum P(2) = 5.5e-86
 Identities = 117/303 (38%), Positives = 173/303 (57%)

Query:   163 FDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTPIHSRIPGMSSVLSLSEFDHAYLA 222
             +D I++G+  +G V+A RL+EV + KVLL+EAGGD PI +           SE+D  Y +
Sbjct:    58 YDFIVIGSGTSGAVVAGRLAEVKNWKVLLLEAGGDPPIETEFVAWHMATQFSEWDWQYHS 117

Query:   223 EPSQFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAKLGYNGWGYDETLK 282
             +P+  A + ++        GK LGG++ +  ++Y RGT  D++++ + G  GWGYDE LK
Sbjct:   118 KPNGRACMAMKGESCHWPRGKMLGGTNGMNAMIYARGTRKDFDDWEERGNPGWGYDEVLK 177

Query:   283 YFVKSEDYRSVIYNESKAVHGTQGYLPVGLFKNKENNIIREIFETSAQELGYPCPKDMND 342
             +F K+ED RS   +     HG  G  P+GL     +N  R       QE+GY    D  +
Sbjct:   178 HFRKAEDLRSTRPDYKPGDHGVGG--PMGLNNYVSDNEFRTTIRAGMQEMGYGSAPDFTE 235

Query:   343 RYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRT-NLYVLKRSKVTKVIINDQNVATGV 401
                 VG  ++ G    G R + A ++L     K T NL++L+ + V K+ ++  N A  V
Sbjct:   236 GSF-VGQMDILGTQDGGRRITTARSHLK----KNTPNLHILRHAHVKKINLDRNNRAESV 290

Query:   402 EYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQDLRVGENLK 461
              +V+   +   V A+KEVI++AGAI + Q+LLLSGIGP  HL  + IPVK DL VGENLK
Sbjct:   291 TFVHRGKKEYTVKASKEVIVSAGAIGSPQILLLSGIGPADHLKSLGIPVKLDLPVGENLK 350

Query:   462 LNA 464
              +A
Sbjct:   351 DHA 353


GO:0008812 "choline dehydrogenase activity" evidence=ISS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0006066 "alcohol metabolic process" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
FB|FBgn0030598 CG9503 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0039415 CG6142 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030589 CG9519 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0001112 Gld "Glucose dehydrogenase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q47YL1 CPS_3434 "Oxidoreductase, GMC family" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_3434 CPS_3434 "oxidoreductase, GMC family" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
FB|FBgn0030590 CG9518 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_4010 CPS_4010 "choline dehydrogenase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_2359 SPO_2359 "oxidoreductase, GMC family" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1381
PRK02106560 PRK02106, PRK02106, choline dehydrogenase; Validat 1e-69
COG2303542 COG2303, BetA, Choline dehydrogenase and related f 7e-61
TIGR01810532 TIGR01810, betA, choline dehydrogenase 1e-60
TIGR03970487 TIGR03970, Rv0697, dehydrogenase, Rv0697 family 1e-43
pfam00732218 pfam00732, GMC_oxred_N, GMC oxidoreductase 3e-33
pfam05199139 pfam05199, GMC_oxred_C, GMC oxidoreductase 5e-31
PLN02785587 PLN02785, PLN02785, Protein HOTHEAD 3e-20
COG2303542 COG2303, BetA, Choline dehydrogenase and related f 4e-19
PRK02106560 PRK02106, PRK02106, choline dehydrogenase; Validat 7e-19
pfam10101738 pfam10101, DUF2339, Predicted membrane protein (DU 1e-14
pfam10101738 pfam10101, DUF2339, Predicted membrane protein (DU 2e-14
TIGR03970487 TIGR03970, Rv0697, dehydrogenase, Rv0697 family 4e-14
pfam10101738 pfam10101, DUF2339, Predicted membrane protein (DU 8e-14
COG1807535 COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transfe 6e-13
COG1807535 COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transfe 6e-13
COG1807535 COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transfe 4e-12
COG1807535 COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transfe 5e-12
COG1807535 COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transfe 1e-11
COG1807535 COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transfe 1e-11
pfam09586 835 pfam09586, YfhO, Bacterial membrane protein YfhO 1e-11
COG1287 773 COG1287, COG1287, Uncharacterized membrane protein 4e-11
COG1287 773 COG1287, COG1287, Uncharacterized membrane protein 4e-11
COG1287 773 COG1287, COG1287, Uncharacterized membrane protein 4e-11
COG1368650 COG1368, MdoB, Phosphoglycerol transferase and rel 5e-11
COG1287 773 COG1287, COG1287, Uncharacterized membrane protein 9e-11
COG1287773 COG1287, COG1287, Uncharacterized membrane protein 1e-10
pfam09586 835 pfam09586, YfhO, Bacterial membrane protein YfhO 2e-10
pfam09586 835 pfam09586, YfhO, Bacterial membrane protein YfhO 2e-10
pfam09586 835 pfam09586, YfhO, Bacterial membrane protein YfhO 2e-10
pfam09586 835 pfam09586, YfhO, Bacterial membrane protein YfhO 2e-10
pfam09586 835 pfam09586, YfhO, Bacterial membrane protein YfhO 2e-10
pfam09586 835 pfam09586, YfhO, Bacterial membrane protein YfhO 2e-10
COG1287773 COG1287, COG1287, Uncharacterized membrane protein 2e-10
COG1807 535 COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transfe 3e-10
COG1368650 COG1368, MdoB, Phosphoglycerol transferase and rel 3e-10
COG1368 650 COG1368, MdoB, Phosphoglycerol transferase and rel 3e-10
COG1368 650 COG1368, MdoB, Phosphoglycerol transferase and rel 3e-10
COG1368 650 COG1368, MdoB, Phosphoglycerol transferase and rel 3e-10
COG1368 650 COG1368, MdoB, Phosphoglycerol transferase and rel 3e-10
COG1368 650 COG1368, MdoB, Phosphoglycerol transferase and rel 3e-10
COG1368 650 COG1368, MdoB, Phosphoglycerol transferase and rel 3e-10
COG1368 650 COG1368, MdoB, Phosphoglycerol transferase and rel 3e-10
COG1368 650 COG1368, MdoB, Phosphoglycerol transferase and rel 3e-10
COG1368 650 COG1368, MdoB, Phosphoglycerol transferase and rel 3e-10
COG1368 650 COG1368, MdoB, Phosphoglycerol transferase and rel 3e-10
pfam10101738 pfam10101, DUF2339, Predicted membrane protein (DU 4e-10
COG2194 555 COG2194, COG2194, Predicted membrane-associated, m 4e-10
COG2194 555 COG2194, COG2194, Predicted membrane-associated, m 4e-10
COG1368650 COG1368, MdoB, Phosphoglycerol transferase and rel 6e-10
COG1287773 COG1287, COG1287, Uncharacterized membrane protein 7e-10
pfam10101 738 pfam10101, DUF2339, Predicted membrane protein (DU 2e-09
COG2194555 COG2194, COG2194, Predicted membrane-associated, m 2e-09
COG2194555 COG2194, COG2194, Predicted membrane-associated, m 2e-09
COG2194555 COG2194, COG2194, Predicted membrane-associated, m 2e-09
COG2194555 COG2194, COG2194, Predicted membrane-associated, m 2e-09
COG2194555 COG2194, COG2194, Predicted membrane-associated, m 2e-09
COG2194 555 COG2194, COG2194, Predicted membrane-associated, m 2e-09
COG2194 555 COG2194, COG2194, Predicted membrane-associated, m 2e-09
COG2194 555 COG2194, COG2194, Predicted membrane-associated, m 2e-09
COG2194 555 COG2194, COG2194, Predicted membrane-associated, m 2e-09
COG1368 650 COG1368, MdoB, Phosphoglycerol transferase and rel 3e-09
COG3307424 COG3307, RfaL, Lipid A core - O-antigen ligase and 3e-09
pfam09586835 pfam09586, YfhO, Bacterial membrane protein YfhO 5e-09
pfam09586835 pfam09586, YfhO, Bacterial membrane protein YfhO 5e-09
COG3307424 COG3307, RfaL, Lipid A core - O-antigen ligase and 5e-09
COG3307424 COG3307, RfaL, Lipid A core - O-antigen ligase and 1e-08
COG2194555 COG2194, COG2194, Predicted membrane-associated, m 2e-08
COG1368650 COG1368, MdoB, Phosphoglycerol transferase and rel 3e-08
COG2194 555 COG2194, COG2194, Predicted membrane-associated, m 3e-08
COG3307424 COG3307, RfaL, Lipid A core - O-antigen ligase and 3e-08
pfam03699 771 pfam03699, UPF0182, Uncharacterized protein family 4e-08
COG3307424 COG3307, RfaL, Lipid A core - O-antigen ligase and 5e-08
COG0815518 COG0815, Lnt, Apolipoprotein N-acyltransferase [Ce 6e-08
COG0815518 COG0815, Lnt, Apolipoprotein N-acyltransferase [Ce 6e-08
COG0815 518 COG0815, Lnt, Apolipoprotein N-acyltransferase [Ce 6e-08
COG0815 518 COG0815, Lnt, Apolipoprotein N-acyltransferase [Ce 6e-08
COG0815 518 COG0815, Lnt, Apolipoprotein N-acyltransferase [Ce 6e-08
COG0815518 COG0815, Lnt, Apolipoprotein N-acyltransferase [Ce 6e-08
pfam03699 771 pfam03699, UPF0182, Uncharacterized protein family 9e-08
pfam03699 771 pfam03699, UPF0182, Uncharacterized protein family 9e-08
pfam03699 771 pfam03699, UPF0182, Uncharacterized protein family 9e-08
pfam03699 771 pfam03699, UPF0182, Uncharacterized protein family 9e-08
pfam03699 771 pfam03699, UPF0182, Uncharacterized protein family 9e-08
pfam03699 771 pfam03699, UPF0182, Uncharacterized protein family 9e-08
pfam03699 771 pfam03699, UPF0182, Uncharacterized protein family 9e-08
pfam03699 771 pfam03699, UPF0182, Uncharacterized protein family 9e-08
pfam03699 771 pfam03699, UPF0182, Uncharacterized protein family 9e-08
COG0815 518 COG0815, Lnt, Apolipoprotein N-acyltransferase [Ce 9e-08
COG4585365 COG4585, COG4585, Signal transduction histidine ki 1e-07
COG4585365 COG4585, COG4585, Signal transduction histidine ki 1e-07
COG4585365 COG4585, COG4585, Signal transduction histidine ki 1e-07
COG4585365 COG4585, COG4585, Signal transduction histidine ki 1e-07
COG4585365 COG4585, COG4585, Signal transduction histidine ki 1e-07
COG4585365 COG4585, COG4585, Signal transduction histidine ki 1e-07
COG4585365 COG4585, COG4585, Signal transduction histidine ki 1e-07
COG4585365 COG4585, COG4585, Signal transduction histidine ki 1e-07
COG4585365 COG4585, COG4585, Signal transduction histidine ki 1e-07
COG4585365 COG4585, COG4585, Signal transduction histidine ki 1e-07
COG4585365 COG4585, COG4585, Signal transduction histidine ki 1e-07
COG4585 365 COG4585, COG4585, Signal transduction histidine ki 1e-07
COG4585 365 COG4585, COG4585, Signal transduction histidine ki 1e-07
pfam10101738 pfam10101, DUF2339, Predicted membrane protein (DU 2e-07
pfam03699 771 pfam03699, UPF0182, Uncharacterized protein family 2e-07
COG4585365 COG4585, COG4585, Signal transduction histidine ki 2e-07
COG4585365 COG4585, COG4585, Signal transduction histidine ki 2e-07
COG4585365 COG4585, COG4585, Signal transduction histidine ki 2e-07
COG4585365 COG4585, COG4585, Signal transduction histidine ki 2e-07
COG4585365 COG4585, COG4585, Signal transduction histidine ki 2e-07
COG4585365 COG4585, COG4585, Signal transduction histidine ki 2e-07
COG4585365 COG4585, COG4585, Signal transduction histidine ki 2e-07
COG4585365 COG4585, COG4585, Signal transduction histidine ki 2e-07
COG4585365 COG4585, COG4585, Signal transduction histidine ki 2e-07
COG4585365 COG4585, COG4585, Signal transduction histidine ki 2e-07
COG4585 365 COG4585, COG4585, Signal transduction histidine ki 2e-07
COG4585 365 COG4585, COG4585, Signal transduction histidine ki 2e-07
COG4585 365 COG4585, COG4585, Signal transduction histidine ki 2e-07
COG4585365 COG4585, COG4585, Signal transduction histidine ki 2e-07
COG4485 858 COG4485, COG4485, Predicted membrane protein [Func 2e-07
COG4485 858 COG4485, COG4485, Predicted membrane protein [Func 3e-07
COG4485 858 COG4485, COG4485, Predicted membrane protein [Func 3e-07
COG4485 858 COG4485, COG4485, Predicted membrane protein [Func 3e-07
COG4485 858 COG4485, COG4485, Predicted membrane protein [Func 3e-07
COG4485 858 COG4485, COG4485, Predicted membrane protein [Func 3e-07
COG4485 858 COG4485, COG4485, Predicted membrane protein [Func 3e-07
pfam02516 650 pfam02516, STT3, Oligosaccharyl transferase STT3 s 3e-07
pfam05297 382 pfam05297, Herpes_LMP1, Herpesvirus latent membran 3e-07
pfam05297382 pfam05297, Herpes_LMP1, Herpesvirus latent membran 3e-07
pfam05297382 pfam05297, Herpes_LMP1, Herpesvirus latent membran 3e-07
pfam05297382 pfam05297, Herpes_LMP1, Herpesvirus latent membran 3e-07
pfam05297382 pfam05297, Herpes_LMP1, Herpesvirus latent membran 3e-07
pfam05297382 pfam05297, Herpes_LMP1, Herpesvirus latent membran 3e-07
pfam05297382 pfam05297, Herpes_LMP1, Herpesvirus latent membran 3e-07
pfam05297382 pfam05297, Herpes_LMP1, Herpesvirus latent membran 3e-07
pfam05297382 pfam05297, Herpes_LMP1, Herpesvirus latent membran 3e-07
pfam05297382 pfam05297, Herpes_LMP1, Herpesvirus latent membran 3e-07
pfam05297382 pfam05297, Herpes_LMP1, Herpesvirus latent membran 3e-07
pfam05297382 pfam05297, Herpes_LMP1, Herpesvirus latent membran 3e-07
pfam05297382 pfam05297, Herpes_LMP1, Herpesvirus latent membran 3e-07
COG1807535 COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transfe 4e-07
COG4585 365 COG4585, COG4585, Signal transduction histidine ki 4e-07
COG4585365 COG4585, COG4585, Signal transduction histidine ki 4e-07
COG4585365 COG4585, COG4585, Signal transduction histidine ki 4e-07
COG4585365 COG4585, COG4585, Signal transduction histidine ki 4e-07
COG4585365 COG4585, COG4585, Signal transduction histidine ki 4e-07
COG4585365 COG4585, COG4585, Signal transduction histidine ki 4e-07
COG4585365 COG4585, COG4585, Signal transduction histidine ki 4e-07
COG4585365 COG4585, COG4585, Signal transduction histidine ki 4e-07
COG4585365 COG4585, COG4585, Signal transduction histidine ki 4e-07
COG4585365 COG4585, COG4585, Signal transduction histidine ki 4e-07
COG4585365 COG4585, COG4585, Signal transduction histidine ki 4e-07
COG4585365 COG4585, COG4585, Signal transduction histidine ki 4e-07
COG4585 365 COG4585, COG4585, Signal transduction histidine ki 4e-07
COG4585 365 COG4585, COG4585, Signal transduction histidine ki 4e-07
pfam05297 382 pfam05297, Herpes_LMP1, Herpesvirus latent membran 4e-07
COG2244480 COG2244, RfbX, Membrane protein involved in the ex 5e-07
COG2244480 COG2244, RfbX, Membrane protein involved in the ex 5e-07
COG2244480 COG2244, RfbX, Membrane protein involved in the ex 5e-07
COG2244480 COG2244, RfbX, Membrane protein involved in the ex 5e-07
COG2244480 COG2244, RfbX, Membrane protein involved in the ex 5e-07
COG3307 424 COG3307, RfaL, Lipid A core - O-antigen ligase and 1e-06
COG4585365 COG4585, COG4585, Signal transduction histidine ki 1e-06
COG4585365 COG4585, COG4585, Signal transduction histidine ki 1e-06
COG4585365 COG4585, COG4585, Signal transduction histidine ki 1e-06
COG4585365 COG4585, COG4585, Signal transduction histidine ki 1e-06
COG4585365 COG4585, COG4585, Signal transduction histidine ki 1e-06
COG4585365 COG4585, COG4585, Signal transduction histidine ki 1e-06
COG4585365 COG4585, COG4585, Signal transduction histidine ki 1e-06
COG4585365 COG4585, COG4585, Signal transduction histidine ki 1e-06
COG4585365 COG4585, COG4585, Signal transduction histidine ki 1e-06
COG4585365 COG4585, COG4585, Signal transduction histidine ki 1e-06
COG4585 365 COG4585, COG4585, Signal transduction histidine ki 1e-06
COG4585 365 COG4585, COG4585, Signal transduction histidine ki 1e-06
COG4585 365 COG4585, COG4585, Signal transduction histidine ki 1e-06
pfam02516 650 pfam02516, STT3, Oligosaccharyl transferase STT3 s 1e-06
pfam02516 650 pfam02516, STT3, Oligosaccharyl transferase STT3 s 1e-06
pfam02516 650 pfam02516, STT3, Oligosaccharyl transferase STT3 s 1e-06
COG2244480 COG2244, RfbX, Membrane protein involved in the ex 1e-06
MTH00163 445 MTH00163, ND4, NADH dehydrogenase subunit 4; Provi 1e-06
COG1835386 COG1835, COG1835, Predicted acyltransferases [Lipi 1e-06
COG1835386 COG1835, COG1835, Predicted acyltransferases [Lipi 1e-06
COG1835386 COG1835, COG1835, Predicted acyltransferases [Lipi 1e-06
COG1835386 COG1835, COG1835, Predicted acyltransferases [Lipi 1e-06
COG1835386 COG1835, COG1835, Predicted acyltransferases [Lipi 1e-06
COG0474917 COG0474, MgtA, Cation transport ATPase [Inorganic 1e-06
COG1807 535 COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transfe 2e-06
pfam03699 771 pfam03699, UPF0182, Uncharacterized protein family 2e-06
COG4585365 COG4585, COG4585, Signal transduction histidine ki 2e-06
COG4485 858 COG4485, COG4485, Predicted membrane protein [Func 2e-06
pfam02516650 pfam02516, STT3, Oligosaccharyl transferase STT3 s 2e-06
COG2244480 COG2244, RfbX, Membrane protein involved in the ex 2e-06
MTH00163445 MTH00163, ND4, NADH dehydrogenase subunit 4; Provi 2e-06
MTH00163445 MTH00163, ND4, NADH dehydrogenase subunit 4; Provi 2e-06
MTH00163445 MTH00163, ND4, NADH dehydrogenase subunit 4; Provi 2e-06
MTH00163445 MTH00163, ND4, NADH dehydrogenase subunit 4; Provi 2e-06
MTH00163 445 MTH00163, ND4, NADH dehydrogenase subunit 4; Provi 2e-06
MTH00163 445 MTH00163, ND4, NADH dehydrogenase subunit 4; Provi 2e-06
MTH00095527 MTH00095, ND5, NADH dehydrogenase subunit 5; Provi 2e-06
pfam14351321 pfam14351, DUF4401, Domain of unknown function (DU 2e-06
COG0658453 COG0658, ComEC, Predicted membrane metal-binding p 2e-06
COG0658453 COG0658, ComEC, Predicted membrane metal-binding p 2e-06
COG0658453 COG0658, ComEC, Predicted membrane metal-binding p 2e-06
COG0658453 COG0658, ComEC, Predicted membrane metal-binding p 2e-06
COG4585365 COG4585, COG4585, Signal transduction histidine ki 3e-06
pfam14351321 pfam14351, DUF4401, Domain of unknown function (DU 3e-06
pfam14351321 pfam14351, DUF4401, Domain of unknown function (DU 3e-06
COG0658453 COG0658, ComEC, Predicted membrane metal-binding p 3e-06
TIGR04286 920 TIGR04286, MSEP-CTERM, MSEP-CTERM protein 3e-06
COG1287 773 COG1287, COG1287, Uncharacterized membrane protein 4e-06
MTH00095527 MTH00095, ND5, NADH dehydrogenase subunit 5; Provi 4e-06
TIGR04286 920 TIGR04286, MSEP-CTERM, MSEP-CTERM protein 4e-06
TIGR04286 920 TIGR04286, MSEP-CTERM, MSEP-CTERM protein 4e-06
COG3264 835 COG3264, COG3264, Small-conductance mechanosensiti 4e-06
MTH00163445 MTH00163, ND4, NADH dehydrogenase subunit 4; Provi 5e-06
MTH00163445 MTH00163, ND4, NADH dehydrogenase subunit 4; Provi 5e-06
MTH00163 445 MTH00163, ND4, NADH dehydrogenase subunit 4; Provi 5e-06
COG0474917 COG0474, MgtA, Cation transport ATPase [Inorganic 5e-06
COG0474917 COG0474, MgtA, Cation transport ATPase [Inorganic 5e-06
COG0474917 COG0474, MgtA, Cation transport ATPase [Inorganic 5e-06
COG0474917 COG0474, MgtA, Cation transport ATPase [Inorganic 5e-06
COG0474917 COG0474, MgtA, Cation transport ATPase [Inorganic 5e-06
COG0474917 COG0474, MgtA, Cation transport ATPase [Inorganic 5e-06
COG0474917 COG0474, MgtA, Cation transport ATPase [Inorganic 5e-06
COG0474917 COG0474, MgtA, Cation transport ATPase [Inorganic 5e-06
COG0474917 COG0474, MgtA, Cation transport ATPase [Inorganic 5e-06
COG0474917 COG0474, MgtA, Cation transport ATPase [Inorganic 5e-06
COG0474917 COG0474, MgtA, Cation transport ATPase [Inorganic 5e-06
MTH00163445 MTH00163, ND4, NADH dehydrogenase subunit 4; Provi 7e-06
COG1835386 COG1835, COG1835, Predicted acyltransferases [Lipi 7e-06
TIGR04286 920 TIGR04286, MSEP-CTERM, MSEP-CTERM protein 7e-06
COG1368650 COG1368, MdoB, Phosphoglycerol transferase and rel 8e-06
COG0474917 COG0474, MgtA, Cation transport ATPase [Inorganic 8e-06
COG3307 424 COG3307, RfaL, Lipid A core - O-antigen ligase and 9e-06
COG4485 858 COG4485, COG4485, Predicted membrane protein [Func 9e-06
pfam05297382 pfam05297, Herpes_LMP1, Herpesvirus latent membran 9e-06
TIGR04286 920 TIGR04286, MSEP-CTERM, MSEP-CTERM protein 9e-06
pfam03699 771 pfam03699, UPF0182, Uncharacterized protein family 1e-05
COG0815518 COG0815, Lnt, Apolipoprotein N-acyltransferase [Ce 1e-05
pfam02516650 pfam02516, STT3, Oligosaccharyl transferase STT3 s 1e-05
pfam02516650 pfam02516, STT3, Oligosaccharyl transferase STT3 s 1e-05
pfam02516650 pfam02516, STT3, Oligosaccharyl transferase STT3 s 1e-05
pfam02516650 pfam02516, STT3, Oligosaccharyl transferase STT3 s 1e-05
pfam02516650 pfam02516, STT3, Oligosaccharyl transferase STT3 s 1e-05
pfam02516650 pfam02516, STT3, Oligosaccharyl transferase STT3 s 1e-05
pfam02516650 pfam02516, STT3, Oligosaccharyl transferase STT3 s 1e-05
MTH00163445 MTH00163, ND4, NADH dehydrogenase subunit 4; Provi 1e-05
MTH00163 445 MTH00163, ND4, NADH dehydrogenase subunit 4; Provi 1e-05
pfam14351321 pfam14351, DUF4401, Domain of unknown function (DU 1e-05
COG3307424 COG3307, RfaL, Lipid A core - O-antigen ligase and 2e-05
MTH00163 445 MTH00163, ND4, NADH dehydrogenase subunit 4; Provi 2e-05
MTH00163445 MTH00163, ND4, NADH dehydrogenase subunit 4; Provi 2e-05
pfam14351321 pfam14351, DUF4401, Domain of unknown function (DU 2e-05
COG3264835 COG3264, COG3264, Small-conductance mechanosensiti 2e-05
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (M 2e-05
COG3356 578 COG3356, COG3356, Predicted membrane protein [Func 2e-05
COG3307424 COG3307, RfaL, Lipid A core - O-antigen ligase and 3e-05
COG0815518 COG0815, Lnt, Apolipoprotein N-acyltransferase [Ce 3e-05
COG3264 835 COG3264, COG3264, Small-conductance mechanosensiti 3e-05
MTH00091273 MTH00091, ND2, NADH dehydrogenase subunit 2; Provi 3e-05
TIGR03025445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 3e-05
TIGR03025445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 3e-05
TIGR03025445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 3e-05
TIGR03025445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 3e-05
TIGR03025445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 3e-05
TIGR03025445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 3e-05
TIGR03025445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 3e-05
TIGR03025445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 3e-05
TIGR03025 445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 3e-05
TIGR03025 445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 3e-05
TIGR03025 445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 3e-05
TIGR03025 445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 3e-05
TIGR03025 445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 3e-05
TIGR03025 445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 3e-05
pfam09586835 pfam09586, YfhO, Bacterial membrane protein YfhO 4e-05
COG3307424 COG3307, RfaL, Lipid A core - O-antigen ligase and 4e-05
COG0474917 COG0474, MgtA, Cation transport ATPase [Inorganic 4e-05
COG0474917 COG0474, MgtA, Cation transport ATPase [Inorganic 4e-05
pfam14351321 pfam14351, DUF4401, Domain of unknown function (DU 4e-05
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (M 4e-05
COG3356578 COG3356, COG3356, Predicted membrane protein [Func 4e-05
COG3356578 COG3356, COG3356, Predicted membrane protein [Func 4e-05
COG3356 578 COG3356, COG3356, Predicted membrane protein [Func 4e-05
COG3356 578 COG3356, COG3356, Predicted membrane protein [Func 4e-05
COG3356 578 COG3356, COG3356, Predicted membrane protein [Func 4e-05
COG3356578 COG3356, COG3356, Predicted membrane protein [Func 4e-05
COG0658453 COG0658, ComEC, Predicted membrane metal-binding p 5e-05
COG4984644 COG4984, COG4984, Predicted membrane protein [Func 5e-05
COG2194 555 COG2194, COG2194, Predicted membrane-associated, m 6e-05
pfam14351321 pfam14351, DUF4401, Domain of unknown function (DU 6e-05
COG3356 578 COG3356, COG3356, Predicted membrane protein [Func 6e-05
TIGR03766483 TIGR03766, TIGR03766, conserved hypothetical integ 6e-05
TIGR03766483 TIGR03766, TIGR03766, conserved hypothetical integ 6e-05
COG1480700 COG1480, COG1480, Predicted membrane-associated HD 6e-05
COG1480700 COG1480, COG1480, Predicted membrane-associated HD 6e-05
COG1480700 COG1480, COG1480, Predicted membrane-associated HD 6e-05
COG1480700 COG1480, COG1480, Predicted membrane-associated HD 6e-05
COG1480700 COG1480, COG1480, Predicted membrane-associated HD 6e-05
COG1480700 COG1480, COG1480, Predicted membrane-associated HD 6e-05
COG1480700 COG1480, COG1480, Predicted membrane-associated HD 6e-05
COG1480700 COG1480, COG1480, Predicted membrane-associated HD 6e-05
COG1480 700 COG1480, COG1480, Predicted membrane-associated HD 6e-05
COG1480 700 COG1480, COG1480, Predicted membrane-associated HD 6e-05
COG1480 700 COG1480, COG1480, Predicted membrane-associated HD 6e-05
PRK00302505 PRK00302, lnt, apolipoprotein N-acyltransferase; R 6e-05
PRK00302505 PRK00302, lnt, apolipoprotein N-acyltransferase; R 6e-05
PRK00302 505 PRK00302, lnt, apolipoprotein N-acyltransferase; R 6e-05
COG1835386 COG1835, COG1835, Predicted acyltransferases [Lipi 7e-05
COG1480700 COG1480, COG1480, Predicted membrane-associated HD 7e-05
COG1480700 COG1480, COG1480, Predicted membrane-associated HD 7e-05
COG1480700 COG1480, COG1480, Predicted membrane-associated HD 7e-05
COG1480 700 COG1480, COG1480, Predicted membrane-associated HD 7e-05
COG1480700 COG1480, COG1480, Predicted membrane-associated HD 8e-05
COG0348386 COG0348, NapH, Polyferredoxin [Energy production a 8e-05
COG0348386 COG0348, NapH, Polyferredoxin [Energy production a 8e-05
COG0348386 COG0348, NapH, Polyferredoxin [Energy production a 8e-05
COG0348386 COG0348, NapH, Polyferredoxin [Energy production a 8e-05
COG0348 386 COG0348, NapH, Polyferredoxin [Energy production a 8e-05
COG1030436 COG1030, NfeD, Membrane-bound serine protease (Clp 8e-05
COG1030436 COG1030, NfeD, Membrane-bound serine protease (Clp 8e-05
COG1030436 COG1030, NfeD, Membrane-bound serine protease (Clp 8e-05
COG1030436 COG1030, NfeD, Membrane-bound serine protease (Clp 8e-05
COG1030436 COG1030, NfeD, Membrane-bound serine protease (Clp 8e-05
COG1030436 COG1030, NfeD, Membrane-bound serine protease (Clp 8e-05
COG1030436 COG1030, NfeD, Membrane-bound serine protease (Clp 8e-05
COG1030436 COG1030, NfeD, Membrane-bound serine protease (Clp 8e-05
COG1030436 COG1030, NfeD, Membrane-bound serine protease (Clp 8e-05
COG1030436 COG1030, NfeD, Membrane-bound serine protease (Clp 8e-05
COG1030436 COG1030, NfeD, Membrane-bound serine protease (Clp 8e-05
COG1030436 COG1030, NfeD, Membrane-bound serine protease (Clp 8e-05
COG1030436 COG1030, NfeD, Membrane-bound serine protease (Clp 8e-05
COG1030436 COG1030, NfeD, Membrane-bound serine protease (Clp 8e-05
pfam02516 650 pfam02516, STT3, Oligosaccharyl transferase STT3 s 9e-05
COG0531466 COG0531, PotE, Amino acid transporters [Amino acid 9e-05
COG0531466 COG0531, PotE, Amino acid transporters [Amino acid 9e-05
COG0531466 COG0531, PotE, Amino acid transporters [Amino acid 9e-05
COG0531466 COG0531, PotE, Amino acid transporters [Amino acid 9e-05
COG0531466 COG0531, PotE, Amino acid transporters [Amino acid 9e-05
COG3594343 COG3594, NolL, Fucose 4-O-acetylase and related ac 9e-05
COG3594343 COG3594, NolL, Fucose 4-O-acetylase and related ac 9e-05
pfam03699 771 pfam03699, UPF0182, Uncharacterized protein family 1e-04
MTH00095527 MTH00095, ND5, NADH dehydrogenase subunit 5; Provi 1e-04
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (M 1e-04
TIGR03025445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 1e-04
TIGR03025445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 1e-04
TIGR03025445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 1e-04
TIGR03025445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 1e-04
TIGR03025445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 1e-04
TIGR03025445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 1e-04
TIGR03025445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 1e-04
TIGR03025445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 1e-04
TIGR03025 445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 1e-04
TIGR03025 445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 1e-04
TIGR03025 445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 1e-04
TIGR03025 445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 1e-04
TIGR03025 445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 1e-04
TIGR03025 445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 1e-04
TIGR03766483 TIGR03766, TIGR03766, conserved hypothetical integ 1e-04
TIGR03766 483 TIGR03766, TIGR03766, conserved hypothetical integ 1e-04
COG0531466 COG0531, PotE, Amino acid transporters [Amino acid 1e-04
COG0531466 COG0531, PotE, Amino acid transporters [Amino acid 1e-04
COG0531466 COG0531, PotE, Amino acid transporters [Amino acid 1e-04
COG0531466 COG0531, PotE, Amino acid transporters [Amino acid 1e-04
COG2194555 COG2194, COG2194, Predicted membrane-associated, m 2e-04
COG2244480 COG2244, RfbX, Membrane protein involved in the ex 2e-04
MTH00163 445 MTH00163, ND4, NADH dehydrogenase subunit 4; Provi 2e-04
COG1835386 COG1835, COG1835, Predicted acyltransferases [Lipi 2e-04
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (M 2e-04
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (M 2e-04
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (M 2e-04
MTH00091273 MTH00091, ND2, NADH dehydrogenase subunit 2; Provi 2e-04
TIGR03025 445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 2e-04
TIGR03025 445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 2e-04
TIGR03025445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 2e-04
TIGR03025445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 2e-04
TIGR03025445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 2e-04
TIGR03025445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 2e-04
TIGR03025445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 2e-04
TIGR03025445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 2e-04
TIGR03025445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 2e-04
TIGR03025445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 2e-04
TIGR03025445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 2e-04
TIGR03025 445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 2e-04
TIGR03025 445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 2e-04
TIGR03025 445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 2e-04
TIGR03025 445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 2e-04
TIGR03025 445 TIGR03025, EPS_sugtrans, exopolysaccharide biosynt 2e-04
PRK00302505 PRK00302, lnt, apolipoprotein N-acyltransferase; R 2e-04
COG0531466 COG0531, PotE, Amino acid transporters [Amino acid 2e-04
pfam11992321 pfam11992, DUF3488, Domain of unknown function (DU 2e-04
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 2e-04
TIGR03023451 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g 2e-04
TIGR03023451 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g 2e-04
TIGR03023451 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g 2e-04
TIGR03023451 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g 2e-04
TIGR03023451 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g 2e-04
TIGR03023451 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g 2e-04
TIGR03023451 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g 2e-04
TIGR03023451 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g 2e-04
TIGR03023 451 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g 2e-04
TIGR03023 451 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g 2e-04
TIGR03023 451 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g 2e-04
TIGR03023 451 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g 2e-04
TIGR03023 451 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g 2e-04
TIGR03023 451 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g 2e-04
MTH00091273 MTH00091, ND2, NADH dehydrogenase subunit 2; Provi 3e-04
MTH00091273 MTH00091, ND2, NADH dehydrogenase subunit 2; Provi 3e-04
MTH00091273 MTH00091, ND2, NADH dehydrogenase subunit 2; Provi 3e-04
MTH00091273 MTH00091, ND2, NADH dehydrogenase subunit 2; Provi 3e-04
MTH00091273 MTH00091, ND2, NADH dehydrogenase subunit 2; Provi 3e-04
MTH00091273 MTH00091, ND2, NADH dehydrogenase subunit 2; Provi 3e-04
MTH00091273 MTH00091, ND2, NADH dehydrogenase subunit 2; Provi 3e-04
MTH00091273 MTH00091, ND2, NADH dehydrogenase subunit 2; Provi 3e-04
COG4984644 COG4984, COG4984, Predicted membrane protein [Func 3e-04
TIGR03766483 TIGR03766, TIGR03766, conserved hypothetical integ 3e-04
TIGR03766 483 TIGR03766, TIGR03766, conserved hypothetical integ 3e-04
COG3594343 COG3594, NolL, Fucose 4-O-acetylase and related ac 3e-04
pfam03772270 pfam03772, Competence, Competence protein 3e-04
pfam03772270 pfam03772, Competence, Competence protein 3e-04
pfam03772270 pfam03772, Competence, Competence protein 3e-04
pfam03772270 pfam03772, Competence, Competence protein 3e-04
pfam03772270 pfam03772, Competence, Competence protein 3e-04
pfam03772270 pfam03772, Competence, Competence protein 3e-04
pfam03772270 pfam03772, Competence, Competence protein 3e-04
pfam03772270 pfam03772, Competence, Competence protein 3e-04
COG2898538 COG2898, COG2898, Uncharacterized conserved protei 3e-04
pfam01757326 pfam01757, Acyl_transf_3, Acyltransferase family 3e-04
pfam01757326 pfam01757, Acyl_transf_3, Acyltransferase family 3e-04
pfam01757326 pfam01757, Acyl_transf_3, Acyltransferase family 3e-04
pfam01757326 pfam01757, Acyl_transf_3, Acyltransferase family 3e-04
pfam01757326 pfam01757, Acyl_transf_3, Acyltransferase family 3e-04
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 3e-04
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 3e-04
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 3e-04
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 3e-04
COG1132 567 COG1132, MdlB, ABC-type multidrug transport system 3e-04
COG1132 567 COG1132, MdlB, ABC-type multidrug transport system 3e-04
COG1132 567 COG1132, MdlB, ABC-type multidrug transport system 3e-04
COG1132 567 COG1132, MdlB, ABC-type multidrug transport system 3e-04
COG1132 567 COG1132, MdlB, ABC-type multidrug transport system 3e-04
COG1132 567 COG1132, MdlB, ABC-type multidrug transport system 3e-04
COG1132 567 COG1132, MdlB, ABC-type multidrug transport system 3e-04
COG1132 567 COG1132, MdlB, ABC-type multidrug transport system 3e-04
pfam03901412 pfam03901, Glyco_transf_22, Alg9-like mannosyltran 3e-04
pfam03901412 pfam03901, Glyco_transf_22, Alg9-like mannosyltran 3e-04
TIGR01654679 TIGR01654, bact_immun_7tm, bacteriocin-associated 3e-04
TIGR01654679 TIGR01654, bact_immun_7tm, bacteriocin-associated 3e-04
TIGR01654679 TIGR01654, bact_immun_7tm, bacteriocin-associated 3e-04
TIGR01654 679 TIGR01654, bact_immun_7tm, bacteriocin-associated 3e-04
TIGR01654 679 TIGR01654, bact_immun_7tm, bacteriocin-associated 3e-04
TIGR01654 679 TIGR01654, bact_immun_7tm, bacteriocin-associated 3e-04
TIGR01654 679 TIGR01654, bact_immun_7tm, bacteriocin-associated 3e-04
pfam02516650 pfam02516, STT3, Oligosaccharyl transferase STT3 s 4e-04
COG0348386 COG0348, NapH, Polyferredoxin [Energy production a 4e-04
COG0348386 COG0348, NapH, Polyferredoxin [Energy production a 4e-04
COG0348386 COG0348, NapH, Polyferredoxin [Energy production a 4e-04
COG3594343 COG3594, NolL, Fucose 4-O-acetylase and related ac 4e-04
pfam11992321 pfam11992, DUF3488, Domain of unknown function (DU 4e-04
pfam11992321 pfam11992, DUF3488, Domain of unknown function (DU 4e-04
pfam11992321 pfam11992, DUF3488, Domain of unknown function (DU 4e-04
pfam11992321 pfam11992, DUF3488, Domain of unknown function (DU 4e-04
pfam11992321 pfam11992, DUF3488, Domain of unknown function (DU 4e-04
pfam11992321 pfam11992, DUF3488, Domain of unknown function (DU 4e-04
pfam11992321 pfam11992, DUF3488, Domain of unknown function (DU 4e-04
pfam11992321 pfam11992, DUF3488, Domain of unknown function (DU 4e-04
pfam11992321 pfam11992, DUF3488, Domain of unknown function (DU 4e-04
pfam11992321 pfam11992, DUF3488, Domain of unknown function (DU 4e-04
pfam11992321 pfam11992, DUF3488, Domain of unknown function (DU 4e-04
pfam11992321 pfam11992, DUF3488, Domain of unknown function (DU 4e-04
pfam11992321 pfam11992, DUF3488, Domain of unknown function (DU 4e-04
TIGR03023451 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g 4e-04
TIGR03023451 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g 4e-04
TIGR03023451 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g 4e-04
TIGR03023451 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g 4e-04
TIGR03023451 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g 4e-04
TIGR03023451 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g 4e-04
TIGR03023451 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g 4e-04
TIGR03023451 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g 4e-04
TIGR03023 451 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g 4e-04
TIGR03023 451 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g 4e-04
TIGR03023 451 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g 4e-04
TIGR03023 451 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g 4e-04
TIGR03023 451 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g 4e-04
TIGR03023 451 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g 4e-04
COG2898538 COG2898, COG2898, Uncharacterized conserved protei 4e-04
COG2898 538 COG2898, COG2898, Uncharacterized conserved protei 4e-04
COG2898 538 COG2898, COG2898, Uncharacterized conserved protei 4e-04
COG2898 538 COG2898, COG2898, Uncharacterized conserved protei 4e-04
COG1215439 COG1215, COG1215, Glycosyltransferases, probably i 4e-04
COG1215439 COG1215, COG1215, Glycosyltransferases, probably i 4e-04
COG1215439 COG1215, COG1215, Glycosyltransferases, probably i 4e-04
COG1215439 COG1215, COG1215, Glycosyltransferases, probably i 4e-04
COG1215439 COG1215, COG1215, Glycosyltransferases, probably i 4e-04
COG1215439 COG1215, COG1215, Glycosyltransferases, probably i 4e-04
COG1215439 COG1215, COG1215, Glycosyltransferases, probably i 4e-04
COG1215439 COG1215, COG1215, Glycosyltransferases, probably i 4e-04
COG1215439 COG1215, COG1215, Glycosyltransferases, probably i 4e-04
COG1215439 COG1215, COG1215, Glycosyltransferases, probably i 4e-04
COG1215439 COG1215, COG1215, Glycosyltransferases, probably i 4e-04
COG1215439 COG1215, COG1215, Glycosyltransferases, probably i 4e-04
COG1215439 COG1215, COG1215, Glycosyltransferases, probably i 4e-04
PRK06370463 PRK06370, PRK06370, mercuric reductase; Validated 4e-04
COG5305552 COG5305, COG5305, Predicted membrane protein [Func 4e-04
COG2244480 COG2244, RfbX, Membrane protein involved in the ex 5e-04
MTH00163 445 MTH00163, ND4, NADH dehydrogenase subunit 4; Provi 5e-04
COG1030436 COG1030, NfeD, Membrane-bound serine protease (Clp 5e-04
TIGR03023 451 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g 5e-04
pfam03772270 pfam03772, Competence, Competence protein 5e-04
pfam03772270 pfam03772, Competence, Competence protein 5e-04
pfam03772270 pfam03772, Competence, Competence protein 5e-04
pfam03772270 pfam03772, Competence, Competence protein 5e-04
COG2898538 COG2898, COG2898, Uncharacterized conserved protei 5e-04
COG2898 538 COG2898, COG2898, Uncharacterized conserved protei 5e-04
COG5305552 COG5305, COG5305, Predicted membrane protein [Func 5e-04
pfam14264317 pfam14264, Glucos_trans_II, Glucosyl transferase G 5e-04
pfam14264317 pfam14264, Glucos_trans_II, Glucosyl transferase G 5e-04
pfam14264317 pfam14264, Glucos_trans_II, Glucosyl transferase G 5e-04
pfam14264317 pfam14264, Glucos_trans_II, Glucosyl transferase G 5e-04
pfam14264317 pfam14264, Glucos_trans_II, Glucosyl transferase G 5e-04
pfam14264317 pfam14264, Glucos_trans_II, Glucosyl transferase G 5e-04
pfam14264317 pfam14264, Glucos_trans_II, Glucosyl transferase G 5e-04
pfam14264317 pfam14264, Glucos_trans_II, Glucosyl transferase G 5e-04
pfam14264317 pfam14264, Glucos_trans_II, Glucosyl transferase G 5e-04
COG4393 405 COG4393, COG4393, Predicted membrane protein [Func 5e-04
COG1377363 COG1377, FlhB, Flagellar biosynthesis pathway, com 5e-04
COG1377363 COG1377, FlhB, Flagellar biosynthesis pathway, com 5e-04
COG1377363 COG1377, FlhB, Flagellar biosynthesis pathway, com 5e-04
COG1377363 COG1377, FlhB, Flagellar biosynthesis pathway, com 5e-04
COG1377363 COG1377, FlhB, Flagellar biosynthesis pathway, com 5e-04
COG3264 835 COG3264, COG3264, Small-conductance mechanosensiti 6e-04
COG3594343 COG3594, NolL, Fucose 4-O-acetylase and related ac 6e-04
pfam03772270 pfam03772, Competence, Competence protein 6e-04
COG1215439 COG1215, COG1215, Glycosyltransferases, probably i 6e-04
TIGR03766483 TIGR03766, TIGR03766, conserved hypothetical integ 7e-04
TIGR03766483 TIGR03766, TIGR03766, conserved hypothetical integ 7e-04
COG1132 567 COG1132, MdlB, ABC-type multidrug transport system 7e-04
pfam03699771 pfam03699, UPF0182, Uncharacterized protein family 9e-04
pfam01757326 pfam01757, Acyl_transf_3, Acyltransferase family 9e-04
pfam14351321 pfam14351, DUF4401, Domain of unknown function (DU 0.001
pfam14351321 pfam14351, DUF4401, Domain of unknown function (DU 0.001
COG0658453 COG0658, ComEC, Predicted membrane metal-binding p 0.001
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (M 0.001
TIGR03766 483 TIGR03766, TIGR03766, conserved hypothetical integ 0.001
PRK00302 505 PRK00302, lnt, apolipoprotein N-acyltransferase; R 0.001
COG0531466 COG0531, PotE, Amino acid transporters [Amino acid 0.001
COG3594343 COG3594, NolL, Fucose 4-O-acetylase and related ac 0.001
COG2898538 COG2898, COG2898, Uncharacterized conserved protei 0.001
pfam01757326 pfam01757, Acyl_transf_3, Acyltransferase family 0.001
pfam01757326 pfam01757, Acyl_transf_3, Acyltransferase family 0.001
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 0.001
MTH00165573 MTH00165, ND5, NADH dehydrogenase subunit 5; Provi 0.001
MTH00165573 MTH00165, ND5, NADH dehydrogenase subunit 5; Provi 0.001
MTH00165573 MTH00165, ND5, NADH dehydrogenase subunit 5; Provi 0.001
MTH00165573 MTH00165, ND5, NADH dehydrogenase subunit 5; Provi 0.001
MTH00165573 MTH00165, ND5, NADH dehydrogenase subunit 5; Provi 0.001
MTH00165573 MTH00165, ND5, NADH dehydrogenase subunit 5; Provi 0.001
MTH00165573 MTH00165, ND5, NADH dehydrogenase subunit 5; Provi 0.001
MTH00165573 MTH00165, ND5, NADH dehydrogenase subunit 5; Provi 0.001
MTH00165573 MTH00165, ND5, NADH dehydrogenase subunit 5; Provi 0.001
MTH00165573 MTH00165, ND5, NADH dehydrogenase subunit 5; Provi 0.001
MTH00165573 MTH00165, ND5, NADH dehydrogenase subunit 5; Provi 0.001
MTH00165573 MTH00165, ND5, NADH dehydrogenase subunit 5; Provi 0.001
COG0728518 COG0728, MviN, Uncharacterized membrane protein, p 0.001
MTH00094403 MTH00094, ND4, NADH dehydrogenase subunit 4; Provi 0.001
MTH00094403 MTH00094, ND4, NADH dehydrogenase subunit 4; Provi 0.001
MTH00094403 MTH00094, ND4, NADH dehydrogenase subunit 4; Provi 0.001
MTH00094403 MTH00094, ND4, NADH dehydrogenase subunit 4; Provi 0.001
MTH00094403 MTH00094, ND4, NADH dehydrogenase subunit 4; Provi 0.001
MTH00094403 MTH00094, ND4, NADH dehydrogenase subunit 4; Provi 0.001
MTH00160335 MTH00160, ND2, NADH dehydrogenase subunit 2; Provi 0.001
TIGR03766483 TIGR03766, TIGR03766, conserved hypothetical integ 0.002
TIGR03766483 TIGR03766, TIGR03766, conserved hypothetical integ 0.002
TIGR03766483 TIGR03766, TIGR03766, conserved hypothetical integ 0.002
TIGR03766483 TIGR03766, TIGR03766, conserved hypothetical integ 0.002
COG1480 700 COG1480, COG1480, Predicted membrane-associated HD 0.002
TIGR03023 451 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g 0.002
COG2898 538 COG2898, COG2898, Uncharacterized conserved protei 0.002
pfam03901412 pfam03901, Glyco_transf_22, Alg9-like mannosyltran 0.002
pfam03901412 pfam03901, Glyco_transf_22, Alg9-like mannosyltran 0.002
pfam03901412 pfam03901, Glyco_transf_22, Alg9-like mannosyltran 0.002
COG1215439 COG1215, COG1215, Glycosyltransferases, probably i 0.002
COG5305552 COG5305, COG5305, Predicted membrane protein [Func 0.002
COG1377363 COG1377, FlhB, Flagellar biosynthesis pathway, com 0.002
COG1377363 COG1377, FlhB, Flagellar biosynthesis pathway, com 0.002
COG1377363 COG1377, FlhB, Flagellar biosynthesis pathway, com 0.002
COG1377363 COG1377, FlhB, Flagellar biosynthesis pathway, com 0.002
COG1377363 COG1377, FlhB, Flagellar biosynthesis pathway, com 0.002
COG1377363 COG1377, FlhB, Flagellar biosynthesis pathway, com 0.002
COG1377363 COG1377, FlhB, Flagellar biosynthesis pathway, com 0.002
COG1377363 COG1377, FlhB, Flagellar biosynthesis pathway, com 0.002
pfam05940379 pfam05940, NnrS, NnrS protein 0.002
COG4652657 COG4652, COG4652, Uncharacterized protein conserve 0.002
COG4652657 COG4652, COG4652, Uncharacterized protein conserve 0.002
COG4652657 COG4652, COG4652, Uncharacterized protein conserve 0.002
COG4652657 COG4652, COG4652, Uncharacterized protein conserve 0.002
COG4652 657 COG4652, COG4652, Uncharacterized protein conserve 0.002
COG4652 657 COG4652, COG4652, Uncharacterized protein conserve 0.002
COG4652 657 COG4652, COG4652, Uncharacterized protein conserve 0.002
COG0392322 COG0392, COG0392, Predicted integral membrane prot 0.002
TIGR00546 391 TIGR00546, lnt, apolipoprotein N-acyltransferase 0.002
COG1086 588 COG1086, COG1086, Predicted nucleoside-diphosphate 0.002
COG1835386 COG1835, COG1835, Predicted acyltransferases [Lipi 0.003
COG4984644 COG4984, COG4984, Predicted membrane protein [Func 0.003
COG1480 700 COG1480, COG1480, Predicted membrane-associated HD 0.003
COG0348386 COG0348, NapH, Polyferredoxin [Energy production a 0.003
COG0348386 COG0348, NapH, Polyferredoxin [Energy production a 0.003
COG0348 386 COG0348, NapH, Polyferredoxin [Energy production a 0.003
TIGR01654679 TIGR01654, bact_immun_7tm, bacteriocin-associated 0.003
TIGR01654 679 TIGR01654, bact_immun_7tm, bacteriocin-associated 0.003
TIGR01654 679 TIGR01654, bact_immun_7tm, bacteriocin-associated 0.003
COG1377 363 COG1377, FlhB, Flagellar biosynthesis pathway, com 0.003
COG0728518 COG0728, MviN, Uncharacterized membrane protein, p 0.003
COG0728518 COG0728, MviN, Uncharacterized membrane protein, p 0.003
COG0728518 COG0728, MviN, Uncharacterized membrane protein, p 0.003
COG0728518 COG0728, MviN, Uncharacterized membrane protein, p 0.003
COG0728518 COG0728, MviN, Uncharacterized membrane protein, p 0.003
pfam05940379 pfam05940, NnrS, NnrS protein 0.003
COG0575265 COG0575, CdsA, CDP-diglyceride synthetase [Lipid m 0.003
COG0575265 COG0575, CdsA, CDP-diglyceride synthetase [Lipid m 0.003
COG0575265 COG0575, CdsA, CDP-diglyceride synthetase [Lipid m 0.003
COG0575265 COG0575, CdsA, CDP-diglyceride synthetase [Lipid m 0.003
COG0575265 COG0575, CdsA, CDP-diglyceride synthetase [Lipid m 0.003
COG0575265 COG0575, CdsA, CDP-diglyceride synthetase [Lipid m 0.003
COG0575265 COG0575, CdsA, CDP-diglyceride synthetase [Lipid m 0.003
COG0575265 COG0575, CdsA, CDP-diglyceride synthetase [Lipid m 0.003
COG0575265 COG0575, CdsA, CDP-diglyceride synthetase [Lipid m 0.003
COG0575265 COG0575, CdsA, CDP-diglyceride synthetase [Lipid m 0.003
COG0575265 COG0575, CdsA, CDP-diglyceride synthetase [Lipid m 0.003
COG0575265 COG0575, CdsA, CDP-diglyceride synthetase [Lipid m 0.003
COG0575265 COG0575, CdsA, CDP-diglyceride synthetase [Lipid m 0.003
COG0575265 COG0575, CdsA, CDP-diglyceride synthetase [Lipid m 0.003
PRK05702359 PRK05702, flhB, flagellar biosynthesis protein Flh 0.003
PRK05702359 PRK05702, flhB, flagellar biosynthesis protein Flh 0.003
PRK05702359 PRK05702, flhB, flagellar biosynthesis protein Flh 0.003
PRK05702359 PRK05702, flhB, flagellar biosynthesis protein Flh 0.003
COG3846 452 COG3846, TrbL, Type IV secretory pathway, TrbL com 0.003
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
pfam13779 820 pfam13779, DUF4175, Domain of unknown function (DU 0.003
MTH00091273 MTH00091, ND2, NADH dehydrogenase subunit 2; Provi 0.004
TIGR03766483 TIGR03766, TIGR03766, conserved hypothetical integ 0.004
COG1132 567 COG1132, MdlB, ABC-type multidrug transport system 0.004
COG1086 588 COG1086, COG1086, Predicted nucleoside-diphosphate 0.004
PRK05702359 PRK05702, flhB, flagellar biosynthesis protein Flh 0.004
PRK05702359 PRK05702, flhB, flagellar biosynthesis protein Flh 0.004
PRK05702359 PRK05702, flhB, flagellar biosynthesis protein Flh 0.004
PRK05702359 PRK05702, flhB, flagellar biosynthesis protein Flh 0.004
pfam09913390 pfam09913, DUF2142, Predicted membrane protein (DU 0.004
PRK12291418 PRK12291, PRK12291, apolipoprotein N-acyltransfera 0.004
PRK12291418 PRK12291, PRK12291, apolipoprotein N-acyltransfera 0.004
PRK12291 418 PRK12291, PRK12291, apolipoprotein N-acyltransfera 0.004
COG5243491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 0.004
COG5243491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 0.004
COG5243491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 0.004
COG5243491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 0.004
COG5243 491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 0.004
pfam06728373 pfam06728, PIG-U, GPI transamidase subunit PIG-U 0.004
>gnl|CDD|235000 PRK02106, PRK02106, choline dehydrogenase; Validated Back     alignment and domain information
 Score =  244 bits (625), Expect = 1e-69
 Identities = 121/306 (39%), Positives = 163/306 (53%), Gaps = 23/306 (7%)

Query: 163 FDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGG-DTPIHSRIPGMSSVLSL----SEFD 217
           +D II+GA +AGCVLANRLSE   + VLL+EAGG D      I  M + L+       ++
Sbjct: 6   YDYIIIGAGSAGCVLANRLSEDPDVSVLLLEAGGPDYRWDFFIQ-MPAALAFPLQGKRYN 64

Query: 218 HAYLAEPSQFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAKL-GYNGWG 276
            AY  EP         N R++   GK LGGSS++  ++Y RG + DY+N+A+L G  GW 
Sbjct: 65  WAYETEPEPHMN----NRRMECPRGKVLGGSSSINGMVYIRGNAMDYDNWAELPGLEGWS 120

Query: 277 YDETLKYFVKSEDYRSVIYNESKAVHGTQGYLPVGLFK-NKENNIIREIFETSAQELGYP 335
           Y + L YF K+E              G  G  P+ + +     N + + F  +  + GYP
Sbjct: 121 YADCLPYFKKAETR----DGGEDDYRGGDG--PLSVTRGKPGTNPLFQAFVEAGVQAGYP 174

Query: 336 CPKDMNDRYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRTNLYVLKRSKVTKVIINDQ 395
              D+N  Y   GF  +      G R+SAA AYL P A KR NL ++  +   +++  + 
Sbjct: 175 RTDDLNG-YQQEGFGPMDRTVTNGRRWSAARAYLDP-ALKRPNLTIVTHALTDRILF-EG 231

Query: 396 NVATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQDLR 455
             A GVEY    G      A +EVIL+AGAI + QLL LSGIGP  HL E+ IPV  DL 
Sbjct: 232 KRAVGVEYER-GGGRETARARREVILSAGAINSPQLLQLSGIGPAEHLKELGIPVVHDLP 290

Query: 456 -VGENL 460
            VGENL
Sbjct: 291 GVGENL 296


Length = 560

>gnl|CDD|225186 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|233581 TIGR01810, betA, choline dehydrogenase Back     alignment and domain information
>gnl|CDD|234421 TIGR03970, Rv0697, dehydrogenase, Rv0697 family Back     alignment and domain information
>gnl|CDD|216089 pfam00732, GMC_oxred_N, GMC oxidoreductase Back     alignment and domain information
>gnl|CDD|218493 pfam05199, GMC_oxred_C, GMC oxidoreductase Back     alignment and domain information
>gnl|CDD|215420 PLN02785, PLN02785, Protein HOTHEAD Back     alignment and domain information
>gnl|CDD|225186 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|235000 PRK02106, PRK02106, choline dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|220569 pfam10101, DUF2339, Predicted membrane protein (DUF2339) Back     alignment and domain information
>gnl|CDD|220569 pfam10101, DUF2339, Predicted membrane protein (DUF2339) Back     alignment and domain information
>gnl|CDD|234421 TIGR03970, Rv0697, dehydrogenase, Rv0697 family Back     alignment and domain information
>gnl|CDD|220569 pfam10101, DUF2339, Predicted membrane protein (DUF2339) Back     alignment and domain information
>gnl|CDD|224720 COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224720 COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224720 COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224720 COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224720 COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224720 COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|220299 pfam09586, YfhO, Bacterial membrane protein YfhO Back     alignment and domain information
>gnl|CDD|224206 COG1287, COG1287, Uncharacterized membrane protein, required for N-linked glycosylation [General function prediction only] Back     alignment and domain information
>gnl|CDD|224206 COG1287, COG1287, Uncharacterized membrane protein, required for N-linked glycosylation [General function prediction only] Back     alignment and domain information
>gnl|CDD|224206 COG1287, COG1287, Uncharacterized membrane protein, required for N-linked glycosylation [General function prediction only] Back     alignment and domain information
>gnl|CDD|224287 COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224206 COG1287, COG1287, Uncharacterized membrane protein, required for N-linked glycosylation [General function prediction only] Back     alignment and domain information
>gnl|CDD|224206 COG1287, COG1287, Uncharacterized membrane protein, required for N-linked glycosylation [General function prediction only] Back     alignment and domain information
>gnl|CDD|220299 pfam09586, YfhO, Bacterial membrane protein YfhO Back     alignment and domain information
>gnl|CDD|220299 pfam09586, YfhO, Bacterial membrane protein YfhO Back     alignment and domain information
>gnl|CDD|220299 pfam09586, YfhO, Bacterial membrane protein YfhO Back     alignment and domain information
>gnl|CDD|220299 pfam09586, YfhO, Bacterial membrane protein YfhO Back     alignment and domain information
>gnl|CDD|220299 pfam09586, YfhO, Bacterial membrane protein YfhO Back     alignment and domain information
>gnl|CDD|220299 pfam09586, YfhO, Bacterial membrane protein YfhO Back     alignment and domain information
>gnl|CDD|224206 COG1287, COG1287, Uncharacterized membrane protein, required for N-linked glycosylation [General function prediction only] Back     alignment and domain information
>gnl|CDD|224720 COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224287 COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224287 COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224287 COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224287 COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224287 COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224287 COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224287 COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224287 COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224287 COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224287 COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224287 COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|220569 pfam10101, DUF2339, Predicted membrane protein (DUF2339) Back     alignment and domain information
>gnl|CDD|225105 COG2194, COG2194, Predicted membrane-associated, metal-dependent hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|225105 COG2194, COG2194, Predicted membrane-associated, metal-dependent hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224287 COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224206 COG1287, COG1287, Uncharacterized membrane protein, required for N-linked glycosylation [General function prediction only] Back     alignment and domain information
>gnl|CDD|220569 pfam10101, DUF2339, Predicted membrane protein (DUF2339) Back     alignment and domain information
>gnl|CDD|225105 COG2194, COG2194, Predicted membrane-associated, metal-dependent hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|225105 COG2194, COG2194, Predicted membrane-associated, metal-dependent hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|225105 COG2194, COG2194, Predicted membrane-associated, metal-dependent hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|225105 COG2194, COG2194, Predicted membrane-associated, metal-dependent hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|225105 COG2194, COG2194, Predicted membrane-associated, metal-dependent hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|225105 COG2194, COG2194, Predicted membrane-associated, metal-dependent hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|225105 COG2194, COG2194, Predicted membrane-associated, metal-dependent hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|225105 COG2194, COG2194, Predicted membrane-associated, metal-dependent hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|225105 COG2194, COG2194, Predicted membrane-associated, metal-dependent hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224287 COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|225844 COG3307, RfaL, Lipid A core - O-antigen ligase and related enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|220299 pfam09586, YfhO, Bacterial membrane protein YfhO Back     alignment and domain information
>gnl|CDD|220299 pfam09586, YfhO, Bacterial membrane protein YfhO Back     alignment and domain information
>gnl|CDD|225844 COG3307, RfaL, Lipid A core - O-antigen ligase and related enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|225844 COG3307, RfaL, Lipid A core - O-antigen ligase and related enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|225105 COG2194, COG2194, Predicted membrane-associated, metal-dependent hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224287 COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|225105 COG2194, COG2194, Predicted membrane-associated, metal-dependent hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|225844 COG3307, RfaL, Lipid A core - O-antigen ligase and related enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|217678 pfam03699, UPF0182, Uncharacterized protein family (UPF0182) Back     alignment and domain information
>gnl|CDD|225844 COG3307, RfaL, Lipid A core - O-antigen ligase and related enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|223885 COG0815, Lnt, Apolipoprotein N-acyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|223885 COG0815, Lnt, Apolipoprotein N-acyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|223885 COG0815, Lnt, Apolipoprotein N-acyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|223885 COG0815, Lnt, Apolipoprotein N-acyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|223885 COG0815, Lnt, Apolipoprotein N-acyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|223885 COG0815, Lnt, Apolipoprotein N-acyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|217678 pfam03699, UPF0182, Uncharacterized protein family (UPF0182) Back     alignment and domain information
>gnl|CDD|217678 pfam03699, UPF0182, Uncharacterized protein family (UPF0182) Back     alignment and domain information
>gnl|CDD|217678 pfam03699, UPF0182, Uncharacterized protein family (UPF0182) Back     alignment and domain information
>gnl|CDD|217678 pfam03699, UPF0182, Uncharacterized protein family (UPF0182) Back     alignment and domain information
>gnl|CDD|217678 pfam03699, UPF0182, Uncharacterized protein family (UPF0182) Back     alignment and domain information
>gnl|CDD|217678 pfam03699, UPF0182, Uncharacterized protein family (UPF0182) Back     alignment and domain information
>gnl|CDD|217678 pfam03699, UPF0182, Uncharacterized protein family (UPF0182) Back     alignment and domain information
>gnl|CDD|217678 pfam03699, UPF0182, Uncharacterized protein family (UPF0182) Back     alignment and domain information
>gnl|CDD|217678 pfam03699, UPF0182, Uncharacterized protein family (UPF0182) Back     alignment and domain information
>gnl|CDD|223885 COG0815, Lnt, Apolipoprotein N-acyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|220569 pfam10101, DUF2339, Predicted membrane protein (DUF2339) Back     alignment and domain information
>gnl|CDD|217678 pfam03699, UPF0182, Uncharacterized protein family (UPF0182) Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226888 COG4485, COG4485, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|226888 COG4485, COG4485, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|226888 COG4485, COG4485, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|226888 COG4485, COG4485, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|226888 COG4485, COG4485, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|226888 COG4485, COG4485, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|226888 COG4485, COG4485, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|217079 pfam02516, STT3, Oligosaccharyl transferase STT3 subunit Back     alignment and domain information
>gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) Back     alignment and domain information
>gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) Back     alignment and domain information
>gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) Back     alignment and domain information
>gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) Back     alignment and domain information
>gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) Back     alignment and domain information
>gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) Back     alignment and domain information
>gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) Back     alignment and domain information
>gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) Back     alignment and domain information
>gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) Back     alignment and domain information
>gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) Back     alignment and domain information
>gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) Back     alignment and domain information
>gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) Back     alignment and domain information
>gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) Back     alignment and domain information
>gnl|CDD|224720 COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) Back     alignment and domain information
>gnl|CDD|225153 COG2244, RfbX, Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only] Back     alignment and domain information
>gnl|CDD|225153 COG2244, RfbX, Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only] Back     alignment and domain information
>gnl|CDD|225153 COG2244, RfbX, Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only] Back     alignment and domain information
>gnl|CDD|225153 COG2244, RfbX, Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only] Back     alignment and domain information
>gnl|CDD|225153 COG2244, RfbX, Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only] Back     alignment and domain information
>gnl|CDD|225844 COG3307, RfaL, Lipid A core - O-antigen ligase and related enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|217079 pfam02516, STT3, Oligosaccharyl transferase STT3 subunit Back     alignment and domain information
>gnl|CDD|217079 pfam02516, STT3, Oligosaccharyl transferase STT3 subunit Back     alignment and domain information
>gnl|CDD|217079 pfam02516, STT3, Oligosaccharyl transferase STT3 subunit Back     alignment and domain information
>gnl|CDD|225153 COG2244, RfbX, Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only] Back     alignment and domain information
>gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|224748 COG1835, COG1835, Predicted acyltransferases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|224748 COG1835, COG1835, Predicted acyltransferases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|224748 COG1835, COG1835, Predicted acyltransferases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|224748 COG1835, COG1835, Predicted acyltransferases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|224748 COG1835, COG1835, Predicted acyltransferases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224720 COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|217678 pfam03699, UPF0182, Uncharacterized protein family (UPF0182) Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226888 COG4485, COG4485, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|217079 pfam02516, STT3, Oligosaccharyl transferase STT3 subunit Back     alignment and domain information
>gnl|CDD|225153 COG2244, RfbX, Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only] Back     alignment and domain information
>gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|177158 MTH00095, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|222703 pfam14351, DUF4401, Domain of unknown function (DUF4401) Back     alignment and domain information
>gnl|CDD|223731 COG0658, ComEC, Predicted membrane metal-binding protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|223731 COG0658, ComEC, Predicted membrane metal-binding protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|223731 COG0658, ComEC, Predicted membrane metal-binding protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|223731 COG0658, ComEC, Predicted membrane metal-binding protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|222703 pfam14351, DUF4401, Domain of unknown function (DUF4401) Back     alignment and domain information
>gnl|CDD|222703 pfam14351, DUF4401, Domain of unknown function (DUF4401) Back     alignment and domain information
>gnl|CDD|223731 COG0658, ComEC, Predicted membrane metal-binding protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|234534 TIGR04286, MSEP-CTERM, MSEP-CTERM protein Back     alignment and domain information
>gnl|CDD|224206 COG1287, COG1287, Uncharacterized membrane protein, required for N-linked glycosylation [General function prediction only] Back     alignment and domain information
>gnl|CDD|177158 MTH00095, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|234534 TIGR04286, MSEP-CTERM, MSEP-CTERM protein Back     alignment and domain information
>gnl|CDD|234534 TIGR04286, MSEP-CTERM, MSEP-CTERM protein Back     alignment and domain information
>gnl|CDD|225803 COG3264, COG3264, Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|224748 COG1835, COG1835, Predicted acyltransferases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|234534 TIGR04286, MSEP-CTERM, MSEP-CTERM protein Back     alignment and domain information
>gnl|CDD|224287 COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|225844 COG3307, RfaL, Lipid A core - O-antigen ligase and related enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|226888 COG4485, COG4485, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) Back     alignment and domain information
>gnl|CDD|234534 TIGR04286, MSEP-CTERM, MSEP-CTERM protein Back     alignment and domain information
>gnl|CDD|217678 pfam03699, UPF0182, Uncharacterized protein family (UPF0182) Back     alignment and domain information
>gnl|CDD|223885 COG0815, Lnt, Apolipoprotein N-acyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|217079 pfam02516, STT3, Oligosaccharyl transferase STT3 subunit Back     alignment and domain information
>gnl|CDD|217079 pfam02516, STT3, Oligosaccharyl transferase STT3 subunit Back     alignment and domain information
>gnl|CDD|217079 pfam02516, STT3, Oligosaccharyl transferase STT3 subunit Back     alignment and domain information
>gnl|CDD|217079 pfam02516, STT3, Oligosaccharyl transferase STT3 subunit Back     alignment and domain information
>gnl|CDD|217079 pfam02516, STT3, Oligosaccharyl transferase STT3 subunit Back     alignment and domain information
>gnl|CDD|217079 pfam02516, STT3, Oligosaccharyl transferase STT3 subunit Back     alignment and domain information
>gnl|CDD|217079 pfam02516, STT3, Oligosaccharyl transferase STT3 subunit Back     alignment and domain information
>gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|222703 pfam14351, DUF4401, Domain of unknown function (DUF4401) Back     alignment and domain information
>gnl|CDD|225844 COG3307, RfaL, Lipid A core - O-antigen ligase and related enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|222703 pfam14351, DUF4401, Domain of unknown function (DUF4401) Back     alignment and domain information
>gnl|CDD|225803 COG3264, COG3264, Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|225892 COG3356, COG3356, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|225844 COG3307, RfaL, Lipid A core - O-antigen ligase and related enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|223885 COG0815, Lnt, Apolipoprotein N-acyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|225803 COG3264, COG3264, Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|177154 MTH00091, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|220299 pfam09586, YfhO, Bacterial membrane protein YfhO Back     alignment and domain information
>gnl|CDD|225844 COG3307, RfaL, Lipid A core - O-antigen ligase and related enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|222703 pfam14351, DUF4401, Domain of unknown function (DUF4401) Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|225892 COG3356, COG3356, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|225892 COG3356, COG3356, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|225892 COG3356, COG3356, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|225892 COG3356, COG3356, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|225892 COG3356, COG3356, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|225892 COG3356, COG3356, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|223731 COG0658, ComEC, Predicted membrane metal-binding protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|227317 COG4984, COG4984, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|225105 COG2194, COG2194, Predicted membrane-associated, metal-dependent hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|222703 pfam14351, DUF4401, Domain of unknown function (DUF4401) Back     alignment and domain information
>gnl|CDD|225892 COG3356, COG3356, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|234350 TIGR03766, TIGR03766, conserved hypothetical integral membrane protein Back     alignment and domain information
>gnl|CDD|234350 TIGR03766, TIGR03766, conserved hypothetical integral membrane protein Back     alignment and domain information
>gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|234721 PRK00302, lnt, apolipoprotein N-acyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|234721 PRK00302, lnt, apolipoprotein N-acyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|234721 PRK00302, lnt, apolipoprotein N-acyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|224748 COG1835, COG1835, Predicted acyltransferases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|223425 COG0348, NapH, Polyferredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|223425 COG0348, NapH, Polyferredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|223425 COG0348, NapH, Polyferredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|223425 COG0348, NapH, Polyferredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|223425 COG0348, NapH, Polyferredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|223961 COG1030, NfeD, Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223961 COG1030, NfeD, Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223961 COG1030, NfeD, Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223961 COG1030, NfeD, Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223961 COG1030, NfeD, Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223961 COG1030, NfeD, Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223961 COG1030, NfeD, Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223961 COG1030, NfeD, Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223961 COG1030, NfeD, Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223961 COG1030, NfeD, Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223961 COG1030, NfeD, Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223961 COG1030, NfeD, Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223961 COG1030, NfeD, Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223961 COG1030, NfeD, Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|217079 pfam02516, STT3, Oligosaccharyl transferase STT3 subunit Back     alignment and domain information
>gnl|CDD|223605 COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223605 COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223605 COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223605 COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223605 COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|226122 COG3594, NolL, Fucose 4-O-acetylase and related acetyltransferases [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|226122 COG3594, NolL, Fucose 4-O-acetylase and related acetyltransferases [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|217678 pfam03699, UPF0182, Uncharacterized protein family (UPF0182) Back     alignment and domain information
>gnl|CDD|177158 MTH00095, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234350 TIGR03766, TIGR03766, conserved hypothetical integral membrane protein Back     alignment and domain information
>gnl|CDD|234350 TIGR03766, TIGR03766, conserved hypothetical integral membrane protein Back     alignment and domain information
>gnl|CDD|223605 COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223605 COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223605 COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223605 COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|225105 COG2194, COG2194, Predicted membrane-associated, metal-dependent hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|225153 COG2244, RfbX, Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only] Back     alignment and domain information
>gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|224748 COG1835, COG1835, Predicted acyltransferases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|177154 MTH00091, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>gnl|CDD|234721 PRK00302, lnt, apolipoprotein N-acyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|223605 COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|221363 pfam11992, DUF3488, Domain of unknown function (DUF3488) Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>gnl|CDD|177154 MTH00091, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|177154 MTH00091, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|177154 MTH00091, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|177154 MTH00091, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|177154 MTH00091, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|177154 MTH00091, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|177154 MTH00091, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|177154 MTH00091, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|227317 COG4984, COG4984, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|234350 TIGR03766, TIGR03766, conserved hypothetical integral membrane protein Back     alignment and domain information
>gnl|CDD|234350 TIGR03766, TIGR03766, conserved hypothetical integral membrane protein Back     alignment and domain information
>gnl|CDD|226122 COG3594, NolL, Fucose 4-O-acetylase and related acetyltransferases [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|217721 pfam03772, Competence, Competence protein Back     alignment and domain information
>gnl|CDD|217721 pfam03772, Competence, Competence protein Back     alignment and domain information
>gnl|CDD|217721 pfam03772, Competence, Competence protein Back     alignment and domain information
>gnl|CDD|217721 pfam03772, Competence, Competence protein Back     alignment and domain information
>gnl|CDD|217721 pfam03772, Competence, Competence protein Back     alignment and domain information
>gnl|CDD|217721 pfam03772, Competence, Competence protein Back     alignment and domain information
>gnl|CDD|217721 pfam03772, Competence, Competence protein Back     alignment and domain information
>gnl|CDD|217721 pfam03772, Competence, Competence protein Back     alignment and domain information
>gnl|CDD|225451 COG2898, COG2898, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|216682 pfam01757, Acyl_transf_3, Acyltransferase family Back     alignment and domain information
>gnl|CDD|216682 pfam01757, Acyl_transf_3, Acyltransferase family Back     alignment and domain information
>gnl|CDD|216682 pfam01757, Acyl_transf_3, Acyltransferase family Back     alignment and domain information
>gnl|CDD|216682 pfam01757, Acyl_transf_3, Acyltransferase family Back     alignment and domain information
>gnl|CDD|216682 pfam01757, Acyl_transf_3, Acyltransferase family Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|217785 pfam03901, Glyco_transf_22, Alg9-like mannosyltransferase family Back     alignment and domain information
>gnl|CDD|217785 pfam03901, Glyco_transf_22, Alg9-like mannosyltransferase family Back     alignment and domain information
>gnl|CDD|233511 TIGR01654, bact_immun_7tm, bacteriocin-associated integral membrane (putative immunity) protein Back     alignment and domain information
>gnl|CDD|233511 TIGR01654, bact_immun_7tm, bacteriocin-associated integral membrane (putative immunity) protein Back     alignment and domain information
>gnl|CDD|233511 TIGR01654, bact_immun_7tm, bacteriocin-associated integral membrane (putative immunity) protein Back     alignment and domain information
>gnl|CDD|233511 TIGR01654, bact_immun_7tm, bacteriocin-associated integral membrane (putative immunity) protein Back     alignment and domain information
>gnl|CDD|233511 TIGR01654, bact_immun_7tm, bacteriocin-associated integral membrane (putative immunity) protein Back     alignment and domain information
>gnl|CDD|233511 TIGR01654, bact_immun_7tm, bacteriocin-associated integral membrane (putative immunity) protein Back     alignment and domain information
>gnl|CDD|233511 TIGR01654, bact_immun_7tm, bacteriocin-associated integral membrane (putative immunity) protein Back     alignment and domain information
>gnl|CDD|217079 pfam02516, STT3, Oligosaccharyl transferase STT3 subunit Back     alignment and domain information
>gnl|CDD|223425 COG0348, NapH, Polyferredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|223425 COG0348, NapH, Polyferredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|223425 COG0348, NapH, Polyferredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|226122 COG3594, NolL, Fucose 4-O-acetylase and related acetyltransferases [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|221363 pfam11992, DUF3488, Domain of unknown function (DUF3488) Back     alignment and domain information
>gnl|CDD|221363 pfam11992, DUF3488, Domain of unknown function (DUF3488) Back     alignment and domain information
>gnl|CDD|221363 pfam11992, DUF3488, Domain of unknown function (DUF3488) Back     alignment and domain information
>gnl|CDD|221363 pfam11992, DUF3488, Domain of unknown function (DUF3488) Back     alignment and domain information
>gnl|CDD|221363 pfam11992, DUF3488, Domain of unknown function (DUF3488) Back     alignment and domain information
>gnl|CDD|221363 pfam11992, DUF3488, Domain of unknown function (DUF3488) Back     alignment and domain information
>gnl|CDD|221363 pfam11992, DUF3488, Domain of unknown function (DUF3488) Back     alignment and domain information
>gnl|CDD|221363 pfam11992, DUF3488, Domain of unknown function (DUF3488) Back     alignment and domain information
>gnl|CDD|221363 pfam11992, DUF3488, Domain of unknown function (DUF3488) Back     alignment and domain information
>gnl|CDD|221363 pfam11992, DUF3488, Domain of unknown function (DUF3488) Back     alignment and domain information
>gnl|CDD|221363 pfam11992, DUF3488, Domain of unknown function (DUF3488) Back     alignment and domain information
>gnl|CDD|221363 pfam11992, DUF3488, Domain of unknown function (DUF3488) Back     alignment and domain information
>gnl|CDD|221363 pfam11992, DUF3488, Domain of unknown function (DUF3488) Back     alignment and domain information
>gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>gnl|CDD|225451 COG2898, COG2898, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|225451 COG2898, COG2898, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|225451 COG2898, COG2898, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|225451 COG2898, COG2898, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|235787 PRK06370, PRK06370, mercuric reductase; Validated Back     alignment and domain information
>gnl|CDD|227621 COG5305, COG5305, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|225153 COG2244, RfbX, Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only] Back     alignment and domain information
>gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|223961 COG1030, NfeD, Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>gnl|CDD|217721 pfam03772, Competence, Competence protein Back     alignment and domain information
>gnl|CDD|217721 pfam03772, Competence, Competence protein Back     alignment and domain information
>gnl|CDD|217721 pfam03772, Competence, Competence protein Back     alignment and domain information
>gnl|CDD|217721 pfam03772, Competence, Competence protein Back     alignment and domain information
>gnl|CDD|225451 COG2898, COG2898, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|225451 COG2898, COG2898, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227621 COG5305, COG5305, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|222635 pfam14264, Glucos_trans_II, Glucosyl transferase GtrII Back     alignment and domain information
>gnl|CDD|222635 pfam14264, Glucos_trans_II, Glucosyl transferase GtrII Back     alignment and domain information
>gnl|CDD|222635 pfam14264, Glucos_trans_II, Glucosyl transferase GtrII Back     alignment and domain information
>gnl|CDD|222635 pfam14264, Glucos_trans_II, Glucosyl transferase GtrII Back     alignment and domain information
>gnl|CDD|222635 pfam14264, Glucos_trans_II, Glucosyl transferase GtrII Back     alignment and domain information
>gnl|CDD|222635 pfam14264, Glucos_trans_II, Glucosyl transferase GtrII Back     alignment and domain information
>gnl|CDD|222635 pfam14264, Glucos_trans_II, Glucosyl transferase GtrII Back     alignment and domain information
>gnl|CDD|222635 pfam14264, Glucos_trans_II, Glucosyl transferase GtrII Back     alignment and domain information
>gnl|CDD|222635 pfam14264, Glucos_trans_II, Glucosyl transferase GtrII Back     alignment and domain information
>gnl|CDD|226828 COG4393, COG4393, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|224295 COG1377, FlhB, Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|224295 COG1377, FlhB, Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|224295 COG1377, FlhB, Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|224295 COG1377, FlhB, Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|224295 COG1377, FlhB, Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|225803 COG3264, COG3264, Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|226122 COG3594, NolL, Fucose 4-O-acetylase and related acetyltransferases [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|217721 pfam03772, Competence, Competence protein Back     alignment and domain information
>gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|234350 TIGR03766, TIGR03766, conserved hypothetical integral membrane protein Back     alignment and domain information
>gnl|CDD|234350 TIGR03766, TIGR03766, conserved hypothetical integral membrane protein Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|217678 pfam03699, UPF0182, Uncharacterized protein family (UPF0182) Back     alignment and domain information
>gnl|CDD|216682 pfam01757, Acyl_transf_3, Acyltransferase family Back     alignment and domain information
>gnl|CDD|222703 pfam14351, DUF4401, Domain of unknown function (DUF4401) Back     alignment and domain information
>gnl|CDD|222703 pfam14351, DUF4401, Domain of unknown function (DUF4401) Back     alignment and domain information
>gnl|CDD|223731 COG0658, ComEC, Predicted membrane metal-binding protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|234350 TIGR03766, TIGR03766, conserved hypothetical integral membrane protein Back     alignment and domain information
>gnl|CDD|234721 PRK00302, lnt, apolipoprotein N-acyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|223605 COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|226122 COG3594, NolL, Fucose 4-O-acetylase and related acetyltransferases [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|225451 COG2898, COG2898, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|216682 pfam01757, Acyl_transf_3, Acyltransferase family Back     alignment and domain information
>gnl|CDD|216682 pfam01757, Acyl_transf_3, Acyltransferase family Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|214444 MTH00165, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|214444 MTH00165, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|214444 MTH00165, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|214444 MTH00165, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|214444 MTH00165, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|214444 MTH00165, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|214444 MTH00165, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|214444 MTH00165, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|214444 MTH00165, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|214444 MTH00165, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|214444 MTH00165, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|214444 MTH00165, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|223800 COG0728, MviN, Uncharacterized membrane protein, putative virulence factor [General function prediction only] Back     alignment and domain information
>gnl|CDD|177157 MTH00094, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|177157 MTH00094, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|177157 MTH00094, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|177157 MTH00094, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|177157 MTH00094, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|177157 MTH00094, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|214442 MTH00160, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|234350 TIGR03766, TIGR03766, conserved hypothetical integral membrane protein Back     alignment and domain information
>gnl|CDD|234350 TIGR03766, TIGR03766, conserved hypothetical integral membrane protein Back     alignment and domain information
>gnl|CDD|234350 TIGR03766, TIGR03766, conserved hypothetical integral membrane protein Back     alignment and domain information
>gnl|CDD|234350 TIGR03766, TIGR03766, conserved hypothetical integral membrane protein Back     alignment and domain information
>gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>gnl|CDD|225451 COG2898, COG2898, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|217785 pfam03901, Glyco_transf_22, Alg9-like mannosyltransferase family Back     alignment and domain information
>gnl|CDD|217785 pfam03901, Glyco_transf_22, Alg9-like mannosyltransferase family Back     alignment and domain information
>gnl|CDD|217785 pfam03901, Glyco_transf_22, Alg9-like mannosyltransferase family Back     alignment and domain information
>gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|227621 COG5305, COG5305, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|224295 COG1377, FlhB, Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|224295 COG1377, FlhB, Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|224295 COG1377, FlhB, Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|224295 COG1377, FlhB, Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|224295 COG1377, FlhB, Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|224295 COG1377, FlhB, Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|224295 COG1377, FlhB, Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|224295 COG1377, FlhB, Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|218818 pfam05940, NnrS, NnrS protein Back     alignment and domain information
>gnl|CDD|226999 COG4652, COG4652, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|226999 COG4652, COG4652, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|226999 COG4652, COG4652, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|226999 COG4652, COG4652, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|226999 COG4652, COG4652, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|226999 COG4652, COG4652, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|226999 COG4652, COG4652, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|223469 COG0392, COG0392, Predicted integral membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|233016 TIGR00546, lnt, apolipoprotein N-acyltransferase Back     alignment and domain information
>gnl|CDD|224011 COG1086, COG1086, Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|224748 COG1835, COG1835, Predicted acyltransferases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|227317 COG4984, COG4984, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] Back     alignment and domain information
>gnl|CDD|223425 COG0348, NapH, Polyferredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|223425 COG0348, NapH, Polyferredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|223425 COG0348, NapH, Polyferredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|233511 TIGR01654, bact_immun_7tm, bacteriocin-associated integral membrane (putative immunity) protein Back     alignment and domain information
>gnl|CDD|233511 TIGR01654, bact_immun_7tm, bacteriocin-associated integral membrane (putative immunity) protein Back     alignment and domain information
>gnl|CDD|233511 TIGR01654, bact_immun_7tm, bacteriocin-associated integral membrane (putative immunity) protein Back     alignment and domain information
>gnl|CDD|224295 COG1377, FlhB, Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|223800 COG0728, MviN, Uncharacterized membrane protein, putative virulence factor [General function prediction only] Back     alignment and domain information
>gnl|CDD|223800 COG0728, MviN, Uncharacterized membrane protein, putative virulence factor [General function prediction only] Back     alignment and domain information
>gnl|CDD|223800 COG0728, MviN, Uncharacterized membrane protein, putative virulence factor [General function prediction only] Back     alignment and domain information
>gnl|CDD|223800 COG0728, MviN, Uncharacterized membrane protein, putative virulence factor [General function prediction only] Back     alignment and domain information
>gnl|CDD|223800 COG0728, MviN, Uncharacterized membrane protein, putative virulence factor [General function prediction only] Back     alignment and domain information
>gnl|CDD|218818 pfam05940, NnrS, NnrS protein Back     alignment and domain information
>gnl|CDD|223648 COG0575, CdsA, CDP-diglyceride synthetase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|223648 COG0575, CdsA, CDP-diglyceride synthetase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|223648 COG0575, CdsA, CDP-diglyceride synthetase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|223648 COG0575, CdsA, CDP-diglyceride synthetase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|223648 COG0575, CdsA, CDP-diglyceride synthetase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|223648 COG0575, CdsA, CDP-diglyceride synthetase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|223648 COG0575, CdsA, CDP-diglyceride synthetase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|223648 COG0575, CdsA, CDP-diglyceride synthetase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|223648 COG0575, CdsA, CDP-diglyceride synthetase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|223648 COG0575, CdsA, CDP-diglyceride synthetase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|223648 COG0575, CdsA, CDP-diglyceride synthetase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|223648 COG0575, CdsA, CDP-diglyceride synthetase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|223648 COG0575, CdsA, CDP-diglyceride synthetase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|223648 COG0575, CdsA, CDP-diglyceride synthetase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|235569 PRK05702, flhB, flagellar biosynthesis protein FlhB; Reviewed Back     alignment and domain information
>gnl|CDD|235569 PRK05702, flhB, flagellar biosynthesis protein FlhB; Reviewed Back     alignment and domain information
>gnl|CDD|235569 PRK05702, flhB, flagellar biosynthesis protein FlhB; Reviewed Back     alignment and domain information
>gnl|CDD|235569 PRK05702, flhB, flagellar biosynthesis protein FlhB; Reviewed Back     alignment and domain information
>gnl|CDD|226365 COG3846, TrbL, Type IV secretory pathway, TrbL components [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) Back     alignment and domain information
>gnl|CDD|177154 MTH00091, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|234350 TIGR03766, TIGR03766, conserved hypothetical integral membrane protein Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|224011 COG1086, COG1086, Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|235569 PRK05702, flhB, flagellar biosynthesis protein FlhB; Reviewed Back     alignment and domain information
>gnl|CDD|235569 PRK05702, flhB, flagellar biosynthesis protein FlhB; Reviewed Back     alignment and domain information
>gnl|CDD|235569 PRK05702, flhB, flagellar biosynthesis protein FlhB; Reviewed Back     alignment and domain information
>gnl|CDD|235569 PRK05702, flhB, flagellar biosynthesis protein FlhB; Reviewed Back     alignment and domain information
>gnl|CDD|220468 pfam09913, DUF2142, Predicted membrane protein (DUF2142) Back     alignment and domain information
>gnl|CDD|237042 PRK12291, PRK12291, apolipoprotein N-acyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|237042 PRK12291, PRK12291, apolipoprotein N-acyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|237042 PRK12291, PRK12291, apolipoprotein N-acyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|219152 pfam06728, PIG-U, GPI transamidase subunit PIG-U Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1381
KOG1238|consensus623 100.0
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 100.0
PRK02106560 choline dehydrogenase; Validated 100.0
PLN02785587 Protein HOTHEAD 100.0
COG2303542 BetA Choline dehydrogenase and related flavoprotei 100.0
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 100.0
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 100.0
PF05199144 GMC_oxred_C: GMC oxidoreductase; InterPro: IPR0078 100.0
PRK07121492 hypothetical protein; Validated 99.29
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 99.21
PRK08274466 tricarballylate dehydrogenase; Validated 99.21
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.21
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 99.12
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.11
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.09
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 99.06
PRK06175433 L-aspartate oxidase; Provisional 99.01
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 99.0
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 98.99
PRK06854608 adenylylsulfate reductase subunit alpha; Validated 98.96
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.95
PRK12842574 putative succinate dehydrogenase; Reviewed 98.94
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 98.93
PRK08275554 putative oxidoreductase; Provisional 98.93
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 98.93
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 98.89
PTZ003061167 NADH-dependent fumarate reductase; Provisional 98.89
PRK05257494 malate:quinone oxidoreductase; Validated 98.89
PLN00128635 Succinate dehydrogenase [ubiquinone] flavoprotein 98.87
PRK12839572 hypothetical protein; Provisional 98.86
PRK06481506 fumarate reductase flavoprotein subunit; Validated 98.86
COG0579429 Predicted dehydrogenase [General function predicti 98.85
PRK07395553 L-aspartate oxidase; Provisional 98.84
PTZ00139617 Succinate dehydrogenase [ubiquinone] flavoprotein 98.83
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 98.83
PRK08958588 sdhA succinate dehydrogenase flavoprotein subunit; 98.82
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 98.82
PRK07804541 L-aspartate oxidase; Provisional 98.81
PRK07573640 sdhA succinate dehydrogenase flavoprotein subunit; 98.81
PRK09078598 sdhA succinate dehydrogenase flavoprotein subunit; 98.81
PRK08641589 sdhA succinate dehydrogenase flavoprotein subunit; 98.8
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 98.79
PRK08071510 L-aspartate oxidase; Provisional 98.79
TIGR01812566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 98.79
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 98.78
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; 98.78
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 98.76
PRK09077536 L-aspartate oxidase; Provisional 98.76
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 98.75
PRK07057591 sdhA succinate dehydrogenase flavoprotein subunit; 98.74
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 98.74
PRK09231582 fumarate reductase flavoprotein subunit; Validated 98.74
PLN02815594 L-aspartate oxidase 98.73
PRK08205583 sdhA succinate dehydrogenase flavoprotein subunit; 98.73
PTZ00383497 malate:quinone oxidoreductase; Provisional 98.72
PRK11728393 hydroxyglutarate oxidase; Provisional 98.72
TIGR01176580 fum_red_Fp fumarate reductase, flavoprotein subuni 98.72
PRK06069577 sdhA succinate dehydrogenase flavoprotein subunit; 98.69
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 98.69
PRK08626657 fumarate reductase flavoprotein subunit; Provision 98.69
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 98.68
PRK07512513 L-aspartate oxidase; Provisional 98.67
PRK13339497 malate:quinone oxidoreductase; Reviewed 98.66
PRK10157428 putative oxidoreductase FixC; Provisional 98.65
PLN02464627 glycerol-3-phosphate dehydrogenase 98.64
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 98.63
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 98.62
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 98.62
PLN02661357 Putative thiazole synthesis 98.62
TIGR01811603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 98.62
PRK07803626 sdhA succinate dehydrogenase flavoprotein subunit; 98.61
TIGR02061614 aprA adenosine phosphosulphate reductase, alpha su 98.6
PRK11259376 solA N-methyltryptophan oxidase; Provisional 98.59
PRK13977576 myosin-cross-reactive antigen; Provisional 98.58
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 98.55
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, f 98.54
KOG1298|consensus509 98.53
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 98.52
COG2081408 Predicted flavoproteins [General function predicti 98.5
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 98.47
PRK10015429 oxidoreductase; Provisional 98.46
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 98.45
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.45
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.39
PRK06185407 hypothetical protein; Provisional 98.37
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 98.36
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 98.34
PRK08401466 L-aspartate oxidase; Provisional 98.33
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.33
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 98.33
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.32
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 98.32
COG3573552 Predicted oxidoreductase [General function predict 98.27
TIGR02730493 carot_isom carotene isomerase. Members of this fam 98.26
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 98.25
PLN02985514 squalene monooxygenase 98.24
PRK05192618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.2
PRK07208479 hypothetical protein; Provisional 98.19
COG1233487 Phytoene dehydrogenase and related proteins [Secon 98.17
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 98.17
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 98.16
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 98.15
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 98.08
KOG2404|consensus477 98.07
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 98.01
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 98.0
PRK06126545 hypothetical protein; Provisional 98.0
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.0
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 97.98
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 97.97
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 97.97
TIGR00275400 flavoprotein, HI0933 family. The model when search 97.91
PRK07233434 hypothetical protein; Provisional 97.91
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 97.9
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 97.87
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 97.85
TIGR01372985 soxA sarcosine oxidase, alpha subunit family, hete 97.81
PLN02612567 phytoene desaturase 97.79
PRK08244493 hypothetical protein; Provisional 97.78
KOG4254|consensus561 97.77
PLN02172461 flavin-containing monooxygenase FMO GS-OX 97.77
PRK11445351 putative oxidoreductase; Provisional 97.76
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 97.76
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 97.76
PF01134392 GIDA: Glucose inhibited division protein A; InterP 97.74
PLN02487569 zeta-carotene desaturase 97.71
TIGR00136617 gidA glucose-inhibited division protein A. GidA, t 97.69
KOG0042|consensus680 97.69
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 97.64
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 97.63
PRK10262321 thioredoxin reductase; Provisional 97.53
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 97.51
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 97.47
KOG2415|consensus621 97.46
PRK07538413 hypothetical protein; Provisional 97.44
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 97.43
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 97.42
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 97.4
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 97.39
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 97.39
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 97.38
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 97.37
TIGR03377516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 97.34
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 97.31
KOG2665|consensus453 97.3
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 97.28
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 97.26
PRK09564444 coenzyme A disulfide reductase; Reviewed 97.25
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 97.24
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 97.22
COG0445621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 97.2
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 97.17
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 97.16
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 97.15
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 97.13
PTZ00318424 NADH dehydrogenase-like protein; Provisional 97.11
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.11
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 97.09
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 97.09
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 97.08
PLN02463447 lycopene beta cyclase 97.07
PRK065671028 putative bifunctional glutamate synthase subunit b 97.06
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 97.04
PRK09126392 hypothetical protein; Provisional 97.03
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.02
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 97.01
PRK06116450 glutathione reductase; Validated 97.0
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 96.99
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 96.98
KOG3851|consensus446 96.98
PRK06370463 mercuric reductase; Validated 96.98
PTZ00058561 glutathione reductase; Provisional 96.97
PRK06996398 hypothetical protein; Provisional 96.97
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 96.97
PRK08013400 oxidoreductase; Provisional 96.96
PRK07045388 putative monooxygenase; Reviewed 96.96
PLN02529738 lysine-specific histone demethylase 1 96.95
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 96.95
PRK05675570 sdhA succinate dehydrogenase flavoprotein subunit; 96.94
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 96.94
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 96.92
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 96.91
PRK05976472 dihydrolipoamide dehydrogenase; Validated 96.91
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 96.9
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 96.88
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 96.88
KOG2820|consensus399 96.88
PRK14694468 putative mercuric reductase; Provisional 96.87
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 96.87
PRK08132547 FAD-dependent oxidoreductase; Provisional 96.85
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 96.85
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 96.84
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 96.82
KOG1399|consensus448 96.8
PLN02697529 lycopene epsilon cyclase 96.79
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 96.79
PRK06292460 dihydrolipoamide dehydrogenase; Validated 96.75
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 96.75
TIGR02053463 MerA mercuric reductase. This model represents the 96.74
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 96.74
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 96.73
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 96.72
KOG0685|consensus498 96.72
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 96.71
PRK13748561 putative mercuric reductase; Provisional 96.7
PRK07190487 hypothetical protein; Provisional 96.69
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 96.66
PTZ00367567 squalene epoxidase; Provisional 96.64
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 96.63
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 96.59
PRK09897534 hypothetical protein; Provisional 96.57
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 96.56
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 96.56
KOG2311|consensus679 96.53
PRK06327475 dihydrolipoamide dehydrogenase; Validated 96.52
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 96.52
PLN02507499 glutathione reductase 96.5
PRK06184502 hypothetical protein; Provisional 96.47
PRK06847375 hypothetical protein; Provisional 96.46
PLN02546558 glutathione reductase 96.46
KOG2852|consensus380 96.46
PRK07588391 hypothetical protein; Provisional 96.4
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 96.4
KOG2853|consensus509 96.39
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 96.39
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 96.38
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 96.37
PRK06753373 hypothetical protein; Provisional 96.37
PRK06834488 hypothetical protein; Provisional 96.36
PTZ00052499 thioredoxin reductase; Provisional 96.34
KOG0029|consensus501 96.28
PRK08294634 phenol 2-monooxygenase; Provisional 96.24
PLN02576496 protoporphyrinogen oxidase 96.24
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 96.24
PRK07236386 hypothetical protein; Provisional 96.23
PRK14989847 nitrite reductase subunit NirD; Provisional 96.22
PRK11883451 protoporphyrinogen oxidase; Reviewed 96.2
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 96.17
PTZ00153659 lipoamide dehydrogenase; Provisional 96.12
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 96.11
PRK14727479 putative mercuric reductase; Provisional 96.1
PRK08163396 salicylate hydroxylase; Provisional 96.03
PLN02268435 probable polyamine oxidase 96.02
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 96.02
KOG3855|consensus481 95.93
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 95.79
TIGR02374785 nitri_red_nirB nitrite reductase [NAD(P)H], large 95.65
COG2907447 Predicted NAD/FAD-binding protein [General functio 95.63
PRK05868372 hypothetical protein; Validated 95.58
PRK07846451 mycothione reductase; Reviewed 95.47
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 95.43
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 95.42
PRK12416463 protoporphyrinogen oxidase; Provisional 95.37
PLN02676487 polyamine oxidase 95.36
PLN02568539 polyamine oxidase 95.35
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 95.3
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 95.27
KOG2844|consensus856 95.16
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 95.07
TIGR01816565 sdhA_forward succinate dehydrogenase, flavoprotein 95.06
KOG2960|consensus328 95.02
PLN02927668 antheraxanthin epoxidase/zeaxanthin epoxidase 94.89
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 94.86
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 94.85
KOG0405|consensus478 94.81
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 94.75
PRK06475400 salicylate hydroxylase; Provisional 94.74
COG1231450 Monoamine oxidase [Amino acid transport and metabo 94.73
PRK12831464 putative oxidoreductase; Provisional 94.68
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 94.53
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 94.14
PRK07845466 flavoprotein disulfide reductase; Reviewed 93.83
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 93.67
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 93.57
PLN02852491 ferredoxin-NADP+ reductase 93.5
PRK08255765 salicylyl-CoA 5-hydroxylase; Reviewed 93.3
PRK12814652 putative NADPH-dependent glutamate synthase small 93.09
PRK098531019 putative selenate reductase subunit YgfK; Provisio 93.02
PRK12770352 putative glutamate synthase subunit beta; Provisio 92.93
PRK12779944 putative bifunctional glutamate synthase subunit b 92.75
PLN02328808 lysine-specific histone demethylase 1 homolog 92.62
PLN03000881 amine oxidase 92.6
COG3349485 Uncharacterized conserved protein [Function unknow 92.49
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 92.24
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 92.2
KOG2614|consensus420 91.86
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 91.76
PRK13512438 coenzyme A disulfide reductase; Provisional 91.69
KOG4716|consensus503 91.68
PLN029761713 amine oxidase 91.63
PTZ00188506 adrenodoxin reductase; Provisional 91.22
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 91.19
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 91.03
PRK13984604 putative oxidoreductase; Provisional 90.24
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 89.38
KOG2403|consensus642 89.21
KOG1335|consensus506 87.98
PRK12771564 putative glutamate synthase (NADPH) small subunit; 87.81
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 87.12
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 86.89
COG0569225 TrkA K+ transport systems, NAD-binding component [ 86.8
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 86.54
KOG1276|consensus491 84.64
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 83.83
COG5044434 MRS6 RAB proteins geranylgeranyltransferase compon 82.44
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 82.33
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 82.17
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 81.31
KOG1439|consensus440 80.41
KOG2755|consensus334 80.37
>KOG1238|consensus Back     alignment and domain information
Probab=100.00  E-value=1.9e-131  Score=1165.89  Aligned_cols=558  Identities=36%  Similarity=0.549  Sum_probs=499.4

Q ss_pred             cCCCCCCcccC--CCCcccEEEECCCchHHHHHHHHhccCCCeEEEEeccCCCCCccccCCccccccCCcccCccccccc
Q psy11618        148 IYPPDMTPYVK--SGDCFDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTPIHSRIPGMSSVLSLSEFDHAYLAEPS  225 (1381)
Q Consensus       148 ~~p~~~~~~~~--~~~~YDYIIVGGGTAG~VLAsRLSEdpg~sVLVLEAG~d~~~~~~iP~~~~~l~~s~~DW~Y~TePq  225 (1381)
                      +...++.++..  ..++|||||||||||||++|+||||+|++|||+||||++++...++|......+.+.+||+|+|+||
T Consensus        41 ~~~~~~~~~~~~~~~~~yDyIVVGgGtAGcvlAarLSEn~~~~VLLLEaGg~~~~~~~~p~~~~~~q~s~~dw~y~t~Ps  120 (623)
T KOG1238|consen   41 DPESRPSDATGSELDSSYDYIVVGGGTAGCVLAARLSENPNWSVLLLEAGGDPPLYSDPPLLAANLQLSLYDWSYHTEPS  120 (623)
T ss_pred             CcccccccccccccccCCCEEEECCCchhHHHHHhhccCCCceEEEEecCCCCcccccchHHHHHhccccccccCcCccC
Confidence            33344444444  5678999999999999999999999999999999999999888899977778888999999999999


Q ss_pred             ccccccCCCceeecccccccCccccccceEEecCCccchHHHhhcCCCCCChhhHHHHHHHhcccccCCcccCCCCCCCC
Q psy11618        226 QFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAKLGYNGWGYDETLKYFVKSEDYRSVIYNESKAVHGTQ  305 (1381)
Q Consensus       226 ~~a~~gl~~r~i~~pRGKvLGGSSsINgmvy~RGs~~DFD~Wa~lGn~GWswedLlPYFkKsE~~~~p~~~~d~~~HG~~  305 (1381)
                      +++|+++++++|+|||||++||||++|+|+|+||+++|||+|++.||+||+|++++|||+|+|+...++.+. .++||+.
T Consensus       121 ~~ac~~m~~~~c~wpRGrVLGGsS~iN~m~Y~RG~r~Dyd~W~~~gnpgW~y~~vl~yf~k~E~~~~~~~~~-~~y~~~~  199 (623)
T KOG1238|consen  121 QHACLAMSEDRCYWPRGRVLGGSSVLNAMFYVRGNRRDYDRWAAEGNPGWSYDEVLPYFKKSEDKVVPDPEL-TPYHGAG  199 (623)
T ss_pred             hhhhhhhcCCceecCccceecccccccceEEecCCccchHHHHHhcCCCCCHHHHHHHHHHHhhccCCCccc-CcccccC
Confidence            999999999999999999999999999999999999999999999999999999999999999998877665 5699999


Q ss_pred             CCccccCCCCCCCchHHHHHHHHHHHcCCCCCCCCCCCCCCcccccCCCCCCCCcccchhhhcchhhhcCCCCeEEEcCc
Q psy11618        306 GYLPVGLFKNKENNIIREIFETSAQELGYPCPKDMNDRYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRTNLYVLKRS  385 (1381)
Q Consensus       306 GPL~Vs~~p~~e~~pl~~~f~eA~eeLG~p~~~D~N~g~~~~G~s~~~~ti~~G~RsSAa~AYL~Pa~~~R~NLtILTnA  385 (1381)
                      ||..++..+++  ++..+++.++.+|+|.+.. |+||+. +.|++..+.++++|+|+|++++|++|+...|+|+|+..++
T Consensus       200 g~~~ve~~~~~--~~~~~~~~~ag~e~G~~~~-D~nG~~-~tg~~~l~~t~~~g~R~s~~~a~l~~~~~~R~NL~~~~~~  275 (623)
T KOG1238|consen  200 GPLLVEAGVYP--NNLFTAFHRAGTEIGGSIF-DRNGER-HTGASLLQYTIRNGIRVSLAKAYLKPIRLTRPNLHISRNA  275 (623)
T ss_pred             Ccceecccccc--CchhhHhHHhHHhcCCCcc-CCCCcc-ccchhhhhccccCCEEEEehhhhhhhhhccCccccccccc
Confidence            99999998888  8999999999999996544 999999 9999999999999999999999999998349999999999


Q ss_pred             EEEEEEec-CCCeEEEEEEEecCCeEEEEecCcEEEEcCCchhhHHHHHHcCCCCCCccccCCCCcccCCc-cchhcccc
Q psy11618        386 KVTKVIIN-DQNVATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQDLR-VGENLKLN  463 (1381)
Q Consensus       386 ~VtRIlfd-~g~RAtGVE~vd~~Gr~~tV~ArKEVILSAGAI~SPqLLmlSGIGPkd~Le~lGIpVVvDLP-VGrNLQDH  463 (1381)
                      .|+||.+| .+++|+||+++++.|++++++|+|||||||||||||||||+|||||++||+++|||+++|+| ||||||||
T Consensus       276 ~vtrvl~D~~~~~a~gv~~~~~~~~~~~v~a~kEVILSAGAi~SPQLLMLSGIGP~~~L~~~gIpvv~dLP~VG~nLqDH  355 (623)
T KOG1238|consen  276 AVTRVLIDPAGKRAKGVEFVRDGGKEHTVKARKEVILSAGAINSPQLLMLSGIGPADHLKKLGIPVVLDLPGVGQNLQDH  355 (623)
T ss_pred             eEEEEEEcCCCceEEEEEEEecCceeeeecccceEEEeccccCCHHHHHHcCCCcHHHHHhcCCCeeccCcccccccccc
Confidence            99999999 78899999999833899999999999999999999999999999999999999999999999 99999999


Q ss_pred             ccCCceEEEecCCccccchhhHHHHHHhhccCCCCCCccccccccccccccccccccccccccccccccccCCCcccccc
Q psy11618        464 AQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLSNMHSYCYCLAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSA  543 (1381)
Q Consensus       464 p~v~~vvf~l~~~vs~sl~~a~a~~~Y~~nrtGPls~~~s~~~~~~~LDe~~~~~~~~l~vg~~~~~~~~~a~~~~a~~~  543 (1381)
                      +..+ +....+++++  .                                               ...+.          
T Consensus       356 ~~~~-~~~~~~~~~~--~-----------------------------------------------~~~~~----------  375 (623)
T KOG1238|consen  356 PMNP-GFVFSTNPVE--L-----------------------------------------------SLIRL----------  375 (623)
T ss_pred             cccc-eeeecCCCcc--c-----------------------------------------------ccccc----------
Confidence            9985 3333333321  0                                               00000          


Q ss_pred             cchhhhhhHHHHHHHHHcCCCCCccccccceEEEeecCCCC---CCCCeeeeeeccccccchhhhhhhhccccchhHHHH
Q psy11618        544 PLKRTVYSQEMVFKYLVNRIGPLSNAGLWSFTGYIDTLQNT---ARPDLEIHLLYFQQNDIRNMCKIKRAYDFNDEVQTA  620 (1381)
Q Consensus       544 pl~~tv~s~~~~~eYl~~~sGPLss~g~~e~~gFl~S~~~~---~~PDIq~~~~p~s~~~~d~~~~vk~~~g~~~~~~~~  620 (1381)
                            .......+|+..++||.++.+ .+..+|.+++.+.   ++||+|.++.+.+. ..+.....++..+   +++++
T Consensus       376 ------~~~~~~~~yl~~~~G~~~~~~-~e~~~f~~t~~~~~~~~~PD~~~~~~~~~~-~~~~~~~~~~~~~---~~y~~  444 (623)
T KOG1238|consen  376 ------VGITTVGQYLEGGSGPLASPG-VETLGFINTVSSNLSLDWPDIELHFVAGSL-SSDGLTALRKALG---EIYQA  444 (623)
T ss_pred             ------ccchHHHHHHHcCCCCcccCc-ceeeEEeccccccCcCCCCCeeEEeccccc-cccchhhhhhhcc---hHHHH
Confidence                  013456789999999999877 7889999887654   89999988877665 3344444554444   66777


Q ss_pred             HhccCCCCCeEEEEEeecccCcCcEEEeecCCCCCCccccCCCCCChhhHHHHHHHHHHHHHHhcCHHHHHhcccccccC
Q psy11618        621 YVNLNKRTDMGVISMSLVNPKSCGKVTLKSADPLAPPCIDTGILSEPEDLATLIRGTDYITRLEQTEAIRLAGGTLMSLN  700 (1381)
Q Consensus       621 ~~~p~~~~~~~tI~v~Ll~P~SRGsV~L~SsDP~d~PvIDpNYLSdP~Dle~LveGVR~arrIl~Tp~Lk~~g~~e~~~p  700 (1381)
                      .+.+..+++.+.+...+++|+|||+++|+|+||.++|.|++||++||+|+++++||+|.+.|+.+|++|++++++++.++
T Consensus       445 ~~~~~~~~~~~~i~~~~l~P~SrG~l~L~s~nP~~~P~I~~NY~~~p~Dv~~~vegi~~~~~l~~s~af~~~~~r~~~~~  524 (623)
T KOG1238|consen  445 LFGELTNSDSFVIFPKLLRPKSRGRLKLRSTNPRDNPLITPNYFTHPEDVATLVEGIRTIIRLSNSKAFQRFGARLWKKP  524 (623)
T ss_pred             hhhhhhcCceeEEeehhcCCCccceEEecCCCCCcCceeccCcCCCHHHHHHHHHHHHHHHHHHcCHHHHHhcchhcccc
Confidence            66666666778999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CccCCCCCCCCchhHHHHHhcccCCCcccccCccccCCCCCCcccCCCCeEeCcCCcEEecccCCCCCCCCCchHHHHHH
Q psy11618        701 LEACSQYPWRSTHSWTCYIRHLTTTTSNPVGTVMMGNADDPNAVVTPDLKVKGIKGLRVADISVLPNAIITQSDAISFLL  780 (1381)
Q Consensus       701 lPg~~~~~~~SDEeIe~yIR~~a~T~yHPvGTCRMGP~dDp~GVVDs~LRVhGVdNLRVVDASVfPtiPSgNpqApVyMI  780 (1381)
                      .|+|+.....||++|+|++|+.+.|.|||+|||||||+.||++|||+|+|||||+|||||||||||.+|++|||||||||
T Consensus       525 ~~~c~~~~~~sd~yw~c~~R~~~~TiyH~~GtckMGp~~D~~aVVD~~lrV~Gv~~LRVVDaSimP~~psgN~nA~v~MI  604 (623)
T KOG1238|consen  525 VPGCDLLAFLSDAYWECFCRHTVVTIYHYSGTCKMGPSSDPTAVVDPQLRVHGVRGLRVVDASIMPESPSGNPNAPVMMI  604 (623)
T ss_pred             CCCcccccCCCHHHHHHHHHhccceeeccCCceEeCCccCCCcccCCcceeccccCceEeeccccCCCCCCCccHHHHHH
Confidence            99999888999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             H
Q psy11618        781 L  781 (1381)
Q Consensus       781 A  781 (1381)
                      |
T Consensus       605 g  605 (623)
T KOG1238|consen  605 G  605 (623)
T ss_pred             H
Confidence            8



>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PF05199 GMC_oxred_C: GMC oxidoreductase; InterPro: IPR007867 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>KOG1298|consensus Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>KOG2404|consensus Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>KOG4254|consensus Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>KOG2415|consensus Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>KOG2665|consensus Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>KOG3851|consensus Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>KOG2820|consensus Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>KOG0685|consensus Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>KOG2311|consensus Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>KOG2852|consensus Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>KOG2853|consensus Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>KOG3855|consensus Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>KOG2844|consensus Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>KOG2960|consensus Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0405|consensus Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>KOG2614|consensus Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>KOG4716|consensus Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>KOG2403|consensus Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>KOG1276|consensus Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>KOG1439|consensus Back     alignment and domain information
>KOG2755|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1381
3q9t_A577 Crystal Structure Analysis Of Formate Oxidase Lengt 6e-26
3t37_A526 Crystal Structure Of Pyridoxine 4-Oxidase From Meso 5e-24
3fim_B566 Crystal Structure Of Aryl-Alcohol-Oxidase From Pleu 4e-23
3fim_B566 Crystal Structure Of Aryl-Alcohol-Oxidase From Pleu 5e-08
1gpe_A587 Glucose Oxidase From Penicillium Amagasakiense Leng 3e-20
1cf3_A583 Glucose Oxidase From Apergillus Niger Length = 583 7e-20
2jbv_A546 Crystal Structure Of Choline Oxidase Reveals Insigh 2e-17
2jbv_A546 Crystal Structure Of Choline Oxidase Reveals Insigh 8e-11
3ljp_A546 Crystal Structure Of Choline Oxidase V464a Mutant L 3e-17
3ljp_A546 Crystal Structure Of Choline Oxidase V464a Mutant L 8e-11
3nne_A546 Crystal Structure Of Choline Oxidase S101a Mutant L 4e-17
3nne_A546 Crystal Structure Of Choline Oxidase S101a Mutant L 8e-11
1ju2_A536 Crystal Structure Of The Hydroxynitrile Lyase From 3e-11
3gdn_A521 Almond Hydroxynitrile Lyase In Complex With Benzald 3e-11
3red_A521 3.0 A Structure Of The Prunus Mume Hydroxynitrile L 6e-11
1naa_A541 Cellobiose Dehydrogenase Flavoprotein Fragment In C 1e-04
1kdg_A546 Crystal Structure Of The Flavin Domain Of Cellobios 2e-04
>pdb|3Q9T|A Chain A, Crystal Structure Analysis Of Formate Oxidase Length = 577 Back     alignment and structure

Iteration: 1

Score = 117 bits (292), Expect = 6e-26, Method: Compositional matrix adjust. Identities = 162/639 (25%), Positives = 251/639 (39%), Gaps = 127/639 (19%) Query: 160 GDCFDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTPIHSRIPGM---SSVLSL--S 214 G FD +IVG AG +A RL+E ++ VL++EAG P IP + SS + L S Sbjct: 4 GSHFDFVIVGGGTAGNTVAGRLAENPNVTVLIVEAGIGNP--EDIPEITTPSSAMDLRNS 61 Query: 215 EFDHAY---LAEPSQFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAKLG 271 ++D AY + + + N R GK LGGSS++ + G ++ + + G Sbjct: 62 KYDWAYKTTMVRRDDYERIEKPNTR-----GKTLGGSSSLNYFTWVPGHKATFDQWEEFG 116 Query: 272 YNGWGYDETLKYFVKSEDYRS--VIYNESKAVHGTQGYLPVGLFK-NKENNIIREIFETS 328 W +D + Y KS Y +Y+ G G +P+ + E RE + Sbjct: 117 GKEWTWDPLVPYLRKSATYHDDPRLYSPELEKIGGGGPIPISHAELIDEMAPFRENLTKA 176 Query: 329 AQELGYPCPKDMNDRYVDVGFAELPGMTRYG---LRFSAADAYLTPIAGKRTNLYVLKRS 385 + +G P +++ D E+ G+T R + ++L + N+ ++ Sbjct: 177 WKSMGQPLIENIYD-------GEMDGLTHCCDTIYRGQRSGSFL--FVKNKPNITIVPEV 227 Query: 386 KVTKVIINDQN-VATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLD 444 ++IIN+ + GV V + G + A++EVIL+ G +LL+LSGIGP L Sbjct: 228 HSKRLIINEADRTCKGVTVVTAAGNELNFFADREVILSQGVFETPKLLMLSGIGPTRELS 287 Query: 445 EVKIPVKQDLR-VGEN----------LKLNAQF-TGPVMAFSAPLKRTVYSQEMVFKYLV 492 I D R VG+N L++ F V+ P + V S Y Sbjct: 288 RHGINTIVDSRHVGQNLMDHPGVPFVLRVKDGFGMDDVLLRHGPKRDAVVSA-----YNK 342 Query: 493 NRIGPLSNMHSYCYCLAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSAPLKRTVYSQ 552 NR GP+ + L+ V P R+ + L+ +A++ Sbjct: 343 NRSGPVGS--------GLLELVGFP-----RIDKYLEKDAEY------------------ 371 Query: 553 EMVFKYLVNRIGPLSNAGLWSFTGYIDTLQNTARPDLEIHLLYFQQNDIRNMCKIKRAYD 612 R +N G D +P E+ + C A+ Sbjct: 372 ---------RKAKAANGGK-------DPFSPLGQPHFELDFV----------CMFGTAFQ 405 Query: 613 FNDEVQTAYVNLNKRTDMGVISMSLVNPKS-CGKVTLKSADPLAPPCIDTGILSEPEDLA 671 + + K D + + LV P S G+VTL SADP P I+ + D+ Sbjct: 406 W-------HFPTPKTGDHLTVVVDLVRPISDPGEVTLNSADPFQQPNINLNFFANDLDII 458 Query: 672 TLIRGTDYITRLEQTEAIRLAGGTLMSLNLEACSQYPWR----STHSWTCYIRHLTTTTS 727 + G + L L G +E S+YPW S + T Sbjct: 459 AMREGIRFSYDL-------LFKGEGFKDLVE--SEYPWEMPLDSDKEMHRAVLDRCQTAF 509 Query: 728 NPVGTVMMGNADDPNAVVTPDLKVKGIKGLRVADISVLP 766 +P GT + D VV P LKV GIK LRVAD SV+P Sbjct: 510 HPTGTARLSKNID-QGVVDPKLKVHGIKKLRVADASVIP 547
>pdb|3T37|A Chain A, Crystal Structure Of Pyridoxine 4-Oxidase From Mesorbium Loti Length = 526 Back     alignment and structure
>pdb|3FIM|B Chain B, Crystal Structure Of Aryl-Alcohol-Oxidase From Pleurotus Eryingii Length = 566 Back     alignment and structure
>pdb|3FIM|B Chain B, Crystal Structure Of Aryl-Alcohol-Oxidase From Pleurotus Eryingii Length = 566 Back     alignment and structure
>pdb|1GPE|A Chain A, Glucose Oxidase From Penicillium Amagasakiense Length = 587 Back     alignment and structure
>pdb|1CF3|A Chain A, Glucose Oxidase From Apergillus Niger Length = 583 Back     alignment and structure
>pdb|2JBV|A Chain A, Crystal Structure Of Choline Oxidase Reveals Insights Into The Catalytic Mechanism Length = 546 Back     alignment and structure
>pdb|2JBV|A Chain A, Crystal Structure Of Choline Oxidase Reveals Insights Into The Catalytic Mechanism Length = 546 Back     alignment and structure
>pdb|3LJP|A Chain A, Crystal Structure Of Choline Oxidase V464a Mutant Length = 546 Back     alignment and structure
>pdb|3LJP|A Chain A, Crystal Structure Of Choline Oxidase V464a Mutant Length = 546 Back     alignment and structure
>pdb|3NNE|A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant Length = 546 Back     alignment and structure
>pdb|3NNE|A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant Length = 546 Back     alignment and structure
>pdb|1JU2|A Chain A, Crystal Structure Of The Hydroxynitrile Lyase From Almond Length = 536 Back     alignment and structure
>pdb|3GDN|A Chain A, Almond Hydroxynitrile Lyase In Complex With Benzaldehyde Length = 521 Back     alignment and structure
>pdb|3RED|A Chain A, 3.0 A Structure Of The Prunus Mume Hydroxynitrile Lyase Isozyme-1 Length = 521 Back     alignment and structure
>pdb|1NAA|A Chain A, Cellobiose Dehydrogenase Flavoprotein Fragment In Complex With Cellobionolactam Length = 541 Back     alignment and structure
>pdb|1KDG|A Chain A, Crystal Structure Of The Flavin Domain Of Cellobiose Dehydrogenase Length = 546 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1381
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 1e-124
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 1e-98
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 5e-40
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 5e-95
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 7e-36
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 3e-91
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 3e-41
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 1e-86
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 8e-32
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 2e-85
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 4e-31
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 1e-82
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 7e-31
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 2e-74
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 1e-28
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 6e-29
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 2e-26
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 5e-06
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 9e-24
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 3e-04
3rce_A724 Oligosaccharide transferase to N-glycosylate PROT; 1e-08
3rce_A 724 Oligosaccharide transferase to N-glycosylate PROT; 4e-05
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 9e-06
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 1e-05
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 2e-05
3b8c_A885 ATPase 2, plasma membrane-type; P-type ATPase, pro 8e-05
3b8c_A885 ATPase 2, plasma membrane-type; P-type ATPase, pro 8e-05
3b8c_A885 ATPase 2, plasma membrane-type; P-type ATPase, pro 8e-05
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 9e-05
1mhs_A920 Proton pump, plasma membrane ATPase; ION transport 1e-04
1mhs_A920 Proton pump, plasma membrane ATPase; ION transport 1e-04
1mhs_A920 Proton pump, plasma membrane ATPase; ION transport 1e-04
1mhs_A920 Proton pump, plasma membrane ATPase; ION transport 1e-04
1mhs_A920 Proton pump, plasma membrane ATPase; ION transport 1e-04
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
3ayf_A800 Nitric oxide reductase; oxidoreductase; HET: HEM B 1e-04
3ayf_A800 Nitric oxide reductase; oxidoreductase; HET: HEM B 3e-04
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 4e-04
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 6e-04
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Length = 577 Back     alignment and structure
 Score =  396 bits (1019), Expect = e-124
 Identities = 140/628 (22%), Positives = 218/628 (34%), Gaps = 102/628 (16%)

Query: 163 FDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTP-----IHSRIPGMSSVLSLSEFD 217
           FD +IVG   AG  +A RL+E  ++ VL++EAG   P     I    P  +  L  S++D
Sbjct: 7   FDFVIVGGGTAGNTVAGRLAENPNVTVLIVEAGIGNPEDIPEIT--TPSSAMDLRNSKYD 64

Query: 218 HAYLAEPSQFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAKLGYNGWGY 277
            AY                   T GK LGGSS++    +  G    ++ + + G   W +
Sbjct: 65  WAYKTTMV--RRDDYERIEKPNTRGKTLGGSSSLNYFTWVPGHKATFDQWEEFGGKEWTW 122

Query: 278 DETLKYFVKSEDYR--SVIYNESKAVHGTQGYLPVGLFKNK-ENNIIREIFETSAQELGY 334
           D  + Y  KS  Y     +Y+      G  G +P+   +   E    RE    + + +G 
Sbjct: 123 DPLVPYLRKSATYHDDPRLYSPELEKIGGGGPIPISHAELIDEMAPFRENLTKAWKSMGQ 182

Query: 335 PCPKDMNDRYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRTNLYVLKRSKVTKVIIND 394
           P  +++ D     G          G R  +           + N+ ++      ++IIN+
Sbjct: 183 PLIENIYD-GEMDGLTHCCDTIYRGQRSGSFLF-----VKNKPNITIVPEVHSKRLIINE 236

Query: 395 QN-VATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQD 453
            +    GV  V + G  +   A++EVIL+ G     +LL+LSGIGP   L    I    D
Sbjct: 237 ADRTCKGVTVVTAAGNELNFFADREVILSQGVFETPKLLMLSGIGPTRELSRHGINTIVD 296

Query: 454 LR-VGENL----KLNAQF--TGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLSNMHSYCY 506
            R VG+NL     +                L+       +V  Y  NR GP+ +      
Sbjct: 297 SRHVGQNLMDHPGVPFVLRVKDGFGMDDVLLRHGPKRDAVVSAYNKNRSGPVGSGLLE-- 354

Query: 507 CLAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPL 566
                                          ++ F           + + K    R    
Sbjct: 355 -------------------------------LVGF-------PRIDKYLEKDAEYRKAKA 376

Query: 567 SNAGLWSFTGYIDTLQNTARPDLEIHLLYFQQNDIRNMCKIKRAYDFNDEVQTAYVNLNK 626
           +N G   F+           P  + H                    F    Q  +     
Sbjct: 377 ANGGKDPFS-----------PLGQPHFELDF------------VCMFGTAFQWHFPTPKT 413

Query: 627 RTDMGVISMSLVNPKS-CGKVTLKSADPLAPPCIDTGILSEPEDLATLIRGTDYITR--L 683
              + V+   +  P S  G+VTL SADP   P I+    +   D+  +  G    +   L
Sbjct: 414 GDHLTVVVDLV-RPISDPGEVTLNSADPFQQPNINLNFFANDLDIIAMREGIR-FSYDLL 471

Query: 684 EQTEAIRLAGGTLMSLNLEACSQYPWRSTHSWTCYIRHLTTTTSNPVGTVMMGNADDPNA 743
            + E  +    +     +         S       +     T  +P GT  +   +    
Sbjct: 472 FKGEGFKDLVESEYPWEMPL------DSDKEMHRAVLDRCQTAFHPTGTARLS-KNIDQG 524

Query: 744 VVTPDLKVKGIKGLRVADISVLPNAIIT 771
           VV P LKV GIK LRVAD SV+P  I  
Sbjct: 525 VVDPKLKVHGIKKLRVADASVIPI-IPD 551


>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Length = 587 Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Length = 587 Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Length = 583 Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Length = 583 Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Length = 566 Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Length = 566 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Length = 546 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Length = 546 Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Length = 526 Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Length = 526 Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Length = 546 Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Length = 546 Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Length = 536 Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Length = 536 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Length = 623 Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Length = 504 Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Length = 504 Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Length = 507 Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Length = 507 Back     alignment and structure
>3rce_A Oligosaccharide transferase to N-glycosylate PROT; oligosaccharyltransferase, membrane protein, helical bundle, glycosylation, acceptor peptide, plasma membrane; HET: PPN; 3.40A {Campylobacter lari} Length = 724 Back     alignment and structure
>3rce_A Oligosaccharide transferase to N-glycosylate PROT; oligosaccharyltransferase, membrane protein, helical bundle, glycosylation, acceptor peptide, plasma membrane; HET: PPN; 3.40A {Campylobacter lari} Length = 724 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Length = 566 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571 Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 Back     alignment and structure
>3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} Length = 885 Back     alignment and structure
>3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} Length = 885 Back     alignment and structure
>3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} Length = 885 Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Length = 284 Back     alignment and structure
>1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Length = 920 Back     alignment and structure
>1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Length = 920 Back     alignment and structure
>1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Length = 920 Back     alignment and structure
>1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Length = 920 Back     alignment and structure
>1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Length = 920 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ayf_A Nitric oxide reductase; oxidoreductase; HET: HEM BOG EPE LOP; 2.50A {Geobacillus stearothermophilus} PDB: 3ayg_A* Length = 800 Back     alignment and structure
>3ayf_A Nitric oxide reductase; oxidoreductase; HET: HEM BOG EPE LOP; 2.50A {Geobacillus stearothermophilus} PDB: 3ayg_A* Length = 800 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Length = 510 Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Length = 399 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1381
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 100.0
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 100.0
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 100.0
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 100.0
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 100.0
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 100.0
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 100.0
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 100.0
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 100.0
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 100.0
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 100.0
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 99.55
3dme_A369 Conserved exported protein; structural genomics, P 99.12
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 99.09
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 99.09
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 99.08
2wdq_A588 Succinate dehydrogenase flavoprotein subunit; succ 98.96
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 98.96
2h88_A621 Succinate dehydrogenase flavoprotein subunit; comp 98.93
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 98.91
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 98.91
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 98.89
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 98.88
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 98.87
1jnr_A643 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.86
2bs2_A660 Quinol-fumarate reductase flavoprotein subunit A; 98.85
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 98.83
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 98.83
3gyx_A662 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.83
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 98.81
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.78
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 98.77
1pj5_A830 N,N-dimethylglycine oxidase; channelling, FAD bind 98.75
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.72
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.68
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.67
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 98.67
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 98.67
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 98.66
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 98.66
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.63
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.61
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.58
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 98.57
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 98.56
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 98.56
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 98.55
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.47
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 98.45
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 98.44
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.41
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 98.41
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 98.39
3r9u_A315 Thioredoxin reductase; structural genomics, center 98.38
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.33
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 98.31
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.29
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 98.28
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 98.26
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 98.25
3atr_A453 Conserved archaeal protein; saturating double bond 98.24
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 98.23
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.21
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.21
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 98.2
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 98.19
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 98.18
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.17
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 98.16
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 98.16
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 98.16
2gqf_A401 Hypothetical protein HI0933; structural genomics, 98.15
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 98.15
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.11
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.11
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.09
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 98.08
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 98.06
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 98.02
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.02
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 97.98
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 97.97
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 97.97
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 97.93
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 97.93
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 97.89
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 97.88
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 97.86
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 97.78
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 97.76
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 97.73
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 97.72
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 97.71
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 97.68
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 97.68
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 97.66
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 97.65
4gut_A776 Lysine-specific histone demethylase 1B; histone de 97.64
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 97.64
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 97.63
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 97.59
2gag_A965 Heterotetrameric sarcosine oxidase alpha-subunit; 97.55
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 97.54
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 97.54
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 97.53
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 97.52
4fk1_A304 Putative thioredoxin reductase; structural genomic 97.5
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 97.43
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 97.4
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 97.26
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 97.26
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 97.25
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 97.19
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 97.14
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 97.13
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 97.13
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 97.13
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 97.12
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.1
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 97.08
2cul_A232 Glucose-inhibited division protein A-related PROT 97.04
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 97.03
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 96.99
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 96.95
4dna_A463 Probable glutathione reductase; structural genomic 96.92
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 96.92
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 96.92
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 96.91
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 96.9
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 96.9
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 96.89
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 96.88
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 96.87
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 96.86
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 96.86
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 96.83
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 96.82
2ywl_A180 Thioredoxin reductase related protein; uncharacter 96.81
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 96.81
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 96.81
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 96.79
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 96.78
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 96.78
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 96.77
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 96.77
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 96.75
3ces_A651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 96.75
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 96.74
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 96.74
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 96.71
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 96.7
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 96.7
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 96.68
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 96.68
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 96.67
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 96.66
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 96.66
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 96.65
2dkh_A639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 96.65
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 96.63
3cp8_A641 TRNA uridine 5-carboxymethylaminomethyl modificati 96.63
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 96.63
2bry_A497 NEDD9 interacting protein with calponin homology a 96.63
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 96.62
2zxi_A637 TRNA uridine 5-carboxymethylaminomethyl modificat 96.62
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 96.61
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 96.6
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 96.59
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 96.58
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 96.56
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 96.55
1ojt_A482 Surface protein; redox-active center, glycolysis, 96.53
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 96.5
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 96.49
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 96.48
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 96.48
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 96.46
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 96.45
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 96.41
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 96.4
1fec_A490 Trypanothione reductase; redox-active center, oxid 96.4
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 96.38
4hb9_A412 Similarities with probable monooxygenase; flavin, 96.37
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 96.36
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 96.31
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 96.3
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 96.3
1vg0_A650 RAB proteins geranylgeranyltransferase component A 96.22
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 96.21
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 96.19
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 96.19
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 96.18
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 96.14
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 96.11
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 96.07
1pn0_A665 Phenol 2-monooxygenase; two dimers, TLS refinement 96.03
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 95.98
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 95.83
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 95.82
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 95.71
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 95.67
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 95.63
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 95.59
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 95.58
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 95.53
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 95.16
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 95.1
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 94.7
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 94.53
1gte_A1025 Dihydropyrimidine dehydrogenase; electron transfer 94.05
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 93.94
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 93.93
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 93.46
3ayj_A721 Pro-enzyme of L-phenylalanine oxidase; amino acid 92.68
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 89.05
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 87.87
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 87.8
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 86.94
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 86.54
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 85.22
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 84.88
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 84.72
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 84.54
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 83.28
1id1_A153 Putative potassium channel protein; RCK domain, E. 82.99
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 82.85
1lss_A140 TRK system potassium uptake protein TRKA homolog; 82.84
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 81.98
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 81.03
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 80.83
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 80.21
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 80.2
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 80.16
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
Probab=100.00  E-value=1.8e-118  Score=1067.26  Aligned_cols=524  Identities=27%  Similarity=0.343  Sum_probs=443.6

Q ss_pred             cccEEEECCCchHHHHHHHHhccCCCeEEEEeccCCC--CCccccCCccccccC-CcccCcccccccccccccCCCceee
Q psy11618        162 CFDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDT--PIHSRIPGMSSVLSL-SEFDHAYLAEPSQFAGLGVRNARIK  238 (1381)
Q Consensus       162 ~YDYIIVGGGTAG~VLAsRLSEdpg~sVLVLEAG~d~--~~~~~iP~~~~~l~~-s~~DW~Y~TePq~~a~~gl~~r~i~  238 (1381)
                      +|||||||||+|||++|+||||++++||+|||||++.  +...++|..+..... +++||+|+|+||++    .+||++.
T Consensus         2 ~yD~IIVG~G~aG~v~A~rLse~~~~~VlllEaG~~~~~~~~~~~p~~~~~~~~~~~~~w~~~t~pq~~----~~~r~~~   77 (566)
T 3fim_B            2 DFDYVVVGAGNAGNVVAARLTEDPDVSVLVLEAGVSDENVLGAEAPLLAPGLVPNSIFDWNYTTTAQAG----YNGRSIA   77 (566)
T ss_dssp             CEEEEESCCSTTHHHHHHHHTTSTTCCEEEECSSBCCTTCGGGTSGGGSGGGSSSSTTBCCCBCCCCGG----GTTCCCB
T ss_pred             CcCEEEECCcHHHHHHHHHHHhCcCCcEEEEecCCcccCCCceeCcchHHHhcCCCccccccccccCCC----CCCceEe
Confidence            6999999999999999999999999999999999975  445678887665554 78999999999984    6899999


Q ss_pred             cccccccCccccccceEEecCCccchHHHhhc-CCCCCChhhHHHHHHHhcccccCCc------ccCCCCCCCCCCcccc
Q psy11618        239 ITAGKGLGGSSAVQNILYQRGTSYDYENFAKL-GYNGWGYDETLKYFVKSEDYRSVIY------NESKAVHGTQGYLPVG  311 (1381)
Q Consensus       239 ~pRGKvLGGSSsINgmvy~RGs~~DFD~Wa~l-Gn~GWswedLlPYFkKsE~~~~p~~------~~d~~~HG~~GPL~Vs  311 (1381)
                      |+|||++||||+||+|+|+||+++|||+|++. |++||+||+++|||+|+|++..+..      ..|+++||.+||++++
T Consensus        78 ~~rGk~lGGsS~iN~m~~~Rg~~~d~d~W~~~~G~~gWs~~~~~pyf~k~E~~~~~~~~~~~~~~~~~~~hG~~Gp~~v~  157 (566)
T 3fim_B           78 YPRGRMLGGSSSVHYMVMMRGSTEDFDRYAAVTGDEGWNWDNIQQFVRKNEMVVPPADNHNTSGEFIPAVHGTNGSVSIS  157 (566)
T ss_dssp             CCCBCBTTGGGGTSCCBCCCCCHHHHHHHHHHHTCTTSSHHHHHHHHHHHEEECCCTTCCCCTTTSCGGGSCBSSSEEEB
T ss_pred             ccCCcEEcCcccccceEEecCCHHHHHHHHhcCCCCCcCHHHHHHHHHHHhccCCccccccccccCCccccCCCCCeeee
Confidence            99999999999999999999999999999997 9999999999999999999986532      1245799999999999


Q ss_pred             CCCCCCCchHHHHHHHHHHHc--CCCCCCCCCCCCCCcccccCCCCCCCCcccchhhhcchhhhcCCCCeEEEcCcEEEE
Q psy11618        312 LFKNKENNIIREIFETSAQEL--GYPCPKDMNDRYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRTNLYVLKRSKVTK  389 (1381)
Q Consensus       312 ~~p~~e~~pl~~~f~eA~eeL--G~p~~~D~N~g~~~~G~s~~~~ti~~G~RsSAa~AYL~Pa~~~R~NLtILTnA~VtR  389 (1381)
                      ++++.  +|..+.+.+|++++  |++.++|.|+++ +.|+++.+.++++|+|+|++++|++|+. +|+|++|+|+|+|+|
T Consensus       158 ~~~~~--~~~~~~~~~a~~~~~~G~~~~~d~n~~~-~~G~~~~~~~~~~g~R~sa~~ayL~p~~-~r~NL~Vlt~a~V~r  233 (566)
T 3fim_B          158 LPGFP--TPLDDRVLATTQEQSEEFFFNPDMGTGH-PLGISWSIASVGNGQRSSSSTAYLRPAQ-SRPNLSVLINAQVTK  233 (566)
T ss_dssp             SCSSC--CTHHHHHHHHHHHTHHHHCBCSCGGGSC-CCEEEECCBSEETTEECCHHHHTHHHHT-TCTTEEEESSCEEEE
T ss_pred             cCCCC--CHHHHHHHHHHHHHhcCCCccCCCCCCC-cceEEeeeeecCCCEEcCHHHHHhhhhc-cCCCeEEECCCEEEE
Confidence            98876  89999999999999  999988999888 8899999999999999999999999988 899999999999999


Q ss_pred             EEec---CC-CeEEEEEEEecCC-eEEEEecCcEEEEcCCchhhHHHHHHcCCCCCCccccCCCCcccCCc-cchhcccc
Q psy11618        390 VIIN---DQ-NVATGVEYVNSKG-ETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQDLR-VGENLKLN  463 (1381)
Q Consensus       390 Ilfd---~g-~RAtGVE~vd~~G-r~~tV~ArKEVILSAGAI~SPqLLmlSGIGPkd~Le~lGIpVVvDLP-VGrNLQDH  463 (1381)
                      |++|   ++ +||+|||+.+.+| ++++++|+|||||||||++||||||+|||||++||+++||||++|+| ||||||||
T Consensus       234 Il~~~~~~g~~rA~GVe~~~~~g~~~~~v~A~kEVILsAGai~SPqlL~lSGIGp~~~L~~~gI~vv~dlPgVG~NLqDH  313 (566)
T 3fim_B          234 LVNSGTTNGLPAFRCVEYAEQEGAPTTTVCAKKEVVLSAGSVGTPILLQLSGIGDENDLSSVGIDTIVNNPSVGRNLSDH  313 (566)
T ss_dssp             EECCEEETTEEECCEEEEESSTTSCCEEEEEEEEEEECCHHHHHHHHHHHTTEECHHHHHHTTCCCSEECTTTTCSBBCC
T ss_pred             EEeecCCCCCCEEEEEEEEECCCceEEEEEeeeEEEEecCCcCChHHHHhcCCCChHHHhhcCCCceecCcchhhhhhcC
Confidence            9998   34 7999999998546 88999999999999999999999999999999999999999999999 99999999


Q ss_pred             ccCCceEEEecCCccccchhhHHHHHHhhccCCCCCCccccccccccccccccccccccccccccccccccCCCcccccc
Q psy11618        464 AQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLSNMHSYCYCLAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSA  543 (1381)
Q Consensus       464 p~v~~vvf~l~~~vs~sl~~a~a~~~Y~~nrtGPls~~~s~~~~~~~LDe~~~~~~~~l~vg~~~~~~~~~a~~~~a~~~  543 (1381)
                      +.+. +.++.+++.+.+..                               .               . +           
T Consensus       314 ~~~~-~~~~~~~~~~~~~~-------------------------------~---------------~-~-----------  334 (566)
T 3fim_B          314 LLLP-AAFFVNSNQTFDNI-------------------------------F---------------R-D-----------  334 (566)
T ss_dssp             EEEC-CEEEESCSCSSGGG-------------------------------G---------------T-C-----------
T ss_pred             ccce-EEEEeCCCcccchh-------------------------------h---------------c-C-----------
Confidence            9984 77877654320000                               0               0 0           


Q ss_pred             cchhhhhhHHHHHHHHHcCCCCCccccccceEEEeecCC-------------CCCCCCeeeeeeccccccchhhhhhhhc
Q psy11618        544 PLKRTVYSQEMVFKYLVNRIGPLSNAGLWSFTGYIDTLQ-------------NTARPDLEIHLLYFQQNDIRNMCKIKRA  610 (1381)
Q Consensus       544 pl~~tv~s~~~~~eYl~~~sGPLss~g~~e~~gFl~S~~-------------~~~~PDIq~~~~p~s~~~~d~~~~vk~~  610 (1381)
                          .....+...+|..+++||+++.+ .+..+|.+++.             ....||+|+++.+...  .+        
T Consensus       335 ----~~~~~~~~~~~~~~~~G~l~~~~-~~~~~f~~~~~~~~~~~~~~~~~~~~~~pd~~~~~~~~~~--~~--------  399 (566)
T 3fim_B          335 ----SSEFNVDLDQWTNTRTGPLTALI-ANHLAWLRLPSNSSIFQTFPDPAAGPNSAHWETIFSNQWF--HP--------  399 (566)
T ss_dssp             ----HHHHHHHHHHHHHHSCSGGGCCS-CSEEEEECCCTTCGGGGTSCCCSSSTTSCSEEEEEESSCC--CT--------
T ss_pred             ----hHHHHHHHHHHHhcCCCCcccCh-hhheeeeccccchhhhhhhccccccCCCCCEEEEecccch--hh--------
Confidence                00002334556666666666543 34455555431             2256888765533211  00        


Q ss_pred             cccchhHHHHHhccCCCCCeEEEEEeecccCcCcEEEeecCCCCCCccccCCCCCChhhHHHHHHHHHHHHHHhcCHHHH
Q psy11618        611 YDFNDEVQTAYVNLNKRTDMGVISMSLVNPKSCGKVTLKSADPLAPPCIDTGILSEPEDLATLIRGTDYITRLEQTEAIR  690 (1381)
Q Consensus       611 ~g~~~~~~~~~~~p~~~~~~~tI~v~Ll~P~SRGsV~L~SsDP~d~PvIDpNYLSdP~Dle~LveGVR~arrIl~Tp~Lk  690 (1381)
                                ...+..+.+++++.+++++|+|||+|||+|+||.++|.||+||++||.|++.+++|+|.+||++++++++
T Consensus       400 ----------~~~~~~~~~~~~~~~~l~~P~SrG~V~L~s~dp~~~P~i~~~yl~~~~D~~~~~~~~~~~~~i~~~~~~~  469 (566)
T 3fim_B          400 ----------AIPRPDTGSFMSVTNALISPVARGDIKLATSNPFDKPLINPQYLSTEFDIFTMIQAVKSNLRFLSGQAWA  469 (566)
T ss_dssp             ----------TSCCCSSCCEEEEEEEESSCSCCBEEECSSSCTTSCCEEECCTTCSHHHHHHHHHHHHHHHHHHTSGGGT
T ss_pred             ----------cccCCCCCCEEEEEEeecCCccceEEEecCCCCCCCceeccccCCCccHHHHHHHHHHHHHHHHhCcccC
Confidence                      0011123457889999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhcccccccCCccCCCCCCCCchhHHHHHhcccCCCcccccCccccCCCCCCcccCCCCeEeCcCCcEEecccCCCCCCC
Q psy11618        691 LAGGTLMSLNLEACSQYPWRSTHSWTCYIRHLTTTTSNPVGTVMMGNADDPNAVVTPDLKVKGIKGLRVADISVLPNAII  770 (1381)
Q Consensus       691 ~~g~~e~~~plPg~~~~~~~SDEeIe~yIR~~a~T~yHPvGTCRMGP~dDp~GVVDs~LRVhGVdNLRVVDASVfPtiPS  770 (1381)
                      ++..++..   |++  .+.+|||||++|+|++..|.|||+||||||+++|++||||+++|||||+|||||||||||++|+
T Consensus       470 ~~~~~~~~---P~~--~~~~sd~~~~~~ir~~~~t~~H~~GTc~Mg~~~~~~~VVD~~lrV~Gv~~LrVvDaSv~P~~~~  544 (566)
T 3fim_B          470 DFVIRPFD---PRL--RDPTDDAAIESYIRDNANTIFHPVGTASMSPRGASWGVVDPDLKVKGVDGLRIVDGSILPFAPN  544 (566)
T ss_dssp             TTEEEESS---GGG--SCTTCHHHHHHHHHHHCEECSCCBCTTCBCCTTCSSCSBCTTCBBTTCBSEEECSGGGCCSCCS
T ss_pred             CccccccC---CCc--ccccchHHHHHHHhhcccccccccCccccCCcccCCccCCCCCeEccCCCcEEcccccCCCCCC
Confidence            88766542   332  2457999999999999999999999999999877669999999999999999999999999999


Q ss_pred             CCchHHHHHHHH
Q psy11618        771 TQSDAISFLLLF  782 (1381)
Q Consensus       771 gNpqApVyMIA~  782 (1381)
                      +|||+|+||||-
T Consensus       545 ~n~~~~~~~iae  556 (566)
T 3fim_B          545 AHTQGPIYLVGK  556 (566)
T ss_dssp             SCTHHHHHHHHH
T ss_pred             cCcHHHHHHHHH
Confidence            999999999985



>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1381
d1cf3a1385 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Asper 2e-59
d1cf3a1385 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Asper 1e-06
d1gpea1391 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penic 1e-58
d1gpea1391 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penic 3e-04
d2f5va1379 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W 1e-43
d2f5va1379 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W 3e-08
d1kdga1360 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain 4e-42
d1kdga1360 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain 5e-06
d1ju2a1351 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase { 5e-40
d3coxa1370 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of 4e-37
d1n4wa1367 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of 2e-36
d1cf3a2196 d.16.1.1 (A:325-520) Glucose oxidase {Aspergillus 5e-12
d1gpea2196 d.16.1.1 (A:329-524) Glucose oxidase {Penicillium 7e-12
d1ju2a2170 d.16.1.1 (A:294-463) Hydroxynitrile lyase {Almond 2e-09
d1kdga2181 d.16.1.1 (A:513-693) Flavoprotein domain of flavoc 3e-09
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 3e-08
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 8e-07
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 1e-06
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 3e-06
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 6e-06
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 6e-06
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 6e-06
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 1e-05
d1onfa1259 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase 1e-05
d1chua2305 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E 1e-05
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 2e-05
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 2e-05
d1neka2330 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase 4e-05
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 5e-05
d1h6va1235 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin 5e-05
d3c96a1288 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps 5e-05
d2gqfa1253 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H 6e-05
d2gf3a1281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 8e-05
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 8e-05
d1jnra2356 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reduct 8e-05
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 9e-05
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 1e-04
d2bs2a2336 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo 1e-04
d1lvla1220 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd 1e-04
d1kf6a2311 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es 2e-04
d1pj5a2305 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine ox 2e-04
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 3e-04
d2gjca1311 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th 3e-04
d2ivda1347 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox 3e-04
d2gmha1380 c.3.1.2 (A:4-236,A:336-482) Electron transfer flav 8e-04
d1i8ta1298 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu 8e-04
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 9e-04
d1kqfc_216 f.21.1.1 (C:) Formate dehydrogenase N, cytochrome 0.001
d1kqfc_216 f.21.1.1 (C:) Formate dehydrogenase N, cytochrome 0.001
d1kqfc_216 f.21.1.1 (C:) Formate dehydrogenase N, cytochrome 0.001
d1kqfc_216 f.21.1.1 (C:) Formate dehydrogenase N, cytochrome 0.001
d1kqfc_216 f.21.1.1 (C:) Formate dehydrogenase N, cytochrome 0.001
d1kqfc_216 f.21.1.1 (C:) Formate dehydrogenase N, cytochrome 0.001
d1kqfc_216 f.21.1.1 (C:) Formate dehydrogenase N, cytochrome 0.001
d1kqfc_216 f.21.1.1 (C:) Formate dehydrogenase N, cytochrome 0.001
d1kqfc_216 f.21.1.1 (C:) Formate dehydrogenase N, cytochrome 0.001
d1kqfc_216 f.21.1.1 (C:) Formate dehydrogenase N, cytochrome 0.001
d1kqfc_216 f.21.1.1 (C:) Formate dehydrogenase N, cytochrome 0.001
d1kqfc_216 f.21.1.1 (C:) Formate dehydrogenase N, cytochrome 0.001
d1kqfc_216 f.21.1.1 (C:) Formate dehydrogenase N, cytochrome 0.001
d1pn0a1360 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So 0.001
d1nhpa1198 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enter 0.002
d1aoga1238 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas 0.003
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 0.003
d1fcda1186 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulf 0.004
d1feca1240 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas 0.004
d1xdia1233 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehyd 0.004
d1w4xa1298 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy 0.004
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 385 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Glucose oxidase
species: Aspergillus niger [TaxId: 5061]
 Score =  207 bits (527), Expect = 2e-59
 Identities = 95/373 (25%), Positives = 146/373 (39%), Gaps = 30/373 (8%)

Query: 155 PYVKSGDCFDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTPIHS---RIPGMSSVL 211
           P   SG   D II G    G   A RL+E  ++ VL+IE+G                  +
Sbjct: 10  PKDVSGRTVDYIIAGGGLTGLTTAARLTENPNISVLVIESGSYESDRGPIIEDLNAYGDI 69

Query: 212 SLSEFDHAYLAEPSQFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAKL- 270
             S  DHAY         L   N    I +G GLGGS+ V    + R      +++  + 
Sbjct: 70  FGSSVDHAYETVE-----LATNNQTALIRSGNGLGGSTLVNGGTWTRPHKAQVDSWETVF 124

Query: 271 GYNGWGYDETLKYFVKSEDYRSVIYNESKAVHGTQGYLPVG--------LFKNKENNIIR 322
           G  GW +D    Y +++E  R+    +  A H                      + + I 
Sbjct: 125 GNEGWNWDNVAAYSLQAERARAPNAKQIAAGHYFNASCHGVNGTVHAGPRDTGDDYSPIV 184

Query: 323 EIFETSAQELGYPCPKDMNDRYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRTNLYVL 382
           +   ++ ++ G P  KD               +    +R  AA  +L P   +R NL VL
Sbjct: 185 KALMSAVEDRGVPTKKDFGCGDPHGVSMFPNTLHEDQVRSDAAREWLLPNY-QRPNLQVL 243

Query: 383 KRSKVTKVIINDQN---VATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGP 439
               V KV+++       A GVE+   KG T  V A  EV+L AG+  +  +L  SGIG 
Sbjct: 244 TGQYVGKVLLSQNGTTPRAVGVEFGTHKGNTHNVYAKHEVLLAAGSAVSPTILEYSGIGM 303

Query: 440 KAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPL- 498
           K+ L+ + I    DL VG    +  +  G V          VY  + + + +   I P  
Sbjct: 304 KSILEPLGIDTVVDLPVGLCSMMPKEMGGVVDNA-----ARVYGVQGL-RVIDGSIPPTQ 357

Query: 499 --SNMHSYCYCLA 509
             S++ +  Y +A
Sbjct: 358 MSSHVMTVFYAMA 370


>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 385 Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 391 Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 391 Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360 Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360 Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Length = 351 Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370 Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Length = 367 Back     information, alignment and structure
>d1cf3a2 d.16.1.1 (A:325-520) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 196 Back     information, alignment and structure
>d1gpea2 d.16.1.1 (A:329-524) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 196 Back     information, alignment and structure
>d1ju2a2 d.16.1.1 (A:294-463) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Length = 170 Back     information, alignment and structure
>d1kdga2 d.16.1.1 (A:513-693) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), substrate-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 181 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 356 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311 Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Length = 305 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1kqfc_ f.21.1.1 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli [TaxId: 562]} Length = 216 Back     information, alignment and structure
>d1kqfc_ f.21.1.1 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli [TaxId: 562]} Length = 216 Back     information, alignment and structure
>d1kqfc_ f.21.1.1 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli [TaxId: 562]} Length = 216 Back     information, alignment and structure
>d1kqfc_ f.21.1.1 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli [TaxId: 562]} Length = 216 Back     information, alignment and structure
>d1kqfc_ f.21.1.1 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli [TaxId: 562]} Length = 216 Back     information, alignment and structure
>d1kqfc_ f.21.1.1 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli [TaxId: 562]} Length = 216 Back     information, alignment and structure
>d1kqfc_ f.21.1.1 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli [TaxId: 562]} Length = 216 Back     information, alignment and structure
>d1kqfc_ f.21.1.1 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli [TaxId: 562]} Length = 216 Back     information, alignment and structure
>d1kqfc_ f.21.1.1 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli [TaxId: 562]} Length = 216 Back     information, alignment and structure
>d1kqfc_ f.21.1.1 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli [TaxId: 562]} Length = 216 Back     information, alignment and structure
>d1kqfc_ f.21.1.1 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli [TaxId: 562]} Length = 216 Back     information, alignment and structure
>d1kqfc_ f.21.1.1 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli [TaxId: 562]} Length = 216 Back     information, alignment and structure
>d1kqfc_ f.21.1.1 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli [TaxId: 562]} Length = 216 Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 198 Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Length = 186 Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 233 Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1381
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 100.0
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 100.0
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 100.0
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 100.0
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 100.0
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 100.0
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 100.0
d1gpea2196 Glucose oxidase {Penicillium amagasakiense [TaxId: 99.91
d1cf3a2196 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 99.9
d1kdga2181 Flavoprotein domain of flavocytochrome cellobiose 99.89
d1ju2a2170 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 99.83
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 99.55
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.53
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 99.46
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 99.42
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 99.37
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.35
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 99.31
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.23
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 99.17
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 99.17
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.14
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 99.14
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.09
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 99.06
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 98.97
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 98.91
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.5
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.4
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.25
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.09
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 97.98
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 97.89
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 97.88
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 97.85
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 97.83
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 97.83
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 97.81
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 97.79
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 97.78
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 97.76
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 97.73
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 97.7
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.65
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.57
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 97.56
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 97.53
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 97.49
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 97.47
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.44
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 97.39
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.35
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 97.34
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 97.27
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 97.14
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 97.11
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 97.08
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 97.03
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 96.86
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 96.8
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 96.78
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 96.51
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 96.5
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 96.46
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 96.13
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 96.13
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 95.51
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 95.2
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 95.2
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 94.76
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 94.52
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 94.41
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 94.24
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 94.12
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 93.87
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 93.36
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 93.22
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 93.15
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 92.63
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 92.5
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 92.19
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 91.49
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 91.17
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 91.12
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 91.03
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 90.95
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 90.68
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 90.33
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 90.15
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 90.06
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 90.02
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 89.84
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 89.41
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 89.22
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 88.84
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 88.17
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 87.69
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 87.64
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 87.03
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 85.87
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 85.57
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 84.91
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 80.44
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Glucose oxidase
species: Penicillium amagasakiense [TaxId: 63559]
Probab=100.00  E-value=4.3e-75  Score=658.07  Aligned_cols=300  Identities=29%  Similarity=0.413  Sum_probs=262.2

Q ss_pred             CCCCcccEEEECCCchHHHHHHHHhccCCCeEEEEeccCCCCC---ccccCCccccccCCcccCcccccccccccccCCC
Q psy11618        158 KSGDCFDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTPI---HSRIPGMSSVLSLSEFDHAYLAEPSQFAGLGVRN  234 (1381)
Q Consensus       158 ~~~~~YDYIIVGGGTAG~VLAsRLSEdpg~sVLVLEAG~d~~~---~~~iP~~~~~l~~s~~DW~Y~TePq~~a~~gl~~  234 (1381)
                      ..+++|||||||||+|||++|+||||++++||+|||||++...   ..++|..+....++++||+|+|+||.      +|
T Consensus        20 ~~~~tyD~IIVGsG~aG~vlA~rLae~~~~~VLlLEaG~~~~~~~~~~~~p~~~~~~~~~~~dw~~~t~p~~------~~   93 (391)
T d1gpea1          20 VAGKTYDYIIAGGGLTGLTVAAKLTENPKIKVLVIEKGFYESNDGAIIEDPNAYGQIFGTTVDQNYLTVPLI------NN   93 (391)
T ss_dssp             TTTCEEEEEEECCSHHHHHHHHHHHTSTTCCEEEEESSCCCTTSCHHHHCGGGTTTTTTSTTBCCEECCCCT------TS
T ss_pred             ccCCeeeEEEECcCHHHHHHHHHHHHCCCCeEEEEcCCCCCCCCCceeeCHHHHHHhhCCCcccCceeeecC------CC
Confidence            3557899999999999999999999998899999999986432   34678877777888999999999984      68


Q ss_pred             ceeecccccccCccccccceEEecCCccchHHHhh-cCCCCCChhhHHHHHHHhcccccCCcc-------cCCCCCCCCC
Q psy11618        235 ARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAK-LGYNGWGYDETLKYFVKSEDYRSVIYN-------ESKAVHGTQG  306 (1381)
Q Consensus       235 r~i~~pRGKvLGGSSsINgmvy~RGs~~DFD~Wa~-lGn~GWswedLlPYFkKsE~~~~p~~~-------~d~~~HG~~G  306 (1381)
                      |+..|+|||++||||++|+|+|.|+++.|||.|++ .|++||+|++++|||+|+|++..+..+       .++++||.+|
T Consensus        94 r~~~~~~G~~lGGsS~in~~~~~rg~~~d~~~w~~~~G~~gW~~~~l~pyf~k~E~~~~~~~~~~~~~~~~~~~~~g~~~  173 (391)
T d1gpea1          94 RTNNIKAGKGLGGSTLINGDSWTRPDKVQIDSWEKVFGMEGWNWDNMFEYMKKAEAARTPTAAQLAAGHSFNATCHGTNG  173 (391)
T ss_dssp             CCCEECCBCSTTGGGGTSCCEECCCCHHHHHHHHHTTCCTTCSHHHHHHHHHHTEEECCCCHHHHHHTCCCCGGGCCBSS
T ss_pred             cEeeeceeeccCcccceeeeEEeeccccccccccccCCCCccccchhHHHHHHhhhccCCcchhcccccCccccccCCCC
Confidence            89999999999999999999999999999999987 489999999999999999998755321       2567899999


Q ss_pred             CccccCCCCC-CCchHHHHHHHHHHHcCCCCCCCCCCCCCCcccccCCCCC-CCCcccchhhhcchhhhcCCCCeEEEcC
Q psy11618        307 YLPVGLFKNK-ENNIIREIFETSAQELGYPCPKDMNDRYVDVGFAELPGMT-RYGLRFSAADAYLTPIAGKRTNLYVLKR  384 (1381)
Q Consensus       307 PL~Vs~~p~~-e~~pl~~~f~eA~eeLG~p~~~D~N~g~~~~G~s~~~~ti-~~G~RsSAa~AYL~Pa~~~R~NLtILTn  384 (1381)
                      |++++..+.. ..+|..+++.++++++|++.++|.|+++ +.|.+..+.++ .++.|++++++++.|.. +|+|++|+||
T Consensus       174 ~~~~~~~~~~~~~~p~~~~~~~a~~~~G~~~~~~~~~g~-~~~~~~~~~~~~~~~~r~s~a~~~~~p~~-~r~nl~i~t~  251 (391)
T d1gpea1         174 TVQSGARDNGQPWSPIMKALMNTVSALGVPVQQDFLCGH-PRGVSMIMNNLDENQVRVDAARAWLLPNY-QRSNLEILTG  251 (391)
T ss_dssp             SEEEBCCCCSSCBCTHHHHHHHHHHHTTCCBSCCTTSSC-CCEEECCEESBCTTCCBCCHHHHHTTTTT-TCTTEEEEES
T ss_pred             cccccccccccccCHHHHHHHHHHHhcCCceeeccccCc-ccccccccceeeccccccchhhhccCccc-cchhhhhhcc
Confidence            9998765433 3478999999999999999888888887 66666555554 45689999999999988 8999999999


Q ss_pred             cEEEEEEec---CCCeEEEEEEEecCCeEEEEecCcEEEEcCCchhhHHHHHHcCCCCCCccccCCCCcccCCc--cchh
Q psy11618        385 SKVTKVIIN---DQNVATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQDLR--VGEN  459 (1381)
Q Consensus       385 A~VtRIlfd---~g~RAtGVE~vd~~Gr~~tV~ArKEVILSAGAI~SPqLLmlSGIGPkd~Le~lGIpVVvDLP--VGrN  459 (1381)
                      ++|+||++|   +++||+||||.+.+|++++++|+||||||||||+||||||+|||||+++|+++||++++|+|  ||+|
T Consensus       252 a~V~rIl~~~~~~g~ra~GV~~~~~~g~~~~v~A~keVILaAGai~SP~LLl~SGIGp~~~L~~~gI~~v~dlP~Gvg~n  331 (391)
T d1gpea1         252 QMVGKVLFKQTASGPQAVGVNFGTNKAVNFDVFAKHEVLLAAGSAISPLILEYSGIGLKSVLDQANVTQLLDLPVGICSM  331 (391)
T ss_dssp             CEEEEEEEEEETTEEEEEEEEEEEETTEEEEEEEEEEEEECSCTTTHHHHHHHTTEECHHHHHHTTCCCSEECCTTCTCB
T ss_pred             ceeeEEeeeCCCCCceEEeeEEecCCCeEEEEEeCCEEEEecchhcchHHHHhcCCCcHHHHHHCCCCEEEECCcccccc
Confidence            999999997   24599999998867888999999999999999999999999999999999999999999998  7888


Q ss_pred             cccccc
Q psy11618        460 LKLNAQ  465 (1381)
Q Consensus       460 LQDHp~  465 (1381)
                      +|||+.
T Consensus       332 l~dh~~  337 (391)
T d1gpea1         332 MSRELG  337 (391)
T ss_dssp             SCGGGT
T ss_pred             cccCcc
Confidence            888843



>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1gpea2 d.16.1.1 (A:329-524) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1cf3a2 d.16.1.1 (A:325-520) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1kdga2 d.16.1.1 (A:513-693) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), substrate-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1ju2a2 d.16.1.1 (A:294-463) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure