Psyllid ID: psy11618
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1381 | ||||||
| 242018486 | 635 | glucose dehydrogenase precursor, putativ | 0.394 | 0.858 | 0.345 | 2e-72 | |
| 328779380 | 683 | PREDICTED: glucose dehydrogenase [accept | 0.430 | 0.871 | 0.311 | 7e-59 | |
| 193676365 | 1147 | PREDICTED: hypothetical protein LOC10015 | 0.260 | 0.313 | 0.413 | 5e-58 | |
| 307203797 | 673 | Glucose dehydrogenase [acceptor] [Harpeg | 0.417 | 0.857 | 0.321 | 2e-56 | |
| 340730155 | 615 | PREDICTED: glucose dehydrogenase [accept | 0.383 | 0.860 | 0.309 | 1e-55 | |
| 340730088 | 591 | PREDICTED: glucose dehydrogenase [accept | 0.383 | 0.895 | 0.319 | 2e-55 | |
| 345488938 | 633 | PREDICTED: glucose dehydrogenase [accept | 0.215 | 0.470 | 0.416 | 2e-53 | |
| 345488948 | 616 | PREDICTED: glucose dehydrogenase [accept | 0.234 | 0.525 | 0.402 | 4e-53 | |
| 405978093 | 621 | Glucose dehydrogenase [acceptor] [Crasso | 0.217 | 0.483 | 0.438 | 6e-53 | |
| 350425619 | 615 | PREDICTED: glucose dehydrogenase [accept | 0.383 | 0.860 | 0.304 | 1e-52 |
| >gi|242018486|ref|XP_002429706.1| glucose dehydrogenase precursor, putative [Pediculus humanus corporis] gi|212514709|gb|EEB16968.1| glucose dehydrogenase precursor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 281 bits (718), Expect = 2e-72, Method: Compositional matrix adjust.
Identities = 221/639 (34%), Positives = 321/639 (50%), Gaps = 94/639 (14%)
Query: 146 SVIYPPDMTPYVKSGDCFDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTPIHSRIP 205
SV YP D + +G FD II+GA +AG V+ANRLSE + VLLIEAGG S IP
Sbjct: 45 SVDYPEDKWKSLVNGQNFDFIIIGAGSAGSVVANRLSENPNWSVLLIEAGGSPTPTSEIP 104
Query: 206 G--MSSVLSLSEFDHAYLAEPSQFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYD 263
G +SS+ + + D Y E LG+ + GK LGG+S + ++Y RG D
Sbjct: 105 GLWISSLKT--KMDWNYKLEKMTNCCLGMIEEKCLSPRGKVLGGTSVINAMIYVRGNPED 162
Query: 264 YENFAKLGYNGWGYDETLKYFVKSEDYRS---VIYNE-----SKAVHGTQGYLPVGLFKN 315
Y + +G GW Y LKYF +SE V NE SK H ++G L V F
Sbjct: 163 YNEWENMGNEGWAYKNILKYFKRSEKMSGFNFVDENEISKLVSKKYHSSKGLLNVEHFGK 222
Query: 316 KEN-NIIREIFETSAQELGYPCPKDMNDRYVDVGFAELPGMTRYGLRFSAADAYLTPIAG 374
+ N + ++ + +ELG D+N R+ +GF E T G R + A +L PI G
Sbjct: 223 RPNVDYLKNVIFDGVEELGEFYVSDVNGRF-QLGFTEPQTTTENGRRANTAKTFLNPIKG 281
Query: 375 KRTNLYVLKRSKVTKVIINDQNVATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLL 434
R NL ++K S K+I+ D+ GV+ V S GE RV +KEVIL+AG+I QLL+L
Sbjct: 282 -RKNLLIVKNSMAHKLIL-DRKRVIGVQ-VESNGEMKRVFVHKEVILSAGSINTPQLLML 338
Query: 435 SGIGPKAHLDEVKIPVKQDLR-VGENLKLNAQFTGPVMAFSAPLKRTVYSQEMVFKYLVN 493
SGIGP+ HL+ + IPV ++ VG+NL Q+ V Y
Sbjct: 339 SGIGPRQHLESLNIPVVHEMNGVGQNL-----------------------QDHVVTY--- 372
Query: 494 RIGPLS-NMHSYCYCLAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSAPLKRTVYSQ 552
+ P+S N H P K R G++L
Sbjct: 373 -VAPISINKHK-------------PDKMS-RPGDDL------------------------ 393
Query: 553 EMVFKYLVNRIGPLSNAGLWSFT-----GYIDTLQNTARPDLEIHLLYFQQNDIRNMCKI 607
+L++ GP S SFT G+++T +N+ PD++ H +YF ND ++ K
Sbjct: 394 SHYHDFLLHGTGPYS-----SFTNLDVVGFVNTFKNSTLPDVQYHFMYFYLNDTESVKKF 448
Query: 608 KRAYDFNDEVQTAYVNLNKRTDMGVISMSLVNPKSCGKVTLKSADPLAPPCIDTGILSEP 667
R + E+ YV + + ++ +IS +L+ PKS G++ LKS++P P I L+ P
Sbjct: 449 TRVLNLKPEIGNEYVKIVRDANLLLISTTLLRPKSTGRIELKSSNPYDSPKIIGNYLNVP 508
Query: 668 EDLATLIRGTDYITRLEQTEAIRLAGGTLMSLNLEACSQYPWRSTHSWTCYIRHLTTTTS 727
DL TLIRG +++ L +T+++++ L + L+ CS ++S WTC IRHL+T
Sbjct: 509 GDLDTLIRGVEFVVSLSETKSLKMRESNLERIRLKNCSSEKFKSREYWTCLIRHLSTNLY 568
Query: 728 NPVGTVMMGNADDPNAVVTPDLKVKGIKGLRVADISVLP 766
+PVGT MG D +VV LKV G+ LR+AD S++P
Sbjct: 569 HPVGTCKMGPKKDSTSVVDSKLKVHGLTNLRIADGSIMP 607
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328779380|ref|XP_396549.3| PREDICTED: glucose dehydrogenase [acceptor] [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|193676365|ref|XP_001949532.1| PREDICTED: hypothetical protein LOC100159632 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|307203797|gb|EFN82733.1| Glucose dehydrogenase [acceptor] [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|340730155|ref|XP_003403352.1| PREDICTED: glucose dehydrogenase [acceptor]-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|340730088|ref|XP_003403320.1| PREDICTED: glucose dehydrogenase [acceptor]-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|345488938|ref|XP_001600775.2| PREDICTED: glucose dehydrogenase [acceptor]-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|345488948|ref|XP_001600924.2| PREDICTED: glucose dehydrogenase [acceptor]-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|405978093|gb|EKC42507.1| Glucose dehydrogenase [acceptor] [Crassostrea gigas] | Back alignment and taxonomy information |
|---|
| >gi|350425619|ref|XP_003494178.1| PREDICTED: glucose dehydrogenase [acceptor]-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1381 | ||||||
| FB|FBgn0030593 | 623 | CG9512 [Drosophila melanogaste | 0.213 | 0.473 | 0.386 | 5.5e-86 | |
| FB|FBgn0030598 | 626 | CG9503 [Drosophila melanogaste | 0.261 | 0.576 | 0.362 | 1.6e-82 | |
| FB|FBgn0039415 | 616 | CG6142 [Drosophila melanogaste | 0.243 | 0.545 | 0.384 | 4.6e-76 | |
| FB|FBgn0030589 | 622 | CG9519 [Drosophila melanogaste | 0.211 | 0.469 | 0.403 | 4.6e-71 | |
| FB|FBgn0001112 | 625 | Gld "Glucose dehydrogenase" [D | 0.231 | 0.512 | 0.369 | 2e-69 | |
| UNIPROTKB|Q47YL1 | 539 | CPS_3434 "Oxidoreductase, GMC | 0.209 | 0.536 | 0.416 | 2.2e-58 | |
| TIGR_CMR|CPS_3434 | 539 | CPS_3434 "oxidoreductase, GMC | 0.209 | 0.536 | 0.416 | 2.2e-58 | |
| FB|FBgn0030590 | 703 | CG9518 [Drosophila melanogaste | 0.240 | 0.472 | 0.399 | 1.4e-53 | |
| TIGR_CMR|CPS_4010 | 561 | CPS_4010 "choline dehydrogenas | 0.209 | 0.516 | 0.373 | 6e-53 | |
| TIGR_CMR|SPO_2359 | 535 | SPO_2359 "oxidoreductase, GMC | 0.231 | 0.598 | 0.361 | 1.2e-51 |
| FB|FBgn0030593 CG9512 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 503 (182.1 bits), Expect = 5.5e-86, Sum P(2) = 5.5e-86
Identities = 117/303 (38%), Positives = 173/303 (57%)
Query: 163 FDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTPIHSRIPGMSSVLSLSEFDHAYLA 222
+D I++G+ +G V+A RL+EV + KVLL+EAGGD PI + SE+D Y +
Sbjct: 58 YDFIVIGSGTSGAVVAGRLAEVKNWKVLLLEAGGDPPIETEFVAWHMATQFSEWDWQYHS 117
Query: 223 EPSQFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAKLGYNGWGYDETLK 282
+P+ A + ++ GK LGG++ + ++Y RGT D++++ + G GWGYDE LK
Sbjct: 118 KPNGRACMAMKGESCHWPRGKMLGGTNGMNAMIYARGTRKDFDDWEERGNPGWGYDEVLK 177
Query: 283 YFVKSEDYRSVIYNESKAVHGTQGYLPVGLFKNKENNIIREIFETSAQELGYPCPKDMND 342
+F K+ED RS + HG G P+GL +N R QE+GY D +
Sbjct: 178 HFRKAEDLRSTRPDYKPGDHGVGG--PMGLNNYVSDNEFRTTIRAGMQEMGYGSAPDFTE 235
Query: 343 RYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRT-NLYVLKRSKVTKVIINDQNVATGV 401
VG ++ G G R + A ++L K T NL++L+ + V K+ ++ N A V
Sbjct: 236 GSF-VGQMDILGTQDGGRRITTARSHLK----KNTPNLHILRHAHVKKINLDRNNRAESV 290
Query: 402 EYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQDLRVGENLK 461
+V+ + V A+KEVI++AGAI + Q+LLLSGIGP HL + IPVK DL VGENLK
Sbjct: 291 TFVHRGKKEYTVKASKEVIVSAGAIGSPQILLLSGIGPADHLKSLGIPVKLDLPVGENLK 350
Query: 462 LNA 464
+A
Sbjct: 351 DHA 353
|
|
| FB|FBgn0030598 CG9503 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0039415 CG6142 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0030589 CG9519 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0001112 Gld "Glucose dehydrogenase" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q47YL1 CPS_3434 "Oxidoreductase, GMC family" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_3434 CPS_3434 "oxidoreductase, GMC family" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0030590 CG9518 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_4010 CPS_4010 "choline dehydrogenase" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_2359 SPO_2359 "oxidoreductase, GMC family" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1381 | |||
| PRK02106 | 560 | PRK02106, PRK02106, choline dehydrogenase; Validat | 1e-69 | |
| COG2303 | 542 | COG2303, BetA, Choline dehydrogenase and related f | 7e-61 | |
| TIGR01810 | 532 | TIGR01810, betA, choline dehydrogenase | 1e-60 | |
| TIGR03970 | 487 | TIGR03970, Rv0697, dehydrogenase, Rv0697 family | 1e-43 | |
| pfam00732 | 218 | pfam00732, GMC_oxred_N, GMC oxidoreductase | 3e-33 | |
| pfam05199 | 139 | pfam05199, GMC_oxred_C, GMC oxidoreductase | 5e-31 | |
| PLN02785 | 587 | PLN02785, PLN02785, Protein HOTHEAD | 3e-20 | |
| COG2303 | 542 | COG2303, BetA, Choline dehydrogenase and related f | 4e-19 | |
| PRK02106 | 560 | PRK02106, PRK02106, choline dehydrogenase; Validat | 7e-19 | |
| pfam10101 | 738 | pfam10101, DUF2339, Predicted membrane protein (DU | 1e-14 | |
| pfam10101 | 738 | pfam10101, DUF2339, Predicted membrane protein (DU | 2e-14 | |
| TIGR03970 | 487 | TIGR03970, Rv0697, dehydrogenase, Rv0697 family | 4e-14 | |
| pfam10101 | 738 | pfam10101, DUF2339, Predicted membrane protein (DU | 8e-14 | |
| COG1807 | 535 | COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transfe | 6e-13 | |
| COG1807 | 535 | COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transfe | 6e-13 | |
| COG1807 | 535 | COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transfe | 4e-12 | |
| COG1807 | 535 | COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transfe | 5e-12 | |
| COG1807 | 535 | COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transfe | 1e-11 | |
| COG1807 | 535 | COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transfe | 1e-11 | |
| pfam09586 | 835 | pfam09586, YfhO, Bacterial membrane protein YfhO | 1e-11 | |
| COG1287 | 773 | COG1287, COG1287, Uncharacterized membrane protein | 4e-11 | |
| COG1287 | 773 | COG1287, COG1287, Uncharacterized membrane protein | 4e-11 | |
| COG1287 | 773 | COG1287, COG1287, Uncharacterized membrane protein | 4e-11 | |
| COG1368 | 650 | COG1368, MdoB, Phosphoglycerol transferase and rel | 5e-11 | |
| COG1287 | 773 | COG1287, COG1287, Uncharacterized membrane protein | 9e-11 | |
| COG1287 | 773 | COG1287, COG1287, Uncharacterized membrane protein | 1e-10 | |
| pfam09586 | 835 | pfam09586, YfhO, Bacterial membrane protein YfhO | 2e-10 | |
| pfam09586 | 835 | pfam09586, YfhO, Bacterial membrane protein YfhO | 2e-10 | |
| pfam09586 | 835 | pfam09586, YfhO, Bacterial membrane protein YfhO | 2e-10 | |
| pfam09586 | 835 | pfam09586, YfhO, Bacterial membrane protein YfhO | 2e-10 | |
| pfam09586 | 835 | pfam09586, YfhO, Bacterial membrane protein YfhO | 2e-10 | |
| pfam09586 | 835 | pfam09586, YfhO, Bacterial membrane protein YfhO | 2e-10 | |
| COG1287 | 773 | COG1287, COG1287, Uncharacterized membrane protein | 2e-10 | |
| COG1807 | 535 | COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transfe | 3e-10 | |
| COG1368 | 650 | COG1368, MdoB, Phosphoglycerol transferase and rel | 3e-10 | |
| COG1368 | 650 | COG1368, MdoB, Phosphoglycerol transferase and rel | 3e-10 | |
| COG1368 | 650 | COG1368, MdoB, Phosphoglycerol transferase and rel | 3e-10 | |
| COG1368 | 650 | COG1368, MdoB, Phosphoglycerol transferase and rel | 3e-10 | |
| COG1368 | 650 | COG1368, MdoB, Phosphoglycerol transferase and rel | 3e-10 | |
| COG1368 | 650 | COG1368, MdoB, Phosphoglycerol transferase and rel | 3e-10 | |
| COG1368 | 650 | COG1368, MdoB, Phosphoglycerol transferase and rel | 3e-10 | |
| COG1368 | 650 | COG1368, MdoB, Phosphoglycerol transferase and rel | 3e-10 | |
| COG1368 | 650 | COG1368, MdoB, Phosphoglycerol transferase and rel | 3e-10 | |
| COG1368 | 650 | COG1368, MdoB, Phosphoglycerol transferase and rel | 3e-10 | |
| COG1368 | 650 | COG1368, MdoB, Phosphoglycerol transferase and rel | 3e-10 | |
| pfam10101 | 738 | pfam10101, DUF2339, Predicted membrane protein (DU | 4e-10 | |
| COG2194 | 555 | COG2194, COG2194, Predicted membrane-associated, m | 4e-10 | |
| COG2194 | 555 | COG2194, COG2194, Predicted membrane-associated, m | 4e-10 | |
| COG1368 | 650 | COG1368, MdoB, Phosphoglycerol transferase and rel | 6e-10 | |
| COG1287 | 773 | COG1287, COG1287, Uncharacterized membrane protein | 7e-10 | |
| pfam10101 | 738 | pfam10101, DUF2339, Predicted membrane protein (DU | 2e-09 | |
| COG2194 | 555 | COG2194, COG2194, Predicted membrane-associated, m | 2e-09 | |
| COG2194 | 555 | COG2194, COG2194, Predicted membrane-associated, m | 2e-09 | |
| COG2194 | 555 | COG2194, COG2194, Predicted membrane-associated, m | 2e-09 | |
| COG2194 | 555 | COG2194, COG2194, Predicted membrane-associated, m | 2e-09 | |
| COG2194 | 555 | COG2194, COG2194, Predicted membrane-associated, m | 2e-09 | |
| COG2194 | 555 | COG2194, COG2194, Predicted membrane-associated, m | 2e-09 | |
| COG2194 | 555 | COG2194, COG2194, Predicted membrane-associated, m | 2e-09 | |
| COG2194 | 555 | COG2194, COG2194, Predicted membrane-associated, m | 2e-09 | |
| COG2194 | 555 | COG2194, COG2194, Predicted membrane-associated, m | 2e-09 | |
| COG1368 | 650 | COG1368, MdoB, Phosphoglycerol transferase and rel | 3e-09 | |
| COG3307 | 424 | COG3307, RfaL, Lipid A core - O-antigen ligase and | 3e-09 | |
| pfam09586 | 835 | pfam09586, YfhO, Bacterial membrane protein YfhO | 5e-09 | |
| pfam09586 | 835 | pfam09586, YfhO, Bacterial membrane protein YfhO | 5e-09 | |
| COG3307 | 424 | COG3307, RfaL, Lipid A core - O-antigen ligase and | 5e-09 | |
| COG3307 | 424 | COG3307, RfaL, Lipid A core - O-antigen ligase and | 1e-08 | |
| COG2194 | 555 | COG2194, COG2194, Predicted membrane-associated, m | 2e-08 | |
| COG1368 | 650 | COG1368, MdoB, Phosphoglycerol transferase and rel | 3e-08 | |
| COG2194 | 555 | COG2194, COG2194, Predicted membrane-associated, m | 3e-08 | |
| COG3307 | 424 | COG3307, RfaL, Lipid A core - O-antigen ligase and | 3e-08 | |
| pfam03699 | 771 | pfam03699, UPF0182, Uncharacterized protein family | 4e-08 | |
| COG3307 | 424 | COG3307, RfaL, Lipid A core - O-antigen ligase and | 5e-08 | |
| COG0815 | 518 | COG0815, Lnt, Apolipoprotein N-acyltransferase [Ce | 6e-08 | |
| COG0815 | 518 | COG0815, Lnt, Apolipoprotein N-acyltransferase [Ce | 6e-08 | |
| COG0815 | 518 | COG0815, Lnt, Apolipoprotein N-acyltransferase [Ce | 6e-08 | |
| COG0815 | 518 | COG0815, Lnt, Apolipoprotein N-acyltransferase [Ce | 6e-08 | |
| COG0815 | 518 | COG0815, Lnt, Apolipoprotein N-acyltransferase [Ce | 6e-08 | |
| COG0815 | 518 | COG0815, Lnt, Apolipoprotein N-acyltransferase [Ce | 6e-08 | |
| pfam03699 | 771 | pfam03699, UPF0182, Uncharacterized protein family | 9e-08 | |
| pfam03699 | 771 | pfam03699, UPF0182, Uncharacterized protein family | 9e-08 | |
| pfam03699 | 771 | pfam03699, UPF0182, Uncharacterized protein family | 9e-08 | |
| pfam03699 | 771 | pfam03699, UPF0182, Uncharacterized protein family | 9e-08 | |
| pfam03699 | 771 | pfam03699, UPF0182, Uncharacterized protein family | 9e-08 | |
| pfam03699 | 771 | pfam03699, UPF0182, Uncharacterized protein family | 9e-08 | |
| pfam03699 | 771 | pfam03699, UPF0182, Uncharacterized protein family | 9e-08 | |
| pfam03699 | 771 | pfam03699, UPF0182, Uncharacterized protein family | 9e-08 | |
| pfam03699 | 771 | pfam03699, UPF0182, Uncharacterized protein family | 9e-08 | |
| COG0815 | 518 | COG0815, Lnt, Apolipoprotein N-acyltransferase [Ce | 9e-08 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 1e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 1e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 1e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 1e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 1e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 1e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 1e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 1e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 1e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 1e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 1e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 1e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 1e-07 | |
| pfam10101 | 738 | pfam10101, DUF2339, Predicted membrane protein (DU | 2e-07 | |
| pfam03699 | 771 | pfam03699, UPF0182, Uncharacterized protein family | 2e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 2e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 2e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 2e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 2e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 2e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 2e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 2e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 2e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 2e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 2e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 2e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 2e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 2e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 2e-07 | |
| COG4485 | 858 | COG4485, COG4485, Predicted membrane protein [Func | 2e-07 | |
| COG4485 | 858 | COG4485, COG4485, Predicted membrane protein [Func | 3e-07 | |
| COG4485 | 858 | COG4485, COG4485, Predicted membrane protein [Func | 3e-07 | |
| COG4485 | 858 | COG4485, COG4485, Predicted membrane protein [Func | 3e-07 | |
| COG4485 | 858 | COG4485, COG4485, Predicted membrane protein [Func | 3e-07 | |
| COG4485 | 858 | COG4485, COG4485, Predicted membrane protein [Func | 3e-07 | |
| COG4485 | 858 | COG4485, COG4485, Predicted membrane protein [Func | 3e-07 | |
| pfam02516 | 650 | pfam02516, STT3, Oligosaccharyl transferase STT3 s | 3e-07 | |
| pfam05297 | 382 | pfam05297, Herpes_LMP1, Herpesvirus latent membran | 3e-07 | |
| pfam05297 | 382 | pfam05297, Herpes_LMP1, Herpesvirus latent membran | 3e-07 | |
| pfam05297 | 382 | pfam05297, Herpes_LMP1, Herpesvirus latent membran | 3e-07 | |
| pfam05297 | 382 | pfam05297, Herpes_LMP1, Herpesvirus latent membran | 3e-07 | |
| pfam05297 | 382 | pfam05297, Herpes_LMP1, Herpesvirus latent membran | 3e-07 | |
| pfam05297 | 382 | pfam05297, Herpes_LMP1, Herpesvirus latent membran | 3e-07 | |
| pfam05297 | 382 | pfam05297, Herpes_LMP1, Herpesvirus latent membran | 3e-07 | |
| pfam05297 | 382 | pfam05297, Herpes_LMP1, Herpesvirus latent membran | 3e-07 | |
| pfam05297 | 382 | pfam05297, Herpes_LMP1, Herpesvirus latent membran | 3e-07 | |
| pfam05297 | 382 | pfam05297, Herpes_LMP1, Herpesvirus latent membran | 3e-07 | |
| pfam05297 | 382 | pfam05297, Herpes_LMP1, Herpesvirus latent membran | 3e-07 | |
| pfam05297 | 382 | pfam05297, Herpes_LMP1, Herpesvirus latent membran | 3e-07 | |
| pfam05297 | 382 | pfam05297, Herpes_LMP1, Herpesvirus latent membran | 3e-07 | |
| COG1807 | 535 | COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transfe | 4e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 4e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 4e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 4e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 4e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 4e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 4e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 4e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 4e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 4e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 4e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 4e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 4e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 4e-07 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 4e-07 | |
| pfam05297 | 382 | pfam05297, Herpes_LMP1, Herpesvirus latent membran | 4e-07 | |
| COG2244 | 480 | COG2244, RfbX, Membrane protein involved in the ex | 5e-07 | |
| COG2244 | 480 | COG2244, RfbX, Membrane protein involved in the ex | 5e-07 | |
| COG2244 | 480 | COG2244, RfbX, Membrane protein involved in the ex | 5e-07 | |
| COG2244 | 480 | COG2244, RfbX, Membrane protein involved in the ex | 5e-07 | |
| COG2244 | 480 | COG2244, RfbX, Membrane protein involved in the ex | 5e-07 | |
| COG3307 | 424 | COG3307, RfaL, Lipid A core - O-antigen ligase and | 1e-06 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 1e-06 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 1e-06 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 1e-06 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 1e-06 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 1e-06 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 1e-06 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 1e-06 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 1e-06 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 1e-06 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 1e-06 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 1e-06 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 1e-06 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 1e-06 | |
| pfam02516 | 650 | pfam02516, STT3, Oligosaccharyl transferase STT3 s | 1e-06 | |
| pfam02516 | 650 | pfam02516, STT3, Oligosaccharyl transferase STT3 s | 1e-06 | |
| pfam02516 | 650 | pfam02516, STT3, Oligosaccharyl transferase STT3 s | 1e-06 | |
| COG2244 | 480 | COG2244, RfbX, Membrane protein involved in the ex | 1e-06 | |
| MTH00163 | 445 | MTH00163, ND4, NADH dehydrogenase subunit 4; Provi | 1e-06 | |
| COG1835 | 386 | COG1835, COG1835, Predicted acyltransferases [Lipi | 1e-06 | |
| COG1835 | 386 | COG1835, COG1835, Predicted acyltransferases [Lipi | 1e-06 | |
| COG1835 | 386 | COG1835, COG1835, Predicted acyltransferases [Lipi | 1e-06 | |
| COG1835 | 386 | COG1835, COG1835, Predicted acyltransferases [Lipi | 1e-06 | |
| COG1835 | 386 | COG1835, COG1835, Predicted acyltransferases [Lipi | 1e-06 | |
| COG0474 | 917 | COG0474, MgtA, Cation transport ATPase [Inorganic | 1e-06 | |
| COG1807 | 535 | COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transfe | 2e-06 | |
| pfam03699 | 771 | pfam03699, UPF0182, Uncharacterized protein family | 2e-06 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 2e-06 | |
| COG4485 | 858 | COG4485, COG4485, Predicted membrane protein [Func | 2e-06 | |
| pfam02516 | 650 | pfam02516, STT3, Oligosaccharyl transferase STT3 s | 2e-06 | |
| COG2244 | 480 | COG2244, RfbX, Membrane protein involved in the ex | 2e-06 | |
| MTH00163 | 445 | MTH00163, ND4, NADH dehydrogenase subunit 4; Provi | 2e-06 | |
| MTH00163 | 445 | MTH00163, ND4, NADH dehydrogenase subunit 4; Provi | 2e-06 | |
| MTH00163 | 445 | MTH00163, ND4, NADH dehydrogenase subunit 4; Provi | 2e-06 | |
| MTH00163 | 445 | MTH00163, ND4, NADH dehydrogenase subunit 4; Provi | 2e-06 | |
| MTH00163 | 445 | MTH00163, ND4, NADH dehydrogenase subunit 4; Provi | 2e-06 | |
| MTH00163 | 445 | MTH00163, ND4, NADH dehydrogenase subunit 4; Provi | 2e-06 | |
| MTH00095 | 527 | MTH00095, ND5, NADH dehydrogenase subunit 5; Provi | 2e-06 | |
| pfam14351 | 321 | pfam14351, DUF4401, Domain of unknown function (DU | 2e-06 | |
| COG0658 | 453 | COG0658, ComEC, Predicted membrane metal-binding p | 2e-06 | |
| COG0658 | 453 | COG0658, ComEC, Predicted membrane metal-binding p | 2e-06 | |
| COG0658 | 453 | COG0658, ComEC, Predicted membrane metal-binding p | 2e-06 | |
| COG0658 | 453 | COG0658, ComEC, Predicted membrane metal-binding p | 2e-06 | |
| COG4585 | 365 | COG4585, COG4585, Signal transduction histidine ki | 3e-06 | |
| pfam14351 | 321 | pfam14351, DUF4401, Domain of unknown function (DU | 3e-06 | |
| pfam14351 | 321 | pfam14351, DUF4401, Domain of unknown function (DU | 3e-06 | |
| COG0658 | 453 | COG0658, ComEC, Predicted membrane metal-binding p | 3e-06 | |
| TIGR04286 | 920 | TIGR04286, MSEP-CTERM, MSEP-CTERM protein | 3e-06 | |
| COG1287 | 773 | COG1287, COG1287, Uncharacterized membrane protein | 4e-06 | |
| MTH00095 | 527 | MTH00095, ND5, NADH dehydrogenase subunit 5; Provi | 4e-06 | |
| TIGR04286 | 920 | TIGR04286, MSEP-CTERM, MSEP-CTERM protein | 4e-06 | |
| TIGR04286 | 920 | TIGR04286, MSEP-CTERM, MSEP-CTERM protein | 4e-06 | |
| COG3264 | 835 | COG3264, COG3264, Small-conductance mechanosensiti | 4e-06 | |
| MTH00163 | 445 | MTH00163, ND4, NADH dehydrogenase subunit 4; Provi | 5e-06 | |
| MTH00163 | 445 | MTH00163, ND4, NADH dehydrogenase subunit 4; Provi | 5e-06 | |
| MTH00163 | 445 | MTH00163, ND4, NADH dehydrogenase subunit 4; Provi | 5e-06 | |
| COG0474 | 917 | COG0474, MgtA, Cation transport ATPase [Inorganic | 5e-06 | |
| COG0474 | 917 | COG0474, MgtA, Cation transport ATPase [Inorganic | 5e-06 | |
| COG0474 | 917 | COG0474, MgtA, Cation transport ATPase [Inorganic | 5e-06 | |
| COG0474 | 917 | COG0474, MgtA, Cation transport ATPase [Inorganic | 5e-06 | |
| COG0474 | 917 | COG0474, MgtA, Cation transport ATPase [Inorganic | 5e-06 | |
| COG0474 | 917 | COG0474, MgtA, Cation transport ATPase [Inorganic | 5e-06 | |
| COG0474 | 917 | COG0474, MgtA, Cation transport ATPase [Inorganic | 5e-06 | |
| COG0474 | 917 | COG0474, MgtA, Cation transport ATPase [Inorganic | 5e-06 | |
| COG0474 | 917 | COG0474, MgtA, Cation transport ATPase [Inorganic | 5e-06 | |
| COG0474 | 917 | COG0474, MgtA, Cation transport ATPase [Inorganic | 5e-06 | |
| COG0474 | 917 | COG0474, MgtA, Cation transport ATPase [Inorganic | 5e-06 | |
| MTH00163 | 445 | MTH00163, ND4, NADH dehydrogenase subunit 4; Provi | 7e-06 | |
| COG1835 | 386 | COG1835, COG1835, Predicted acyltransferases [Lipi | 7e-06 | |
| TIGR04286 | 920 | TIGR04286, MSEP-CTERM, MSEP-CTERM protein | 7e-06 | |
| COG1368 | 650 | COG1368, MdoB, Phosphoglycerol transferase and rel | 8e-06 | |
| COG0474 | 917 | COG0474, MgtA, Cation transport ATPase [Inorganic | 8e-06 | |
| COG3307 | 424 | COG3307, RfaL, Lipid A core - O-antigen ligase and | 9e-06 | |
| COG4485 | 858 | COG4485, COG4485, Predicted membrane protein [Func | 9e-06 | |
| pfam05297 | 382 | pfam05297, Herpes_LMP1, Herpesvirus latent membran | 9e-06 | |
| TIGR04286 | 920 | TIGR04286, MSEP-CTERM, MSEP-CTERM protein | 9e-06 | |
| pfam03699 | 771 | pfam03699, UPF0182, Uncharacterized protein family | 1e-05 | |
| COG0815 | 518 | COG0815, Lnt, Apolipoprotein N-acyltransferase [Ce | 1e-05 | |
| pfam02516 | 650 | pfam02516, STT3, Oligosaccharyl transferase STT3 s | 1e-05 | |
| pfam02516 | 650 | pfam02516, STT3, Oligosaccharyl transferase STT3 s | 1e-05 | |
| pfam02516 | 650 | pfam02516, STT3, Oligosaccharyl transferase STT3 s | 1e-05 | |
| pfam02516 | 650 | pfam02516, STT3, Oligosaccharyl transferase STT3 s | 1e-05 | |
| pfam02516 | 650 | pfam02516, STT3, Oligosaccharyl transferase STT3 s | 1e-05 | |
| pfam02516 | 650 | pfam02516, STT3, Oligosaccharyl transferase STT3 s | 1e-05 | |
| pfam02516 | 650 | pfam02516, STT3, Oligosaccharyl transferase STT3 s | 1e-05 | |
| MTH00163 | 445 | MTH00163, ND4, NADH dehydrogenase subunit 4; Provi | 1e-05 | |
| MTH00163 | 445 | MTH00163, ND4, NADH dehydrogenase subunit 4; Provi | 1e-05 | |
| pfam14351 | 321 | pfam14351, DUF4401, Domain of unknown function (DU | 1e-05 | |
| COG3307 | 424 | COG3307, RfaL, Lipid A core - O-antigen ligase and | 2e-05 | |
| MTH00163 | 445 | MTH00163, ND4, NADH dehydrogenase subunit 4; Provi | 2e-05 | |
| MTH00163 | 445 | MTH00163, ND4, NADH dehydrogenase subunit 4; Provi | 2e-05 | |
| pfam14351 | 321 | pfam14351, DUF4401, Domain of unknown function (DU | 2e-05 | |
| COG3264 | 835 | COG3264, COG3264, Small-conductance mechanosensiti | 2e-05 | |
| cd06174 | 352 | cd06174, MFS, The Major Facilitator Superfamily (M | 2e-05 | |
| COG3356 | 578 | COG3356, COG3356, Predicted membrane protein [Func | 2e-05 | |
| COG3307 | 424 | COG3307, RfaL, Lipid A core - O-antigen ligase and | 3e-05 | |
| COG0815 | 518 | COG0815, Lnt, Apolipoprotein N-acyltransferase [Ce | 3e-05 | |
| COG3264 | 835 | COG3264, COG3264, Small-conductance mechanosensiti | 3e-05 | |
| MTH00091 | 273 | MTH00091, ND2, NADH dehydrogenase subunit 2; Provi | 3e-05 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 3e-05 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 3e-05 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 3e-05 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 3e-05 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 3e-05 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 3e-05 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 3e-05 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 3e-05 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 3e-05 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 3e-05 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 3e-05 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 3e-05 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 3e-05 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 3e-05 | |
| pfam09586 | 835 | pfam09586, YfhO, Bacterial membrane protein YfhO | 4e-05 | |
| COG3307 | 424 | COG3307, RfaL, Lipid A core - O-antigen ligase and | 4e-05 | |
| COG0474 | 917 | COG0474, MgtA, Cation transport ATPase [Inorganic | 4e-05 | |
| COG0474 | 917 | COG0474, MgtA, Cation transport ATPase [Inorganic | 4e-05 | |
| pfam14351 | 321 | pfam14351, DUF4401, Domain of unknown function (DU | 4e-05 | |
| cd06174 | 352 | cd06174, MFS, The Major Facilitator Superfamily (M | 4e-05 | |
| COG3356 | 578 | COG3356, COG3356, Predicted membrane protein [Func | 4e-05 | |
| COG3356 | 578 | COG3356, COG3356, Predicted membrane protein [Func | 4e-05 | |
| COG3356 | 578 | COG3356, COG3356, Predicted membrane protein [Func | 4e-05 | |
| COG3356 | 578 | COG3356, COG3356, Predicted membrane protein [Func | 4e-05 | |
| COG3356 | 578 | COG3356, COG3356, Predicted membrane protein [Func | 4e-05 | |
| COG3356 | 578 | COG3356, COG3356, Predicted membrane protein [Func | 4e-05 | |
| COG0658 | 453 | COG0658, ComEC, Predicted membrane metal-binding p | 5e-05 | |
| COG4984 | 644 | COG4984, COG4984, Predicted membrane protein [Func | 5e-05 | |
| COG2194 | 555 | COG2194, COG2194, Predicted membrane-associated, m | 6e-05 | |
| pfam14351 | 321 | pfam14351, DUF4401, Domain of unknown function (DU | 6e-05 | |
| COG3356 | 578 | COG3356, COG3356, Predicted membrane protein [Func | 6e-05 | |
| TIGR03766 | 483 | TIGR03766, TIGR03766, conserved hypothetical integ | 6e-05 | |
| TIGR03766 | 483 | TIGR03766, TIGR03766, conserved hypothetical integ | 6e-05 | |
| COG1480 | 700 | COG1480, COG1480, Predicted membrane-associated HD | 6e-05 | |
| COG1480 | 700 | COG1480, COG1480, Predicted membrane-associated HD | 6e-05 | |
| COG1480 | 700 | COG1480, COG1480, Predicted membrane-associated HD | 6e-05 | |
| COG1480 | 700 | COG1480, COG1480, Predicted membrane-associated HD | 6e-05 | |
| COG1480 | 700 | COG1480, COG1480, Predicted membrane-associated HD | 6e-05 | |
| COG1480 | 700 | COG1480, COG1480, Predicted membrane-associated HD | 6e-05 | |
| COG1480 | 700 | COG1480, COG1480, Predicted membrane-associated HD | 6e-05 | |
| COG1480 | 700 | COG1480, COG1480, Predicted membrane-associated HD | 6e-05 | |
| COG1480 | 700 | COG1480, COG1480, Predicted membrane-associated HD | 6e-05 | |
| COG1480 | 700 | COG1480, COG1480, Predicted membrane-associated HD | 6e-05 | |
| COG1480 | 700 | COG1480, COG1480, Predicted membrane-associated HD | 6e-05 | |
| PRK00302 | 505 | PRK00302, lnt, apolipoprotein N-acyltransferase; R | 6e-05 | |
| PRK00302 | 505 | PRK00302, lnt, apolipoprotein N-acyltransferase; R | 6e-05 | |
| PRK00302 | 505 | PRK00302, lnt, apolipoprotein N-acyltransferase; R | 6e-05 | |
| COG1835 | 386 | COG1835, COG1835, Predicted acyltransferases [Lipi | 7e-05 | |
| COG1480 | 700 | COG1480, COG1480, Predicted membrane-associated HD | 7e-05 | |
| COG1480 | 700 | COG1480, COG1480, Predicted membrane-associated HD | 7e-05 | |
| COG1480 | 700 | COG1480, COG1480, Predicted membrane-associated HD | 7e-05 | |
| COG1480 | 700 | COG1480, COG1480, Predicted membrane-associated HD | 7e-05 | |
| COG1480 | 700 | COG1480, COG1480, Predicted membrane-associated HD | 8e-05 | |
| COG0348 | 386 | COG0348, NapH, Polyferredoxin [Energy production a | 8e-05 | |
| COG0348 | 386 | COG0348, NapH, Polyferredoxin [Energy production a | 8e-05 | |
| COG0348 | 386 | COG0348, NapH, Polyferredoxin [Energy production a | 8e-05 | |
| COG0348 | 386 | COG0348, NapH, Polyferredoxin [Energy production a | 8e-05 | |
| COG0348 | 386 | COG0348, NapH, Polyferredoxin [Energy production a | 8e-05 | |
| COG1030 | 436 | COG1030, NfeD, Membrane-bound serine protease (Clp | 8e-05 | |
| COG1030 | 436 | COG1030, NfeD, Membrane-bound serine protease (Clp | 8e-05 | |
| COG1030 | 436 | COG1030, NfeD, Membrane-bound serine protease (Clp | 8e-05 | |
| COG1030 | 436 | COG1030, NfeD, Membrane-bound serine protease (Clp | 8e-05 | |
| COG1030 | 436 | COG1030, NfeD, Membrane-bound serine protease (Clp | 8e-05 | |
| COG1030 | 436 | COG1030, NfeD, Membrane-bound serine protease (Clp | 8e-05 | |
| COG1030 | 436 | COG1030, NfeD, Membrane-bound serine protease (Clp | 8e-05 | |
| COG1030 | 436 | COG1030, NfeD, Membrane-bound serine protease (Clp | 8e-05 | |
| COG1030 | 436 | COG1030, NfeD, Membrane-bound serine protease (Clp | 8e-05 | |
| COG1030 | 436 | COG1030, NfeD, Membrane-bound serine protease (Clp | 8e-05 | |
| COG1030 | 436 | COG1030, NfeD, Membrane-bound serine protease (Clp | 8e-05 | |
| COG1030 | 436 | COG1030, NfeD, Membrane-bound serine protease (Clp | 8e-05 | |
| COG1030 | 436 | COG1030, NfeD, Membrane-bound serine protease (Clp | 8e-05 | |
| COG1030 | 436 | COG1030, NfeD, Membrane-bound serine protease (Clp | 8e-05 | |
| pfam02516 | 650 | pfam02516, STT3, Oligosaccharyl transferase STT3 s | 9e-05 | |
| COG0531 | 466 | COG0531, PotE, Amino acid transporters [Amino acid | 9e-05 | |
| COG0531 | 466 | COG0531, PotE, Amino acid transporters [Amino acid | 9e-05 | |
| COG0531 | 466 | COG0531, PotE, Amino acid transporters [Amino acid | 9e-05 | |
| COG0531 | 466 | COG0531, PotE, Amino acid transporters [Amino acid | 9e-05 | |
| COG0531 | 466 | COG0531, PotE, Amino acid transporters [Amino acid | 9e-05 | |
| COG3594 | 343 | COG3594, NolL, Fucose 4-O-acetylase and related ac | 9e-05 | |
| COG3594 | 343 | COG3594, NolL, Fucose 4-O-acetylase and related ac | 9e-05 | |
| pfam03699 | 771 | pfam03699, UPF0182, Uncharacterized protein family | 1e-04 | |
| MTH00095 | 527 | MTH00095, ND5, NADH dehydrogenase subunit 5; Provi | 1e-04 | |
| cd06174 | 352 | cd06174, MFS, The Major Facilitator Superfamily (M | 1e-04 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 1e-04 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 1e-04 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 1e-04 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 1e-04 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 1e-04 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 1e-04 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 1e-04 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 1e-04 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 1e-04 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 1e-04 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 1e-04 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 1e-04 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 1e-04 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 1e-04 | |
| TIGR03766 | 483 | TIGR03766, TIGR03766, conserved hypothetical integ | 1e-04 | |
| TIGR03766 | 483 | TIGR03766, TIGR03766, conserved hypothetical integ | 1e-04 | |
| COG0531 | 466 | COG0531, PotE, Amino acid transporters [Amino acid | 1e-04 | |
| COG0531 | 466 | COG0531, PotE, Amino acid transporters [Amino acid | 1e-04 | |
| COG0531 | 466 | COG0531, PotE, Amino acid transporters [Amino acid | 1e-04 | |
| COG0531 | 466 | COG0531, PotE, Amino acid transporters [Amino acid | 1e-04 | |
| COG2194 | 555 | COG2194, COG2194, Predicted membrane-associated, m | 2e-04 | |
| COG2244 | 480 | COG2244, RfbX, Membrane protein involved in the ex | 2e-04 | |
| MTH00163 | 445 | MTH00163, ND4, NADH dehydrogenase subunit 4; Provi | 2e-04 | |
| COG1835 | 386 | COG1835, COG1835, Predicted acyltransferases [Lipi | 2e-04 | |
| cd06174 | 352 | cd06174, MFS, The Major Facilitator Superfamily (M | 2e-04 | |
| cd06174 | 352 | cd06174, MFS, The Major Facilitator Superfamily (M | 2e-04 | |
| cd06174 | 352 | cd06174, MFS, The Major Facilitator Superfamily (M | 2e-04 | |
| MTH00091 | 273 | MTH00091, ND2, NADH dehydrogenase subunit 2; Provi | 2e-04 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 2e-04 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 2e-04 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 2e-04 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 2e-04 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 2e-04 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 2e-04 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 2e-04 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 2e-04 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 2e-04 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 2e-04 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 2e-04 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 2e-04 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 2e-04 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 2e-04 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 2e-04 | |
| TIGR03025 | 445 | TIGR03025, EPS_sugtrans, exopolysaccharide biosynt | 2e-04 | |
| PRK00302 | 505 | PRK00302, lnt, apolipoprotein N-acyltransferase; R | 2e-04 | |
| COG0531 | 466 | COG0531, PotE, Amino acid transporters [Amino acid | 2e-04 | |
| pfam11992 | 321 | pfam11992, DUF3488, Domain of unknown function (DU | 2e-04 | |
| pfam07992 | 283 | pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp | 2e-04 | |
| TIGR03023 | 451 | TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g | 2e-04 | |
| TIGR03023 | 451 | TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g | 2e-04 | |
| TIGR03023 | 451 | TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g | 2e-04 | |
| TIGR03023 | 451 | TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g | 2e-04 | |
| TIGR03023 | 451 | TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g | 2e-04 | |
| TIGR03023 | 451 | TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g | 2e-04 | |
| TIGR03023 | 451 | TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g | 2e-04 | |
| TIGR03023 | 451 | TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g | 2e-04 | |
| TIGR03023 | 451 | TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g | 2e-04 | |
| TIGR03023 | 451 | TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g | 2e-04 | |
| TIGR03023 | 451 | TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g | 2e-04 | |
| TIGR03023 | 451 | TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g | 2e-04 | |
| TIGR03023 | 451 | TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g | 2e-04 | |
| TIGR03023 | 451 | TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g | 2e-04 | |
| MTH00091 | 273 | MTH00091, ND2, NADH dehydrogenase subunit 2; Provi | 3e-04 | |
| MTH00091 | 273 | MTH00091, ND2, NADH dehydrogenase subunit 2; Provi | 3e-04 | |
| MTH00091 | 273 | MTH00091, ND2, NADH dehydrogenase subunit 2; Provi | 3e-04 | |
| MTH00091 | 273 | MTH00091, ND2, NADH dehydrogenase subunit 2; Provi | 3e-04 | |
| MTH00091 | 273 | MTH00091, ND2, NADH dehydrogenase subunit 2; Provi | 3e-04 | |
| MTH00091 | 273 | MTH00091, ND2, NADH dehydrogenase subunit 2; Provi | 3e-04 | |
| MTH00091 | 273 | MTH00091, ND2, NADH dehydrogenase subunit 2; Provi | 3e-04 | |
| MTH00091 | 273 | MTH00091, ND2, NADH dehydrogenase subunit 2; Provi | 3e-04 | |
| COG4984 | 644 | COG4984, COG4984, Predicted membrane protein [Func | 3e-04 | |
| TIGR03766 | 483 | TIGR03766, TIGR03766, conserved hypothetical integ | 3e-04 | |
| TIGR03766 | 483 | TIGR03766, TIGR03766, conserved hypothetical integ | 3e-04 | |
| COG3594 | 343 | COG3594, NolL, Fucose 4-O-acetylase and related ac | 3e-04 | |
| pfam03772 | 270 | pfam03772, Competence, Competence protein | 3e-04 | |
| pfam03772 | 270 | pfam03772, Competence, Competence protein | 3e-04 | |
| pfam03772 | 270 | pfam03772, Competence, Competence protein | 3e-04 | |
| pfam03772 | 270 | pfam03772, Competence, Competence protein | 3e-04 | |
| pfam03772 | 270 | pfam03772, Competence, Competence protein | 3e-04 | |
| pfam03772 | 270 | pfam03772, Competence, Competence protein | 3e-04 | |
| pfam03772 | 270 | pfam03772, Competence, Competence protein | 3e-04 | |
| pfam03772 | 270 | pfam03772, Competence, Competence protein | 3e-04 | |
| COG2898 | 538 | COG2898, COG2898, Uncharacterized conserved protei | 3e-04 | |
| pfam01757 | 326 | pfam01757, Acyl_transf_3, Acyltransferase family | 3e-04 | |
| pfam01757 | 326 | pfam01757, Acyl_transf_3, Acyltransferase family | 3e-04 | |
| pfam01757 | 326 | pfam01757, Acyl_transf_3, Acyltransferase family | 3e-04 | |
| pfam01757 | 326 | pfam01757, Acyl_transf_3, Acyltransferase family | 3e-04 | |
| pfam01757 | 326 | pfam01757, Acyl_transf_3, Acyltransferase family | 3e-04 | |
| COG1132 | 567 | COG1132, MdlB, ABC-type multidrug transport system | 3e-04 | |
| COG1132 | 567 | COG1132, MdlB, ABC-type multidrug transport system | 3e-04 | |
| COG1132 | 567 | COG1132, MdlB, ABC-type multidrug transport system | 3e-04 | |
| COG1132 | 567 | COG1132, MdlB, ABC-type multidrug transport system | 3e-04 | |
| COG1132 | 567 | COG1132, MdlB, ABC-type multidrug transport system | 3e-04 | |
| COG1132 | 567 | COG1132, MdlB, ABC-type multidrug transport system | 3e-04 | |
| COG1132 | 567 | COG1132, MdlB, ABC-type multidrug transport system | 3e-04 | |
| COG1132 | 567 | COG1132, MdlB, ABC-type multidrug transport system | 3e-04 | |
| COG1132 | 567 | COG1132, MdlB, ABC-type multidrug transport system | 3e-04 | |
| COG1132 | 567 | COG1132, MdlB, ABC-type multidrug transport system | 3e-04 | |
| COG1132 | 567 | COG1132, MdlB, ABC-type multidrug transport system | 3e-04 | |
| COG1132 | 567 | COG1132, MdlB, ABC-type multidrug transport system | 3e-04 | |
| pfam03901 | 412 | pfam03901, Glyco_transf_22, Alg9-like mannosyltran | 3e-04 | |
| pfam03901 | 412 | pfam03901, Glyco_transf_22, Alg9-like mannosyltran | 3e-04 | |
| TIGR01654 | 679 | TIGR01654, bact_immun_7tm, bacteriocin-associated | 3e-04 | |
| TIGR01654 | 679 | TIGR01654, bact_immun_7tm, bacteriocin-associated | 3e-04 | |
| TIGR01654 | 679 | TIGR01654, bact_immun_7tm, bacteriocin-associated | 3e-04 | |
| TIGR01654 | 679 | TIGR01654, bact_immun_7tm, bacteriocin-associated | 3e-04 | |
| TIGR01654 | 679 | TIGR01654, bact_immun_7tm, bacteriocin-associated | 3e-04 | |
| TIGR01654 | 679 | TIGR01654, bact_immun_7tm, bacteriocin-associated | 3e-04 | |
| TIGR01654 | 679 | TIGR01654, bact_immun_7tm, bacteriocin-associated | 3e-04 | |
| pfam02516 | 650 | pfam02516, STT3, Oligosaccharyl transferase STT3 s | 4e-04 | |
| COG0348 | 386 | COG0348, NapH, Polyferredoxin [Energy production a | 4e-04 | |
| COG0348 | 386 | COG0348, NapH, Polyferredoxin [Energy production a | 4e-04 | |
| COG0348 | 386 | COG0348, NapH, Polyferredoxin [Energy production a | 4e-04 | |
| COG3594 | 343 | COG3594, NolL, Fucose 4-O-acetylase and related ac | 4e-04 | |
| pfam11992 | 321 | pfam11992, DUF3488, Domain of unknown function (DU | 4e-04 | |
| pfam11992 | 321 | pfam11992, DUF3488, Domain of unknown function (DU | 4e-04 | |
| pfam11992 | 321 | pfam11992, DUF3488, Domain of unknown function (DU | 4e-04 | |
| pfam11992 | 321 | pfam11992, DUF3488, Domain of unknown function (DU | 4e-04 | |
| pfam11992 | 321 | pfam11992, DUF3488, Domain of unknown function (DU | 4e-04 | |
| pfam11992 | 321 | pfam11992, DUF3488, Domain of unknown function (DU | 4e-04 | |
| pfam11992 | 321 | pfam11992, DUF3488, Domain of unknown function (DU | 4e-04 | |
| pfam11992 | 321 | pfam11992, DUF3488, Domain of unknown function (DU | 4e-04 | |
| pfam11992 | 321 | pfam11992, DUF3488, Domain of unknown function (DU | 4e-04 | |
| pfam11992 | 321 | pfam11992, DUF3488, Domain of unknown function (DU | 4e-04 | |
| pfam11992 | 321 | pfam11992, DUF3488, Domain of unknown function (DU | 4e-04 | |
| pfam11992 | 321 | pfam11992, DUF3488, Domain of unknown function (DU | 4e-04 | |
| pfam11992 | 321 | pfam11992, DUF3488, Domain of unknown function (DU | 4e-04 | |
| TIGR03023 | 451 | TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g | 4e-04 | |
| TIGR03023 | 451 | TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g | 4e-04 | |
| TIGR03023 | 451 | TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g | 4e-04 | |
| TIGR03023 | 451 | TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g | 4e-04 | |
| TIGR03023 | 451 | TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g | 4e-04 | |
| TIGR03023 | 451 | TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g | 4e-04 | |
| TIGR03023 | 451 | TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g | 4e-04 | |
| TIGR03023 | 451 | TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g | 4e-04 | |
| TIGR03023 | 451 | TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g | 4e-04 | |
| TIGR03023 | 451 | TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g | 4e-04 | |
| TIGR03023 | 451 | TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g | 4e-04 | |
| TIGR03023 | 451 | TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g | 4e-04 | |
| TIGR03023 | 451 | TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g | 4e-04 | |
| TIGR03023 | 451 | TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g | 4e-04 | |
| COG2898 | 538 | COG2898, COG2898, Uncharacterized conserved protei | 4e-04 | |
| COG2898 | 538 | COG2898, COG2898, Uncharacterized conserved protei | 4e-04 | |
| COG2898 | 538 | COG2898, COG2898, Uncharacterized conserved protei | 4e-04 | |
| COG2898 | 538 | COG2898, COG2898, Uncharacterized conserved protei | 4e-04 | |
| COG1215 | 439 | COG1215, COG1215, Glycosyltransferases, probably i | 4e-04 | |
| COG1215 | 439 | COG1215, COG1215, Glycosyltransferases, probably i | 4e-04 | |
| COG1215 | 439 | COG1215, COG1215, Glycosyltransferases, probably i | 4e-04 | |
| COG1215 | 439 | COG1215, COG1215, Glycosyltransferases, probably i | 4e-04 | |
| COG1215 | 439 | COG1215, COG1215, Glycosyltransferases, probably i | 4e-04 | |
| COG1215 | 439 | COG1215, COG1215, Glycosyltransferases, probably i | 4e-04 | |
| COG1215 | 439 | COG1215, COG1215, Glycosyltransferases, probably i | 4e-04 | |
| COG1215 | 439 | COG1215, COG1215, Glycosyltransferases, probably i | 4e-04 | |
| COG1215 | 439 | COG1215, COG1215, Glycosyltransferases, probably i | 4e-04 | |
| COG1215 | 439 | COG1215, COG1215, Glycosyltransferases, probably i | 4e-04 | |
| COG1215 | 439 | COG1215, COG1215, Glycosyltransferases, probably i | 4e-04 | |
| COG1215 | 439 | COG1215, COG1215, Glycosyltransferases, probably i | 4e-04 | |
| COG1215 | 439 | COG1215, COG1215, Glycosyltransferases, probably i | 4e-04 | |
| PRK06370 | 463 | PRK06370, PRK06370, mercuric reductase; Validated | 4e-04 | |
| COG5305 | 552 | COG5305, COG5305, Predicted membrane protein [Func | 4e-04 | |
| COG2244 | 480 | COG2244, RfbX, Membrane protein involved in the ex | 5e-04 | |
| MTH00163 | 445 | MTH00163, ND4, NADH dehydrogenase subunit 4; Provi | 5e-04 | |
| COG1030 | 436 | COG1030, NfeD, Membrane-bound serine protease (Clp | 5e-04 | |
| TIGR03023 | 451 | TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g | 5e-04 | |
| pfam03772 | 270 | pfam03772, Competence, Competence protein | 5e-04 | |
| pfam03772 | 270 | pfam03772, Competence, Competence protein | 5e-04 | |
| pfam03772 | 270 | pfam03772, Competence, Competence protein | 5e-04 | |
| pfam03772 | 270 | pfam03772, Competence, Competence protein | 5e-04 | |
| COG2898 | 538 | COG2898, COG2898, Uncharacterized conserved protei | 5e-04 | |
| COG2898 | 538 | COG2898, COG2898, Uncharacterized conserved protei | 5e-04 | |
| COG5305 | 552 | COG5305, COG5305, Predicted membrane protein [Func | 5e-04 | |
| pfam14264 | 317 | pfam14264, Glucos_trans_II, Glucosyl transferase G | 5e-04 | |
| pfam14264 | 317 | pfam14264, Glucos_trans_II, Glucosyl transferase G | 5e-04 | |
| pfam14264 | 317 | pfam14264, Glucos_trans_II, Glucosyl transferase G | 5e-04 | |
| pfam14264 | 317 | pfam14264, Glucos_trans_II, Glucosyl transferase G | 5e-04 | |
| pfam14264 | 317 | pfam14264, Glucos_trans_II, Glucosyl transferase G | 5e-04 | |
| pfam14264 | 317 | pfam14264, Glucos_trans_II, Glucosyl transferase G | 5e-04 | |
| pfam14264 | 317 | pfam14264, Glucos_trans_II, Glucosyl transferase G | 5e-04 | |
| pfam14264 | 317 | pfam14264, Glucos_trans_II, Glucosyl transferase G | 5e-04 | |
| pfam14264 | 317 | pfam14264, Glucos_trans_II, Glucosyl transferase G | 5e-04 | |
| COG4393 | 405 | COG4393, COG4393, Predicted membrane protein [Func | 5e-04 | |
| COG1377 | 363 | COG1377, FlhB, Flagellar biosynthesis pathway, com | 5e-04 | |
| COG1377 | 363 | COG1377, FlhB, Flagellar biosynthesis pathway, com | 5e-04 | |
| COG1377 | 363 | COG1377, FlhB, Flagellar biosynthesis pathway, com | 5e-04 | |
| COG1377 | 363 | COG1377, FlhB, Flagellar biosynthesis pathway, com | 5e-04 | |
| COG1377 | 363 | COG1377, FlhB, Flagellar biosynthesis pathway, com | 5e-04 | |
| COG3264 | 835 | COG3264, COG3264, Small-conductance mechanosensiti | 6e-04 | |
| COG3594 | 343 | COG3594, NolL, Fucose 4-O-acetylase and related ac | 6e-04 | |
| pfam03772 | 270 | pfam03772, Competence, Competence protein | 6e-04 | |
| COG1215 | 439 | COG1215, COG1215, Glycosyltransferases, probably i | 6e-04 | |
| TIGR03766 | 483 | TIGR03766, TIGR03766, conserved hypothetical integ | 7e-04 | |
| TIGR03766 | 483 | TIGR03766, TIGR03766, conserved hypothetical integ | 7e-04 | |
| COG1132 | 567 | COG1132, MdlB, ABC-type multidrug transport system | 7e-04 | |
| pfam03699 | 771 | pfam03699, UPF0182, Uncharacterized protein family | 9e-04 | |
| pfam01757 | 326 | pfam01757, Acyl_transf_3, Acyltransferase family | 9e-04 | |
| pfam14351 | 321 | pfam14351, DUF4401, Domain of unknown function (DU | 0.001 | |
| pfam14351 | 321 | pfam14351, DUF4401, Domain of unknown function (DU | 0.001 | |
| COG0658 | 453 | COG0658, ComEC, Predicted membrane metal-binding p | 0.001 | |
| cd06174 | 352 | cd06174, MFS, The Major Facilitator Superfamily (M | 0.001 | |
| TIGR03766 | 483 | TIGR03766, TIGR03766, conserved hypothetical integ | 0.001 | |
| PRK00302 | 505 | PRK00302, lnt, apolipoprotein N-acyltransferase; R | 0.001 | |
| COG0531 | 466 | COG0531, PotE, Amino acid transporters [Amino acid | 0.001 | |
| COG3594 | 343 | COG3594, NolL, Fucose 4-O-acetylase and related ac | 0.001 | |
| COG2898 | 538 | COG2898, COG2898, Uncharacterized conserved protei | 0.001 | |
| pfam01757 | 326 | pfam01757, Acyl_transf_3, Acyltransferase family | 0.001 | |
| pfam01757 | 326 | pfam01757, Acyl_transf_3, Acyltransferase family | 0.001 | |
| COG1132 | 567 | COG1132, MdlB, ABC-type multidrug transport system | 0.001 | |
| MTH00165 | 573 | MTH00165, ND5, NADH dehydrogenase subunit 5; Provi | 0.001 | |
| MTH00165 | 573 | MTH00165, ND5, NADH dehydrogenase subunit 5; Provi | 0.001 | |
| MTH00165 | 573 | MTH00165, ND5, NADH dehydrogenase subunit 5; Provi | 0.001 | |
| MTH00165 | 573 | MTH00165, ND5, NADH dehydrogenase subunit 5; Provi | 0.001 | |
| MTH00165 | 573 | MTH00165, ND5, NADH dehydrogenase subunit 5; Provi | 0.001 | |
| MTH00165 | 573 | MTH00165, ND5, NADH dehydrogenase subunit 5; Provi | 0.001 | |
| MTH00165 | 573 | MTH00165, ND5, NADH dehydrogenase subunit 5; Provi | 0.001 | |
| MTH00165 | 573 | MTH00165, ND5, NADH dehydrogenase subunit 5; Provi | 0.001 | |
| MTH00165 | 573 | MTH00165, ND5, NADH dehydrogenase subunit 5; Provi | 0.001 | |
| MTH00165 | 573 | MTH00165, ND5, NADH dehydrogenase subunit 5; Provi | 0.001 | |
| MTH00165 | 573 | MTH00165, ND5, NADH dehydrogenase subunit 5; Provi | 0.001 | |
| MTH00165 | 573 | MTH00165, ND5, NADH dehydrogenase subunit 5; Provi | 0.001 | |
| COG0728 | 518 | COG0728, MviN, Uncharacterized membrane protein, p | 0.001 | |
| MTH00094 | 403 | MTH00094, ND4, NADH dehydrogenase subunit 4; Provi | 0.001 | |
| MTH00094 | 403 | MTH00094, ND4, NADH dehydrogenase subunit 4; Provi | 0.001 | |
| MTH00094 | 403 | MTH00094, ND4, NADH dehydrogenase subunit 4; Provi | 0.001 | |
| MTH00094 | 403 | MTH00094, ND4, NADH dehydrogenase subunit 4; Provi | 0.001 | |
| MTH00094 | 403 | MTH00094, ND4, NADH dehydrogenase subunit 4; Provi | 0.001 | |
| MTH00094 | 403 | MTH00094, ND4, NADH dehydrogenase subunit 4; Provi | 0.001 | |
| MTH00160 | 335 | MTH00160, ND2, NADH dehydrogenase subunit 2; Provi | 0.001 | |
| TIGR03766 | 483 | TIGR03766, TIGR03766, conserved hypothetical integ | 0.002 | |
| TIGR03766 | 483 | TIGR03766, TIGR03766, conserved hypothetical integ | 0.002 | |
| TIGR03766 | 483 | TIGR03766, TIGR03766, conserved hypothetical integ | 0.002 | |
| TIGR03766 | 483 | TIGR03766, TIGR03766, conserved hypothetical integ | 0.002 | |
| COG1480 | 700 | COG1480, COG1480, Predicted membrane-associated HD | 0.002 | |
| TIGR03023 | 451 | TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate g | 0.002 | |
| COG2898 | 538 | COG2898, COG2898, Uncharacterized conserved protei | 0.002 | |
| pfam03901 | 412 | pfam03901, Glyco_transf_22, Alg9-like mannosyltran | 0.002 | |
| pfam03901 | 412 | pfam03901, Glyco_transf_22, Alg9-like mannosyltran | 0.002 | |
| pfam03901 | 412 | pfam03901, Glyco_transf_22, Alg9-like mannosyltran | 0.002 | |
| COG1215 | 439 | COG1215, COG1215, Glycosyltransferases, probably i | 0.002 | |
| COG5305 | 552 | COG5305, COG5305, Predicted membrane protein [Func | 0.002 | |
| COG1377 | 363 | COG1377, FlhB, Flagellar biosynthesis pathway, com | 0.002 | |
| COG1377 | 363 | COG1377, FlhB, Flagellar biosynthesis pathway, com | 0.002 | |
| COG1377 | 363 | COG1377, FlhB, Flagellar biosynthesis pathway, com | 0.002 | |
| COG1377 | 363 | COG1377, FlhB, Flagellar biosynthesis pathway, com | 0.002 | |
| COG1377 | 363 | COG1377, FlhB, Flagellar biosynthesis pathway, com | 0.002 | |
| COG1377 | 363 | COG1377, FlhB, Flagellar biosynthesis pathway, com | 0.002 | |
| COG1377 | 363 | COG1377, FlhB, Flagellar biosynthesis pathway, com | 0.002 | |
| COG1377 | 363 | COG1377, FlhB, Flagellar biosynthesis pathway, com | 0.002 | |
| pfam05940 | 379 | pfam05940, NnrS, NnrS protein | 0.002 | |
| COG4652 | 657 | COG4652, COG4652, Uncharacterized protein conserve | 0.002 | |
| COG4652 | 657 | COG4652, COG4652, Uncharacterized protein conserve | 0.002 | |
| COG4652 | 657 | COG4652, COG4652, Uncharacterized protein conserve | 0.002 | |
| COG4652 | 657 | COG4652, COG4652, Uncharacterized protein conserve | 0.002 | |
| COG4652 | 657 | COG4652, COG4652, Uncharacterized protein conserve | 0.002 | |
| COG4652 | 657 | COG4652, COG4652, Uncharacterized protein conserve | 0.002 | |
| COG4652 | 657 | COG4652, COG4652, Uncharacterized protein conserve | 0.002 | |
| COG0392 | 322 | COG0392, COG0392, Predicted integral membrane prot | 0.002 | |
| TIGR00546 | 391 | TIGR00546, lnt, apolipoprotein N-acyltransferase | 0.002 | |
| COG1086 | 588 | COG1086, COG1086, Predicted nucleoside-diphosphate | 0.002 | |
| COG1835 | 386 | COG1835, COG1835, Predicted acyltransferases [Lipi | 0.003 | |
| COG4984 | 644 | COG4984, COG4984, Predicted membrane protein [Func | 0.003 | |
| COG1480 | 700 | COG1480, COG1480, Predicted membrane-associated HD | 0.003 | |
| COG0348 | 386 | COG0348, NapH, Polyferredoxin [Energy production a | 0.003 | |
| COG0348 | 386 | COG0348, NapH, Polyferredoxin [Energy production a | 0.003 | |
| COG0348 | 386 | COG0348, NapH, Polyferredoxin [Energy production a | 0.003 | |
| TIGR01654 | 679 | TIGR01654, bact_immun_7tm, bacteriocin-associated | 0.003 | |
| TIGR01654 | 679 | TIGR01654, bact_immun_7tm, bacteriocin-associated | 0.003 | |
| TIGR01654 | 679 | TIGR01654, bact_immun_7tm, bacteriocin-associated | 0.003 | |
| COG1377 | 363 | COG1377, FlhB, Flagellar biosynthesis pathway, com | 0.003 | |
| COG0728 | 518 | COG0728, MviN, Uncharacterized membrane protein, p | 0.003 | |
| COG0728 | 518 | COG0728, MviN, Uncharacterized membrane protein, p | 0.003 | |
| COG0728 | 518 | COG0728, MviN, Uncharacterized membrane protein, p | 0.003 | |
| COG0728 | 518 | COG0728, MviN, Uncharacterized membrane protein, p | 0.003 | |
| COG0728 | 518 | COG0728, MviN, Uncharacterized membrane protein, p | 0.003 | |
| pfam05940 | 379 | pfam05940, NnrS, NnrS protein | 0.003 | |
| COG0575 | 265 | COG0575, CdsA, CDP-diglyceride synthetase [Lipid m | 0.003 | |
| COG0575 | 265 | COG0575, CdsA, CDP-diglyceride synthetase [Lipid m | 0.003 | |
| COG0575 | 265 | COG0575, CdsA, CDP-diglyceride synthetase [Lipid m | 0.003 | |
| COG0575 | 265 | COG0575, CdsA, CDP-diglyceride synthetase [Lipid m | 0.003 | |
| COG0575 | 265 | COG0575, CdsA, CDP-diglyceride synthetase [Lipid m | 0.003 | |
| COG0575 | 265 | COG0575, CdsA, CDP-diglyceride synthetase [Lipid m | 0.003 | |
| COG0575 | 265 | COG0575, CdsA, CDP-diglyceride synthetase [Lipid m | 0.003 | |
| COG0575 | 265 | COG0575, CdsA, CDP-diglyceride synthetase [Lipid m | 0.003 | |
| COG0575 | 265 | COG0575, CdsA, CDP-diglyceride synthetase [Lipid m | 0.003 | |
| COG0575 | 265 | COG0575, CdsA, CDP-diglyceride synthetase [Lipid m | 0.003 | |
| COG0575 | 265 | COG0575, CdsA, CDP-diglyceride synthetase [Lipid m | 0.003 | |
| COG0575 | 265 | COG0575, CdsA, CDP-diglyceride synthetase [Lipid m | 0.003 | |
| COG0575 | 265 | COG0575, CdsA, CDP-diglyceride synthetase [Lipid m | 0.003 | |
| COG0575 | 265 | COG0575, CdsA, CDP-diglyceride synthetase [Lipid m | 0.003 | |
| PRK05702 | 359 | PRK05702, flhB, flagellar biosynthesis protein Flh | 0.003 | |
| PRK05702 | 359 | PRK05702, flhB, flagellar biosynthesis protein Flh | 0.003 | |
| PRK05702 | 359 | PRK05702, flhB, flagellar biosynthesis protein Flh | 0.003 | |
| PRK05702 | 359 | PRK05702, flhB, flagellar biosynthesis protein Flh | 0.003 | |
| COG3846 | 452 | COG3846, TrbL, Type IV secretory pathway, TrbL com | 0.003 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 0.003 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 0.003 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 0.003 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 0.003 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 0.003 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 0.003 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 0.003 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 0.003 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 0.003 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 0.003 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 0.003 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 0.003 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 0.003 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 0.003 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 0.003 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 0.003 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 0.003 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 0.003 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 0.003 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 0.003 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 0.003 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 0.003 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 0.003 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 0.003 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 0.003 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 0.003 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 0.003 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 0.003 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 0.003 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 0.003 | |
| pfam13779 | 820 | pfam13779, DUF4175, Domain of unknown function (DU | 0.003 | |
| MTH00091 | 273 | MTH00091, ND2, NADH dehydrogenase subunit 2; Provi | 0.004 | |
| TIGR03766 | 483 | TIGR03766, TIGR03766, conserved hypothetical integ | 0.004 | |
| COG1132 | 567 | COG1132, MdlB, ABC-type multidrug transport system | 0.004 | |
| COG1086 | 588 | COG1086, COG1086, Predicted nucleoside-diphosphate | 0.004 | |
| PRK05702 | 359 | PRK05702, flhB, flagellar biosynthesis protein Flh | 0.004 | |
| PRK05702 | 359 | PRK05702, flhB, flagellar biosynthesis protein Flh | 0.004 | |
| PRK05702 | 359 | PRK05702, flhB, flagellar biosynthesis protein Flh | 0.004 | |
| PRK05702 | 359 | PRK05702, flhB, flagellar biosynthesis protein Flh | 0.004 | |
| pfam09913 | 390 | pfam09913, DUF2142, Predicted membrane protein (DU | 0.004 | |
| PRK12291 | 418 | PRK12291, PRK12291, apolipoprotein N-acyltransfera | 0.004 | |
| PRK12291 | 418 | PRK12291, PRK12291, apolipoprotein N-acyltransfera | 0.004 | |
| PRK12291 | 418 | PRK12291, PRK12291, apolipoprotein N-acyltransfera | 0.004 | |
| COG5243 | 491 | COG5243, HRD1, HRD ubiquitin ligase complex, ER me | 0.004 | |
| COG5243 | 491 | COG5243, HRD1, HRD ubiquitin ligase complex, ER me | 0.004 | |
| COG5243 | 491 | COG5243, HRD1, HRD ubiquitin ligase complex, ER me | 0.004 | |
| COG5243 | 491 | COG5243, HRD1, HRD ubiquitin ligase complex, ER me | 0.004 | |
| COG5243 | 491 | COG5243, HRD1, HRD ubiquitin ligase complex, ER me | 0.004 | |
| pfam06728 | 373 | pfam06728, PIG-U, GPI transamidase subunit PIG-U | 0.004 |
| >gnl|CDD|235000 PRK02106, PRK02106, choline dehydrogenase; Validated | Back alignment and domain information |
|---|
Score = 244 bits (625), Expect = 1e-69
Identities = 121/306 (39%), Positives = 163/306 (53%), Gaps = 23/306 (7%)
Query: 163 FDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGG-DTPIHSRIPGMSSVLSL----SEFD 217
+D II+GA +AGCVLANRLSE + VLL+EAGG D I M + L+ ++
Sbjct: 6 YDYIIIGAGSAGCVLANRLSEDPDVSVLLLEAGGPDYRWDFFIQ-MPAALAFPLQGKRYN 64
Query: 218 HAYLAEPSQFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAKL-GYNGWG 276
AY EP N R++ GK LGGSS++ ++Y RG + DY+N+A+L G GW
Sbjct: 65 WAYETEPEPHMN----NRRMECPRGKVLGGSSSINGMVYIRGNAMDYDNWAELPGLEGWS 120
Query: 277 YDETLKYFVKSEDYRSVIYNESKAVHGTQGYLPVGLFK-NKENNIIREIFETSAQELGYP 335
Y + L YF K+E G G P+ + + N + + F + + GYP
Sbjct: 121 YADCLPYFKKAETR----DGGEDDYRGGDG--PLSVTRGKPGTNPLFQAFVEAGVQAGYP 174
Query: 336 CPKDMNDRYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRTNLYVLKRSKVTKVIINDQ 395
D+N Y GF + G R+SAA AYL P A KR NL ++ + +++ +
Sbjct: 175 RTDDLNG-YQQEGFGPMDRTVTNGRRWSAARAYLDP-ALKRPNLTIVTHALTDRILF-EG 231
Query: 396 NVATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQDLR 455
A GVEY G A +EVIL+AGAI + QLL LSGIGP HL E+ IPV DL
Sbjct: 232 KRAVGVEYER-GGGRETARARREVILSAGAINSPQLLQLSGIGPAEHLKELGIPVVHDLP 290
Query: 456 -VGENL 460
VGENL
Sbjct: 291 GVGENL 296
|
Length = 560 |
| >gnl|CDD|225186 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233581 TIGR01810, betA, choline dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|234421 TIGR03970, Rv0697, dehydrogenase, Rv0697 family | Back alignment and domain information |
|---|
| >gnl|CDD|216089 pfam00732, GMC_oxred_N, GMC oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|218493 pfam05199, GMC_oxred_C, GMC oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|215420 PLN02785, PLN02785, Protein HOTHEAD | Back alignment and domain information |
|---|
| >gnl|CDD|225186 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235000 PRK02106, PRK02106, choline dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|220569 pfam10101, DUF2339, Predicted membrane protein (DUF2339) | Back alignment and domain information |
|---|
| >gnl|CDD|220569 pfam10101, DUF2339, Predicted membrane protein (DUF2339) | Back alignment and domain information |
|---|
| >gnl|CDD|234421 TIGR03970, Rv0697, dehydrogenase, Rv0697 family | Back alignment and domain information |
|---|
| >gnl|CDD|220569 pfam10101, DUF2339, Predicted membrane protein (DUF2339) | Back alignment and domain information |
|---|
| >gnl|CDD|224720 COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224720 COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224720 COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224720 COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224720 COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224720 COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|220299 pfam09586, YfhO, Bacterial membrane protein YfhO | Back alignment and domain information |
|---|
| >gnl|CDD|224206 COG1287, COG1287, Uncharacterized membrane protein, required for N-linked glycosylation [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224206 COG1287, COG1287, Uncharacterized membrane protein, required for N-linked glycosylation [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224206 COG1287, COG1287, Uncharacterized membrane protein, required for N-linked glycosylation [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224287 COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224206 COG1287, COG1287, Uncharacterized membrane protein, required for N-linked glycosylation [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224206 COG1287, COG1287, Uncharacterized membrane protein, required for N-linked glycosylation [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|220299 pfam09586, YfhO, Bacterial membrane protein YfhO | Back alignment and domain information |
|---|
| >gnl|CDD|220299 pfam09586, YfhO, Bacterial membrane protein YfhO | Back alignment and domain information |
|---|
| >gnl|CDD|220299 pfam09586, YfhO, Bacterial membrane protein YfhO | Back alignment and domain information |
|---|
| >gnl|CDD|220299 pfam09586, YfhO, Bacterial membrane protein YfhO | Back alignment and domain information |
|---|
| >gnl|CDD|220299 pfam09586, YfhO, Bacterial membrane protein YfhO | Back alignment and domain information |
|---|
| >gnl|CDD|220299 pfam09586, YfhO, Bacterial membrane protein YfhO | Back alignment and domain information |
|---|
| >gnl|CDD|224206 COG1287, COG1287, Uncharacterized membrane protein, required for N-linked glycosylation [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224720 COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224287 COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224287 COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224287 COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224287 COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224287 COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224287 COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224287 COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224287 COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224287 COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224287 COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224287 COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|220569 pfam10101, DUF2339, Predicted membrane protein (DUF2339) | Back alignment and domain information |
|---|
| >gnl|CDD|225105 COG2194, COG2194, Predicted membrane-associated, metal-dependent hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|225105 COG2194, COG2194, Predicted membrane-associated, metal-dependent hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224287 COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224206 COG1287, COG1287, Uncharacterized membrane protein, required for N-linked glycosylation [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|220569 pfam10101, DUF2339, Predicted membrane protein (DUF2339) | Back alignment and domain information |
|---|
| >gnl|CDD|225105 COG2194, COG2194, Predicted membrane-associated, metal-dependent hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|225105 COG2194, COG2194, Predicted membrane-associated, metal-dependent hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|225105 COG2194, COG2194, Predicted membrane-associated, metal-dependent hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|225105 COG2194, COG2194, Predicted membrane-associated, metal-dependent hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|225105 COG2194, COG2194, Predicted membrane-associated, metal-dependent hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|225105 COG2194, COG2194, Predicted membrane-associated, metal-dependent hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|225105 COG2194, COG2194, Predicted membrane-associated, metal-dependent hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|225105 COG2194, COG2194, Predicted membrane-associated, metal-dependent hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|225105 COG2194, COG2194, Predicted membrane-associated, metal-dependent hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224287 COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|225844 COG3307, RfaL, Lipid A core - O-antigen ligase and related enzymes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|220299 pfam09586, YfhO, Bacterial membrane protein YfhO | Back alignment and domain information |
|---|
| >gnl|CDD|220299 pfam09586, YfhO, Bacterial membrane protein YfhO | Back alignment and domain information |
|---|
| >gnl|CDD|225844 COG3307, RfaL, Lipid A core - O-antigen ligase and related enzymes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|225844 COG3307, RfaL, Lipid A core - O-antigen ligase and related enzymes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|225105 COG2194, COG2194, Predicted membrane-associated, metal-dependent hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224287 COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|225105 COG2194, COG2194, Predicted membrane-associated, metal-dependent hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|225844 COG3307, RfaL, Lipid A core - O-antigen ligase and related enzymes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|217678 pfam03699, UPF0182, Uncharacterized protein family (UPF0182) | Back alignment and domain information |
|---|
| >gnl|CDD|225844 COG3307, RfaL, Lipid A core - O-antigen ligase and related enzymes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|223885 COG0815, Lnt, Apolipoprotein N-acyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|223885 COG0815, Lnt, Apolipoprotein N-acyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|223885 COG0815, Lnt, Apolipoprotein N-acyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|223885 COG0815, Lnt, Apolipoprotein N-acyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|223885 COG0815, Lnt, Apolipoprotein N-acyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|223885 COG0815, Lnt, Apolipoprotein N-acyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|217678 pfam03699, UPF0182, Uncharacterized protein family (UPF0182) | Back alignment and domain information |
|---|
| >gnl|CDD|217678 pfam03699, UPF0182, Uncharacterized protein family (UPF0182) | Back alignment and domain information |
|---|
| >gnl|CDD|217678 pfam03699, UPF0182, Uncharacterized protein family (UPF0182) | Back alignment and domain information |
|---|
| >gnl|CDD|217678 pfam03699, UPF0182, Uncharacterized protein family (UPF0182) | Back alignment and domain information |
|---|
| >gnl|CDD|217678 pfam03699, UPF0182, Uncharacterized protein family (UPF0182) | Back alignment and domain information |
|---|
| >gnl|CDD|217678 pfam03699, UPF0182, Uncharacterized protein family (UPF0182) | Back alignment and domain information |
|---|
| >gnl|CDD|217678 pfam03699, UPF0182, Uncharacterized protein family (UPF0182) | Back alignment and domain information |
|---|
| >gnl|CDD|217678 pfam03699, UPF0182, Uncharacterized protein family (UPF0182) | Back alignment and domain information |
|---|
| >gnl|CDD|217678 pfam03699, UPF0182, Uncharacterized protein family (UPF0182) | Back alignment and domain information |
|---|
| >gnl|CDD|223885 COG0815, Lnt, Apolipoprotein N-acyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|220569 pfam10101, DUF2339, Predicted membrane protein (DUF2339) | Back alignment and domain information |
|---|
| >gnl|CDD|217678 pfam03699, UPF0182, Uncharacterized protein family (UPF0182) | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226888 COG4485, COG4485, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|226888 COG4485, COG4485, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|226888 COG4485, COG4485, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|226888 COG4485, COG4485, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|226888 COG4485, COG4485, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|226888 COG4485, COG4485, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|226888 COG4485, COG4485, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|217079 pfam02516, STT3, Oligosaccharyl transferase STT3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) | Back alignment and domain information |
|---|
| >gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) | Back alignment and domain information |
|---|
| >gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) | Back alignment and domain information |
|---|
| >gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) | Back alignment and domain information |
|---|
| >gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) | Back alignment and domain information |
|---|
| >gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) | Back alignment and domain information |
|---|
| >gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) | Back alignment and domain information |
|---|
| >gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) | Back alignment and domain information |
|---|
| >gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) | Back alignment and domain information |
|---|
| >gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) | Back alignment and domain information |
|---|
| >gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) | Back alignment and domain information |
|---|
| >gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) | Back alignment and domain information |
|---|
| >gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) | Back alignment and domain information |
|---|
| >gnl|CDD|224720 COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) | Back alignment and domain information |
|---|
| >gnl|CDD|225153 COG2244, RfbX, Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|225153 COG2244, RfbX, Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|225153 COG2244, RfbX, Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|225153 COG2244, RfbX, Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|225153 COG2244, RfbX, Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|225844 COG3307, RfaL, Lipid A core - O-antigen ligase and related enzymes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|217079 pfam02516, STT3, Oligosaccharyl transferase STT3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217079 pfam02516, STT3, Oligosaccharyl transferase STT3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217079 pfam02516, STT3, Oligosaccharyl transferase STT3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|225153 COG2244, RfbX, Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224748 COG1835, COG1835, Predicted acyltransferases [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224748 COG1835, COG1835, Predicted acyltransferases [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224748 COG1835, COG1835, Predicted acyltransferases [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224748 COG1835, COG1835, Predicted acyltransferases [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224748 COG1835, COG1835, Predicted acyltransferases [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224720 COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|217678 pfam03699, UPF0182, Uncharacterized protein family (UPF0182) | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226888 COG4485, COG4485, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|217079 pfam02516, STT3, Oligosaccharyl transferase STT3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|225153 COG2244, RfbX, Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177158 MTH00095, ND5, NADH dehydrogenase subunit 5; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222703 pfam14351, DUF4401, Domain of unknown function (DUF4401) | Back alignment and domain information |
|---|
| >gnl|CDD|223731 COG0658, ComEC, Predicted membrane metal-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223731 COG0658, ComEC, Predicted membrane metal-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223731 COG0658, ComEC, Predicted membrane metal-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223731 COG0658, ComEC, Predicted membrane metal-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|226951 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|222703 pfam14351, DUF4401, Domain of unknown function (DUF4401) | Back alignment and domain information |
|---|
| >gnl|CDD|222703 pfam14351, DUF4401, Domain of unknown function (DUF4401) | Back alignment and domain information |
|---|
| >gnl|CDD|223731 COG0658, ComEC, Predicted membrane metal-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|234534 TIGR04286, MSEP-CTERM, MSEP-CTERM protein | Back alignment and domain information |
|---|
| >gnl|CDD|224206 COG1287, COG1287, Uncharacterized membrane protein, required for N-linked glycosylation [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|177158 MTH00095, ND5, NADH dehydrogenase subunit 5; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234534 TIGR04286, MSEP-CTERM, MSEP-CTERM protein | Back alignment and domain information |
|---|
| >gnl|CDD|234534 TIGR04286, MSEP-CTERM, MSEP-CTERM protein | Back alignment and domain information |
|---|
| >gnl|CDD|225803 COG3264, COG3264, Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224748 COG1835, COG1835, Predicted acyltransferases [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|234534 TIGR04286, MSEP-CTERM, MSEP-CTERM protein | Back alignment and domain information |
|---|
| >gnl|CDD|224287 COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|225844 COG3307, RfaL, Lipid A core - O-antigen ligase and related enzymes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|226888 COG4485, COG4485, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) | Back alignment and domain information |
|---|
| >gnl|CDD|234534 TIGR04286, MSEP-CTERM, MSEP-CTERM protein | Back alignment and domain information |
|---|
| >gnl|CDD|217678 pfam03699, UPF0182, Uncharacterized protein family (UPF0182) | Back alignment and domain information |
|---|
| >gnl|CDD|223885 COG0815, Lnt, Apolipoprotein N-acyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|217079 pfam02516, STT3, Oligosaccharyl transferase STT3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217079 pfam02516, STT3, Oligosaccharyl transferase STT3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217079 pfam02516, STT3, Oligosaccharyl transferase STT3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217079 pfam02516, STT3, Oligosaccharyl transferase STT3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217079 pfam02516, STT3, Oligosaccharyl transferase STT3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217079 pfam02516, STT3, Oligosaccharyl transferase STT3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217079 pfam02516, STT3, Oligosaccharyl transferase STT3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222703 pfam14351, DUF4401, Domain of unknown function (DUF4401) | Back alignment and domain information |
|---|
| >gnl|CDD|225844 COG3307, RfaL, Lipid A core - O-antigen ligase and related enzymes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222703 pfam14351, DUF4401, Domain of unknown function (DUF4401) | Back alignment and domain information |
|---|
| >gnl|CDD|225803 COG3264, COG3264, Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters | Back alignment and domain information |
|---|
| >gnl|CDD|225892 COG3356, COG3356, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|225844 COG3307, RfaL, Lipid A core - O-antigen ligase and related enzymes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|223885 COG0815, Lnt, Apolipoprotein N-acyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|225803 COG3264, COG3264, Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|177154 MTH00091, ND2, NADH dehydrogenase subunit 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|220299 pfam09586, YfhO, Bacterial membrane protein YfhO | Back alignment and domain information |
|---|
| >gnl|CDD|225844 COG3307, RfaL, Lipid A core - O-antigen ligase and related enzymes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|222703 pfam14351, DUF4401, Domain of unknown function (DUF4401) | Back alignment and domain information |
|---|
| >gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters | Back alignment and domain information |
|---|
| >gnl|CDD|225892 COG3356, COG3356, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|225892 COG3356, COG3356, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|225892 COG3356, COG3356, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|225892 COG3356, COG3356, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|225892 COG3356, COG3356, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|225892 COG3356, COG3356, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|223731 COG0658, ComEC, Predicted membrane metal-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|227317 COG4984, COG4984, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|225105 COG2194, COG2194, Predicted membrane-associated, metal-dependent hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|222703 pfam14351, DUF4401, Domain of unknown function (DUF4401) | Back alignment and domain information |
|---|
| >gnl|CDD|225892 COG3356, COG3356, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|234350 TIGR03766, TIGR03766, conserved hypothetical integral membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|234350 TIGR03766, TIGR03766, conserved hypothetical integral membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|234721 PRK00302, lnt, apolipoprotein N-acyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|234721 PRK00302, lnt, apolipoprotein N-acyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|234721 PRK00302, lnt, apolipoprotein N-acyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|224748 COG1835, COG1835, Predicted acyltransferases [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223425 COG0348, NapH, Polyferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|223425 COG0348, NapH, Polyferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|223425 COG0348, NapH, Polyferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|223425 COG0348, NapH, Polyferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|223425 COG0348, NapH, Polyferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|223961 COG1030, NfeD, Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|223961 COG1030, NfeD, Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|223961 COG1030, NfeD, Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|223961 COG1030, NfeD, Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|223961 COG1030, NfeD, Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|223961 COG1030, NfeD, Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|223961 COG1030, NfeD, Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|223961 COG1030, NfeD, Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|223961 COG1030, NfeD, Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|223961 COG1030, NfeD, Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|223961 COG1030, NfeD, Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|223961 COG1030, NfeD, Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|223961 COG1030, NfeD, Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|223961 COG1030, NfeD, Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|217079 pfam02516, STT3, Oligosaccharyl transferase STT3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|223605 COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223605 COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223605 COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223605 COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223605 COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226122 COG3594, NolL, Fucose 4-O-acetylase and related acetyltransferases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226122 COG3594, NolL, Fucose 4-O-acetylase and related acetyltransferases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|217678 pfam03699, UPF0182, Uncharacterized protein family (UPF0182) | Back alignment and domain information |
|---|
| >gnl|CDD|177158 MTH00095, ND5, NADH dehydrogenase subunit 5; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234350 TIGR03766, TIGR03766, conserved hypothetical integral membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|234350 TIGR03766, TIGR03766, conserved hypothetical integral membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|223605 COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223605 COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223605 COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223605 COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|225105 COG2194, COG2194, Predicted membrane-associated, metal-dependent hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|225153 COG2244, RfbX, Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224748 COG1835, COG1835, Predicted acyltransferases [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters | Back alignment and domain information |
|---|
| >gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters | Back alignment and domain information |
|---|
| >gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters | Back alignment and domain information |
|---|
| >gnl|CDD|177154 MTH00091, ND2, NADH dehydrogenase subunit 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234093 TIGR03025, EPS_sugtrans, exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234721 PRK00302, lnt, apolipoprotein N-acyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223605 COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|221363 pfam11992, DUF3488, Domain of unknown function (DUF3488) | Back alignment and domain information |
|---|
| >gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|177154 MTH00091, ND2, NADH dehydrogenase subunit 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177154 MTH00091, ND2, NADH dehydrogenase subunit 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177154 MTH00091, ND2, NADH dehydrogenase subunit 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177154 MTH00091, ND2, NADH dehydrogenase subunit 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177154 MTH00091, ND2, NADH dehydrogenase subunit 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177154 MTH00091, ND2, NADH dehydrogenase subunit 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177154 MTH00091, ND2, NADH dehydrogenase subunit 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177154 MTH00091, ND2, NADH dehydrogenase subunit 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227317 COG4984, COG4984, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|234350 TIGR03766, TIGR03766, conserved hypothetical integral membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|234350 TIGR03766, TIGR03766, conserved hypothetical integral membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|226122 COG3594, NolL, Fucose 4-O-acetylase and related acetyltransferases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|217721 pfam03772, Competence, Competence protein | Back alignment and domain information |
|---|
| >gnl|CDD|217721 pfam03772, Competence, Competence protein | Back alignment and domain information |
|---|
| >gnl|CDD|217721 pfam03772, Competence, Competence protein | Back alignment and domain information |
|---|
| >gnl|CDD|217721 pfam03772, Competence, Competence protein | Back alignment and domain information |
|---|
| >gnl|CDD|217721 pfam03772, Competence, Competence protein | Back alignment and domain information |
|---|
| >gnl|CDD|217721 pfam03772, Competence, Competence protein | Back alignment and domain information |
|---|
| >gnl|CDD|217721 pfam03772, Competence, Competence protein | Back alignment and domain information |
|---|
| >gnl|CDD|217721 pfam03772, Competence, Competence protein | Back alignment and domain information |
|---|
| >gnl|CDD|225451 COG2898, COG2898, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|216682 pfam01757, Acyl_transf_3, Acyltransferase family | Back alignment and domain information |
|---|
| >gnl|CDD|216682 pfam01757, Acyl_transf_3, Acyltransferase family | Back alignment and domain information |
|---|
| >gnl|CDD|216682 pfam01757, Acyl_transf_3, Acyltransferase family | Back alignment and domain information |
|---|
| >gnl|CDD|216682 pfam01757, Acyl_transf_3, Acyltransferase family | Back alignment and domain information |
|---|
| >gnl|CDD|216682 pfam01757, Acyl_transf_3, Acyltransferase family | Back alignment and domain information |
|---|
| >gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|217785 pfam03901, Glyco_transf_22, Alg9-like mannosyltransferase family | Back alignment and domain information |
|---|
| >gnl|CDD|217785 pfam03901, Glyco_transf_22, Alg9-like mannosyltransferase family | Back alignment and domain information |
|---|
| >gnl|CDD|233511 TIGR01654, bact_immun_7tm, bacteriocin-associated integral membrane (putative immunity) protein | Back alignment and domain information |
|---|
| >gnl|CDD|233511 TIGR01654, bact_immun_7tm, bacteriocin-associated integral membrane (putative immunity) protein | Back alignment and domain information |
|---|
| >gnl|CDD|233511 TIGR01654, bact_immun_7tm, bacteriocin-associated integral membrane (putative immunity) protein | Back alignment and domain information |
|---|
| >gnl|CDD|233511 TIGR01654, bact_immun_7tm, bacteriocin-associated integral membrane (putative immunity) protein | Back alignment and domain information |
|---|
| >gnl|CDD|233511 TIGR01654, bact_immun_7tm, bacteriocin-associated integral membrane (putative immunity) protein | Back alignment and domain information |
|---|
| >gnl|CDD|233511 TIGR01654, bact_immun_7tm, bacteriocin-associated integral membrane (putative immunity) protein | Back alignment and domain information |
|---|
| >gnl|CDD|233511 TIGR01654, bact_immun_7tm, bacteriocin-associated integral membrane (putative immunity) protein | Back alignment and domain information |
|---|
| >gnl|CDD|217079 pfam02516, STT3, Oligosaccharyl transferase STT3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|223425 COG0348, NapH, Polyferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|223425 COG0348, NapH, Polyferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|223425 COG0348, NapH, Polyferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|226122 COG3594, NolL, Fucose 4-O-acetylase and related acetyltransferases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|221363 pfam11992, DUF3488, Domain of unknown function (DUF3488) | Back alignment and domain information |
|---|
| >gnl|CDD|221363 pfam11992, DUF3488, Domain of unknown function (DUF3488) | Back alignment and domain information |
|---|
| >gnl|CDD|221363 pfam11992, DUF3488, Domain of unknown function (DUF3488) | Back alignment and domain information |
|---|
| >gnl|CDD|221363 pfam11992, DUF3488, Domain of unknown function (DUF3488) | Back alignment and domain information |
|---|
| >gnl|CDD|221363 pfam11992, DUF3488, Domain of unknown function (DUF3488) | Back alignment and domain information |
|---|
| >gnl|CDD|221363 pfam11992, DUF3488, Domain of unknown function (DUF3488) | Back alignment and domain information |
|---|
| >gnl|CDD|221363 pfam11992, DUF3488, Domain of unknown function (DUF3488) | Back alignment and domain information |
|---|
| >gnl|CDD|221363 pfam11992, DUF3488, Domain of unknown function (DUF3488) | Back alignment and domain information |
|---|
| >gnl|CDD|221363 pfam11992, DUF3488, Domain of unknown function (DUF3488) | Back alignment and domain information |
|---|
| >gnl|CDD|221363 pfam11992, DUF3488, Domain of unknown function (DUF3488) | Back alignment and domain information |
|---|
| >gnl|CDD|221363 pfam11992, DUF3488, Domain of unknown function (DUF3488) | Back alignment and domain information |
|---|
| >gnl|CDD|221363 pfam11992, DUF3488, Domain of unknown function (DUF3488) | Back alignment and domain information |
|---|
| >gnl|CDD|221363 pfam11992, DUF3488, Domain of unknown function (DUF3488) | Back alignment and domain information |
|---|
| >gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|225451 COG2898, COG2898, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|225451 COG2898, COG2898, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|225451 COG2898, COG2898, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|225451 COG2898, COG2898, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|235787 PRK06370, PRK06370, mercuric reductase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|227621 COG5305, COG5305, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|225153 COG2244, RfbX, Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|214443 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223961 COG1030, NfeD, Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|217721 pfam03772, Competence, Competence protein | Back alignment and domain information |
|---|
| >gnl|CDD|217721 pfam03772, Competence, Competence protein | Back alignment and domain information |
|---|
| >gnl|CDD|217721 pfam03772, Competence, Competence protein | Back alignment and domain information |
|---|
| >gnl|CDD|217721 pfam03772, Competence, Competence protein | Back alignment and domain information |
|---|
| >gnl|CDD|225451 COG2898, COG2898, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|225451 COG2898, COG2898, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|227621 COG5305, COG5305, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|222635 pfam14264, Glucos_trans_II, Glucosyl transferase GtrII | Back alignment and domain information |
|---|
| >gnl|CDD|222635 pfam14264, Glucos_trans_II, Glucosyl transferase GtrII | Back alignment and domain information |
|---|
| >gnl|CDD|222635 pfam14264, Glucos_trans_II, Glucosyl transferase GtrII | Back alignment and domain information |
|---|
| >gnl|CDD|222635 pfam14264, Glucos_trans_II, Glucosyl transferase GtrII | Back alignment and domain information |
|---|
| >gnl|CDD|222635 pfam14264, Glucos_trans_II, Glucosyl transferase GtrII | Back alignment and domain information |
|---|
| >gnl|CDD|222635 pfam14264, Glucos_trans_II, Glucosyl transferase GtrII | Back alignment and domain information |
|---|
| >gnl|CDD|222635 pfam14264, Glucos_trans_II, Glucosyl transferase GtrII | Back alignment and domain information |
|---|
| >gnl|CDD|222635 pfam14264, Glucos_trans_II, Glucosyl transferase GtrII | Back alignment and domain information |
|---|
| >gnl|CDD|222635 pfam14264, Glucos_trans_II, Glucosyl transferase GtrII | Back alignment and domain information |
|---|
| >gnl|CDD|226828 COG4393, COG4393, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|224295 COG1377, FlhB, Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|224295 COG1377, FlhB, Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|224295 COG1377, FlhB, Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|224295 COG1377, FlhB, Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|224295 COG1377, FlhB, Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|225803 COG3264, COG3264, Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|226122 COG3594, NolL, Fucose 4-O-acetylase and related acetyltransferases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|217721 pfam03772, Competence, Competence protein | Back alignment and domain information |
|---|
| >gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|234350 TIGR03766, TIGR03766, conserved hypothetical integral membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|234350 TIGR03766, TIGR03766, conserved hypothetical integral membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|217678 pfam03699, UPF0182, Uncharacterized protein family (UPF0182) | Back alignment and domain information |
|---|
| >gnl|CDD|216682 pfam01757, Acyl_transf_3, Acyltransferase family | Back alignment and domain information |
|---|
| >gnl|CDD|222703 pfam14351, DUF4401, Domain of unknown function (DUF4401) | Back alignment and domain information |
|---|
| >gnl|CDD|222703 pfam14351, DUF4401, Domain of unknown function (DUF4401) | Back alignment and domain information |
|---|
| >gnl|CDD|223731 COG0658, ComEC, Predicted membrane metal-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters | Back alignment and domain information |
|---|
| >gnl|CDD|234350 TIGR03766, TIGR03766, conserved hypothetical integral membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|234721 PRK00302, lnt, apolipoprotein N-acyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223605 COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226122 COG3594, NolL, Fucose 4-O-acetylase and related acetyltransferases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|225451 COG2898, COG2898, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|216682 pfam01757, Acyl_transf_3, Acyltransferase family | Back alignment and domain information |
|---|
| >gnl|CDD|216682 pfam01757, Acyl_transf_3, Acyltransferase family | Back alignment and domain information |
|---|
| >gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|214444 MTH00165, ND5, NADH dehydrogenase subunit 5; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214444 MTH00165, ND5, NADH dehydrogenase subunit 5; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214444 MTH00165, ND5, NADH dehydrogenase subunit 5; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214444 MTH00165, ND5, NADH dehydrogenase subunit 5; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214444 MTH00165, ND5, NADH dehydrogenase subunit 5; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214444 MTH00165, ND5, NADH dehydrogenase subunit 5; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214444 MTH00165, ND5, NADH dehydrogenase subunit 5; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214444 MTH00165, ND5, NADH dehydrogenase subunit 5; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214444 MTH00165, ND5, NADH dehydrogenase subunit 5; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214444 MTH00165, ND5, NADH dehydrogenase subunit 5; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214444 MTH00165, ND5, NADH dehydrogenase subunit 5; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214444 MTH00165, ND5, NADH dehydrogenase subunit 5; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223800 COG0728, MviN, Uncharacterized membrane protein, putative virulence factor [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|177157 MTH00094, ND4, NADH dehydrogenase subunit 4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177157 MTH00094, ND4, NADH dehydrogenase subunit 4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177157 MTH00094, ND4, NADH dehydrogenase subunit 4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177157 MTH00094, ND4, NADH dehydrogenase subunit 4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177157 MTH00094, ND4, NADH dehydrogenase subunit 4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177157 MTH00094, ND4, NADH dehydrogenase subunit 4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214442 MTH00160, ND2, NADH dehydrogenase subunit 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234350 TIGR03766, TIGR03766, conserved hypothetical integral membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|234350 TIGR03766, TIGR03766, conserved hypothetical integral membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|234350 TIGR03766, TIGR03766, conserved hypothetical integral membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|234350 TIGR03766, TIGR03766, conserved hypothetical integral membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|234092 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|225451 COG2898, COG2898, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|217785 pfam03901, Glyco_transf_22, Alg9-like mannosyltransferase family | Back alignment and domain information |
|---|
| >gnl|CDD|217785 pfam03901, Glyco_transf_22, Alg9-like mannosyltransferase family | Back alignment and domain information |
|---|
| >gnl|CDD|217785 pfam03901, Glyco_transf_22, Alg9-like mannosyltransferase family | Back alignment and domain information |
|---|
| >gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|227621 COG5305, COG5305, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|224295 COG1377, FlhB, Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|224295 COG1377, FlhB, Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|224295 COG1377, FlhB, Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|224295 COG1377, FlhB, Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|224295 COG1377, FlhB, Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|224295 COG1377, FlhB, Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|224295 COG1377, FlhB, Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|224295 COG1377, FlhB, Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|218818 pfam05940, NnrS, NnrS protein | Back alignment and domain information |
|---|
| >gnl|CDD|226999 COG4652, COG4652, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|226999 COG4652, COG4652, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|226999 COG4652, COG4652, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|226999 COG4652, COG4652, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|226999 COG4652, COG4652, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|226999 COG4652, COG4652, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|226999 COG4652, COG4652, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|223469 COG0392, COG0392, Predicted integral membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|233016 TIGR00546, lnt, apolipoprotein N-acyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|224011 COG1086, COG1086, Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224748 COG1835, COG1835, Predicted acyltransferases [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|227317 COG4984, COG4984, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|224397 COG1480, COG1480, Predicted membrane-associated HD superfamily hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223425 COG0348, NapH, Polyferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|223425 COG0348, NapH, Polyferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|223425 COG0348, NapH, Polyferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|233511 TIGR01654, bact_immun_7tm, bacteriocin-associated integral membrane (putative immunity) protein | Back alignment and domain information |
|---|
| >gnl|CDD|233511 TIGR01654, bact_immun_7tm, bacteriocin-associated integral membrane (putative immunity) protein | Back alignment and domain information |
|---|
| >gnl|CDD|233511 TIGR01654, bact_immun_7tm, bacteriocin-associated integral membrane (putative immunity) protein | Back alignment and domain information |
|---|
| >gnl|CDD|224295 COG1377, FlhB, Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|223800 COG0728, MviN, Uncharacterized membrane protein, putative virulence factor [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223800 COG0728, MviN, Uncharacterized membrane protein, putative virulence factor [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223800 COG0728, MviN, Uncharacterized membrane protein, putative virulence factor [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223800 COG0728, MviN, Uncharacterized membrane protein, putative virulence factor [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223800 COG0728, MviN, Uncharacterized membrane protein, putative virulence factor [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|218818 pfam05940, NnrS, NnrS protein | Back alignment and domain information |
|---|
| >gnl|CDD|223648 COG0575, CdsA, CDP-diglyceride synthetase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223648 COG0575, CdsA, CDP-diglyceride synthetase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223648 COG0575, CdsA, CDP-diglyceride synthetase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223648 COG0575, CdsA, CDP-diglyceride synthetase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223648 COG0575, CdsA, CDP-diglyceride synthetase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223648 COG0575, CdsA, CDP-diglyceride synthetase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223648 COG0575, CdsA, CDP-diglyceride synthetase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223648 COG0575, CdsA, CDP-diglyceride synthetase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223648 COG0575, CdsA, CDP-diglyceride synthetase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223648 COG0575, CdsA, CDP-diglyceride synthetase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223648 COG0575, CdsA, CDP-diglyceride synthetase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223648 COG0575, CdsA, CDP-diglyceride synthetase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223648 COG0575, CdsA, CDP-diglyceride synthetase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223648 COG0575, CdsA, CDP-diglyceride synthetase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235569 PRK05702, flhB, flagellar biosynthesis protein FlhB; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235569 PRK05702, flhB, flagellar biosynthesis protein FlhB; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235569 PRK05702, flhB, flagellar biosynthesis protein FlhB; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235569 PRK05702, flhB, flagellar biosynthesis protein FlhB; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|226365 COG3846, TrbL, Type IV secretory pathway, TrbL components [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|222374 pfam13779, DUF4175, Domain of unknown function (DUF4175) | Back alignment and domain information |
|---|
| >gnl|CDD|177154 MTH00091, ND2, NADH dehydrogenase subunit 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234350 TIGR03766, TIGR03766, conserved hypothetical integral membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|224011 COG1086, COG1086, Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235569 PRK05702, flhB, flagellar biosynthesis protein FlhB; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235569 PRK05702, flhB, flagellar biosynthesis protein FlhB; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235569 PRK05702, flhB, flagellar biosynthesis protein FlhB; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235569 PRK05702, flhB, flagellar biosynthesis protein FlhB; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|220468 pfam09913, DUF2142, Predicted membrane protein (DUF2142) | Back alignment and domain information |
|---|
| >gnl|CDD|237042 PRK12291, PRK12291, apolipoprotein N-acyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237042 PRK12291, PRK12291, apolipoprotein N-acyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237042 PRK12291, PRK12291, apolipoprotein N-acyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|219152 pfam06728, PIG-U, GPI transamidase subunit PIG-U | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1381 | |||
| KOG1238|consensus | 623 | 100.0 | ||
| TIGR01810 | 532 | betA choline dehydrogenase. This enzyme is a membe | 100.0 | |
| PRK02106 | 560 | choline dehydrogenase; Validated | 100.0 | |
| PLN02785 | 587 | Protein HOTHEAD | 100.0 | |
| COG2303 | 542 | BetA Choline dehydrogenase and related flavoprotei | 100.0 | |
| PF00732 | 296 | GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 | 100.0 | |
| TIGR02462 | 544 | pyranose_ox pyranose oxidase. Pyranose oxidase (al | 100.0 | |
| PF05199 | 144 | GMC_oxred_C: GMC oxidoreductase; InterPro: IPR0078 | 100.0 | |
| PRK07121 | 492 | hypothetical protein; Validated | 99.29 | |
| PRK12837 | 513 | 3-ketosteroid-delta-1-dehydrogenase; Provisional | 99.21 | |
| PRK08274 | 466 | tricarballylate dehydrogenase; Validated | 99.21 | |
| PRK12835 | 584 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 99.21 | |
| PF01266 | 358 | DAO: FAD dependent oxidoreductase; InterPro: IPR00 | 99.12 | |
| PRK12844 | 557 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 99.11 | |
| PRK12845 | 564 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 99.09 | |
| PF00890 | 417 | FAD_binding_2: FAD binding domain of the Pfam fami | 99.06 | |
| PRK06175 | 433 | L-aspartate oxidase; Provisional | 99.01 | |
| PRK11101 | 546 | glpA sn-glycerol-3-phosphate dehydrogenase subunit | 99.0 | |
| TIGR01813 | 439 | flavo_cyto_c flavocytochrome c. This model describ | 98.99 | |
| PRK06854 | 608 | adenylylsulfate reductase subunit alpha; Validated | 98.96 | |
| PRK07843 | 557 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 98.95 | |
| PRK12842 | 574 | putative succinate dehydrogenase; Reviewed | 98.94 | |
| PRK06134 | 581 | putative FAD-binding dehydrogenase; Reviewed | 98.93 | |
| PRK08275 | 554 | putative oxidoreductase; Provisional | 98.93 | |
| PRK06263 | 543 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.93 | |
| PRK12843 | 578 | putative FAD-binding dehydrogenase; Reviewed | 98.89 | |
| PTZ00306 | 1167 | NADH-dependent fumarate reductase; Provisional | 98.89 | |
| PRK05257 | 494 | malate:quinone oxidoreductase; Validated | 98.89 | |
| PLN00128 | 635 | Succinate dehydrogenase [ubiquinone] flavoprotein | 98.87 | |
| PRK12839 | 572 | hypothetical protein; Provisional | 98.86 | |
| PRK06481 | 506 | fumarate reductase flavoprotein subunit; Validated | 98.86 | |
| COG0579 | 429 | Predicted dehydrogenase [General function predicti | 98.85 | |
| PRK07395 | 553 | L-aspartate oxidase; Provisional | 98.84 | |
| PTZ00139 | 617 | Succinate dehydrogenase [ubiquinone] flavoprotein | 98.83 | |
| TIGR01373 | 407 | soxB sarcosine oxidase, beta subunit family, heter | 98.83 | |
| PRK08958 | 588 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.82 | |
| PRK06452 | 566 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.82 | |
| PRK07804 | 541 | L-aspartate oxidase; Provisional | 98.81 | |
| PRK07573 | 640 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.81 | |
| PRK09078 | 598 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.81 | |
| PRK08641 | 589 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.8 | |
| PRK12409 | 410 | D-amino acid dehydrogenase small subunit; Provisio | 98.79 | |
| PRK08071 | 510 | L-aspartate oxidase; Provisional | 98.79 | |
| TIGR01812 | 566 | sdhA_frdA_Gneg succinate dehydrogenase or fumarate | 98.79 | |
| PRK13800 | 897 | putative oxidoreductase/HEAT repeat-containing pro | 98.78 | |
| PRK05945 | 575 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.78 | |
| PRK12834 | 549 | putative FAD-binding dehydrogenase; Reviewed | 98.76 | |
| PRK09077 | 536 | L-aspartate oxidase; Provisional | 98.76 | |
| TIGR01320 | 483 | mal_quin_oxido malate:quinone-oxidoreductase. This | 98.75 | |
| PRK07057 | 591 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.74 | |
| PRK00711 | 416 | D-amino acid dehydrogenase small subunit; Validate | 98.74 | |
| PRK09231 | 582 | fumarate reductase flavoprotein subunit; Validated | 98.74 | |
| PLN02815 | 594 | L-aspartate oxidase | 98.73 | |
| PRK08205 | 583 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.73 | |
| PTZ00383 | 497 | malate:quinone oxidoreductase; Provisional | 98.72 | |
| PRK11728 | 393 | hydroxyglutarate oxidase; Provisional | 98.72 | |
| TIGR01176 | 580 | fum_red_Fp fumarate reductase, flavoprotein subuni | 98.72 | |
| PRK06069 | 577 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.69 | |
| TIGR00551 | 488 | nadB L-aspartate oxidase. L-aspartate oxidase is t | 98.69 | |
| PRK08626 | 657 | fumarate reductase flavoprotein subunit; Provision | 98.69 | |
| TIGR01377 | 380 | soxA_mon sarcosine oxidase, monomeric form. Sarcos | 98.68 | |
| PRK07512 | 513 | L-aspartate oxidase; Provisional | 98.67 | |
| PRK13339 | 497 | malate:quinone oxidoreductase; Reviewed | 98.66 | |
| PRK10157 | 428 | putative oxidoreductase FixC; Provisional | 98.65 | |
| PLN02464 | 627 | glycerol-3-phosphate dehydrogenase | 98.64 | |
| TIGR03329 | 460 | Phn_aa_oxid putative aminophosphonate oxidoreducta | 98.63 | |
| PF06039 | 488 | Mqo: Malate:quinone oxidoreductase (Mqo); InterPro | 98.62 | |
| PTZ00363 | 443 | rab-GDP dissociation inhibitor; Provisional | 98.62 | |
| PLN02661 | 357 | Putative thiazole synthesis | 98.62 | |
| TIGR01811 | 603 | sdhA_Bsu succinate dehydrogenase or fumarate reduc | 98.62 | |
| PRK07803 | 626 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.61 | |
| TIGR02061 | 614 | aprA adenosine phosphosulphate reductase, alpha su | 98.6 | |
| PRK11259 | 376 | solA N-methyltryptophan oxidase; Provisional | 98.59 | |
| PRK13977 | 576 | myosin-cross-reactive antigen; Provisional | 98.58 | |
| PRK01747 | 662 | mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans | 98.55 | |
| COG1053 | 562 | SdhA Succinate dehydrogenase/fumarate reductase, f | 98.54 | |
| KOG1298|consensus | 509 | 98.53 | ||
| PF03486 | 409 | HI0933_like: HI0933-like protein; InterPro: IPR004 | 98.52 | |
| COG2081 | 408 | Predicted flavoproteins [General function predicti | 98.5 | |
| TIGR03364 | 365 | HpnW_proposed FAD dependent oxidoreductase TIGR033 | 98.47 | |
| PRK10015 | 429 | oxidoreductase; Provisional | 98.46 | |
| COG0578 | 532 | GlpA Glycerol-3-phosphate dehydrogenase [Energy pr | 98.45 | |
| PRK04176 | 257 | ribulose-1,5-biphosphate synthetase; Provisional | 98.45 | |
| PF12831 | 428 | FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 | 98.39 | |
| PRK06185 | 407 | hypothetical protein; Provisional | 98.37 | |
| TIGR02485 | 432 | CobZ_N-term precorrin 3B synthase CobZ. CobZ is es | 98.36 | |
| PRK05329 | 422 | anaerobic glycerol-3-phosphate dehydrogenase subun | 98.34 | |
| PRK08401 | 466 | L-aspartate oxidase; Provisional | 98.33 | |
| PRK07364 | 415 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 98.33 | |
| PRK12266 | 508 | glpD glycerol-3-phosphate dehydrogenase; Reviewed | 98.33 | |
| TIGR00292 | 254 | thiazole biosynthesis enzyme. This enzyme is invol | 98.32 | |
| PRK13369 | 502 | glycerol-3-phosphate dehydrogenase; Provisional | 98.32 | |
| COG3573 | 552 | Predicted oxidoreductase [General function predict | 98.27 | |
| TIGR02730 | 493 | carot_isom carotene isomerase. Members of this fam | 98.26 | |
| COG0029 | 518 | NadB Aspartate oxidase [Coenzyme metabolism] | 98.25 | |
| PLN02985 | 514 | squalene monooxygenase | 98.24 | |
| PRK05192 | 618 | tRNA uridine 5-carboxymethylaminomethyl modificati | 98.2 | |
| PRK07208 | 479 | hypothetical protein; Provisional | 98.19 | |
| COG1233 | 487 | Phytoene dehydrogenase and related proteins [Secon | 98.17 | |
| COG0665 | 387 | DadA Glycine/D-amino acid oxidases (deaminating) [ | 98.17 | |
| TIGR01292 | 300 | TRX_reduct thioredoxin-disulfide reductase. This m | 98.16 | |
| TIGR02734 | 502 | crtI_fam phytoene desaturase. Phytoene is converte | 98.15 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 98.08 | |
| KOG2404|consensus | 477 | 98.07 | ||
| PRK06183 | 538 | mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va | 98.01 | |
| TIGR02733 | 492 | desat_CrtD C-3',4' desaturase CrtD. Members of thi | 98.0 | |
| PRK06126 | 545 | hypothetical protein; Provisional | 98.0 | |
| TIGR01350 | 461 | lipoamide_DH dihydrolipoamide dehydrogenase. The m | 98.0 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 97.98 | |
| COG0644 | 396 | FixC Dehydrogenases (flavoproteins) [Energy produc | 97.97 | |
| TIGR03378 | 419 | glycerol3P_GlpB glycerol-3-phosphate dehydrogenase | 97.97 | |
| TIGR00275 | 400 | flavoprotein, HI0933 family. The model when search | 97.91 | |
| PRK07233 | 434 | hypothetical protein; Provisional | 97.91 | |
| TIGR02731 | 453 | phytoene_desat phytoene desaturase. Plants and cya | 97.9 | |
| PF13738 | 203 | Pyr_redox_3: Pyridine nucleotide-disulphide oxidor | 97.87 | |
| COG2509 | 486 | Uncharacterized FAD-dependent dehydrogenases [Gene | 97.85 | |
| TIGR01372 | 985 | soxA sarcosine oxidase, alpha subunit family, hete | 97.81 | |
| PLN02612 | 567 | phytoene desaturase | 97.79 | |
| PRK08244 | 493 | hypothetical protein; Provisional | 97.78 | |
| KOG4254|consensus | 561 | 97.77 | ||
| PLN02172 | 461 | flavin-containing monooxygenase FMO GS-OX | 97.77 | |
| PRK11445 | 351 | putative oxidoreductase; Provisional | 97.76 | |
| TIGR02732 | 474 | zeta_caro_desat carotene 7,8-desaturase. Carotene | 97.76 | |
| TIGR03143 | 555 | AhpF_homolog putative alkyl hydroperoxide reductas | 97.76 | |
| PF01134 | 392 | GIDA: Glucose inhibited division protein A; InterP | 97.74 | |
| PLN02487 | 569 | zeta-carotene desaturase | 97.71 | |
| TIGR00136 | 617 | gidA glucose-inhibited division protein A. GidA, t | 97.69 | |
| KOG0042|consensus | 680 | 97.69 | ||
| COG0654 | 387 | UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and | 97.64 | |
| PF04820 | 454 | Trp_halogenase: Tryptophan halogenase; InterPro: I | 97.63 | |
| PRK10262 | 321 | thioredoxin reductase; Provisional | 97.53 | |
| COG3380 | 331 | Predicted NAD/FAD-dependent oxidoreductase [Genera | 97.51 | |
| PLN00093 | 450 | geranylgeranyl diphosphate reductase; Provisional | 97.47 | |
| KOG2415|consensus | 621 | 97.46 | ||
| PRK07538 | 413 | hypothetical protein; Provisional | 97.44 | |
| PRK12810 | 471 | gltD glutamate synthase subunit beta; Reviewed | 97.43 | |
| COG3634 | 520 | AhpF Alkyl hydroperoxide reductase, large subunit | 97.42 | |
| TIGR01438 | 484 | TGR thioredoxin and glutathione reductase selenopr | 97.4 | |
| PF05834 | 374 | Lycopene_cycl: Lycopene cyclase protein; InterPro: | 97.39 | |
| TIGR01316 | 449 | gltA glutamate synthase (NADPH), homotetrameric. T | 97.39 | |
| PF01494 | 356 | FAD_binding_3: FAD binding domain; InterPro: IPR00 | 97.38 | |
| TIGR02032 | 295 | GG-red-SF geranylgeranyl reductase family. This mo | 97.37 | |
| TIGR03377 | 516 | glycerol3P_GlpA glycerol-3-phosphate dehydrogenase | 97.34 | |
| TIGR02023 | 388 | BchP-ChlP geranylgeranyl reductase. This model rep | 97.31 | |
| KOG2665|consensus | 453 | 97.3 | ||
| PF01946 | 230 | Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. | 97.28 | |
| COG1232 | 444 | HemY Protoporphyrinogen oxidase [Coenzyme metaboli | 97.26 | |
| PRK09564 | 444 | coenzyme A disulfide reductase; Reviewed | 97.25 | |
| PRK08020 | 391 | ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin | 97.24 | |
| TIGR01789 | 370 | lycopene_cycl lycopene cyclase. This model represe | 97.22 | |
| COG0445 | 621 | GidA Flavin-dependent tRNA uridine 5-carboxymethyl | 97.2 | |
| PRK08010 | 441 | pyridine nucleotide-disulfide oxidoreductase; Prov | 97.17 | |
| COG0492 | 305 | TrxB Thioredoxin reductase [Posttranslational modi | 97.16 | |
| PRK07608 | 388 | ubiquinone biosynthesis hydroxylase family protein | 97.15 | |
| PRK05249 | 461 | soluble pyridine nucleotide transhydrogenase; Prov | 97.13 | |
| PTZ00318 | 424 | NADH dehydrogenase-like protein; Provisional | 97.11 | |
| PRK07494 | 388 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 97.11 | |
| COG0562 | 374 | Glf UDP-galactopyranose mutase [Cell envelope biog | 97.09 | |
| PRK12775 | 1006 | putative trifunctional 2-polyprenylphenol hydroxyl | 97.09 | |
| TIGR01421 | 450 | gluta_reduc_1 glutathione-disulfide reductase, ani | 97.08 | |
| PLN02463 | 447 | lycopene beta cyclase | 97.07 | |
| PRK06567 | 1028 | putative bifunctional glutamate synthase subunit b | 97.06 | |
| PRK07251 | 438 | pyridine nucleotide-disulfide oxidoreductase; Prov | 97.04 | |
| PRK09126 | 392 | hypothetical protein; Provisional | 97.03 | |
| PRK08773 | 392 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 97.02 | |
| PRK09754 | 396 | phenylpropionate dioxygenase ferredoxin reductase | 97.01 | |
| PRK06116 | 450 | glutathione reductase; Validated | 97.0 | |
| TIGR02028 | 398 | ChlP geranylgeranyl reductase. This model represen | 96.99 | |
| PRK12769 | 654 | putative oxidoreductase Fe-S binding subunit; Revi | 96.98 | |
| KOG3851|consensus | 446 | 96.98 | ||
| PRK06370 | 463 | mercuric reductase; Validated | 96.98 | |
| PTZ00058 | 561 | glutathione reductase; Provisional | 96.97 | |
| PRK06996 | 398 | hypothetical protein; Provisional | 96.97 | |
| PRK06416 | 462 | dihydrolipoamide dehydrogenase; Reviewed | 96.97 | |
| PRK08013 | 400 | oxidoreductase; Provisional | 96.96 | |
| PRK07045 | 388 | putative monooxygenase; Reviewed | 96.96 | |
| PLN02529 | 738 | lysine-specific histone demethylase 1 | 96.95 | |
| PF13450 | 68 | NAD_binding_8: NAD(P)-binding Rossmann-like domain | 96.95 | |
| PRK05675 | 570 | sdhA succinate dehydrogenase flavoprotein subunit; | 96.94 | |
| TIGR00031 | 377 | UDP-GALP_mutase UDP-galactopyranose mutase. The ge | 96.94 | |
| TIGR01424 | 446 | gluta_reduc_2 glutathione-disulfide reductase, pla | 96.92 | |
| TIGR01790 | 388 | carotene-cycl lycopene cyclase family protein. Thi | 96.91 | |
| PRK05976 | 472 | dihydrolipoamide dehydrogenase; Validated | 96.91 | |
| PRK07333 | 403 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 96.9 | |
| PRK05714 | 405 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 96.88 | |
| PF00743 | 531 | FMO-like: Flavin-binding monooxygenase-like; Inter | 96.88 | |
| KOG2820|consensus | 399 | 96.88 | ||
| PRK14694 | 468 | putative mercuric reductase; Provisional | 96.87 | |
| PRK04965 | 377 | NADH:flavorubredoxin oxidoreductase; Provisional | 96.87 | |
| PRK08132 | 547 | FAD-dependent oxidoreductase; Provisional | 96.85 | |
| PRK06115 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 96.85 | |
| COG1635 | 262 | THI4 Ribulose 1,5-bisphosphate synthetase, convert | 96.84 | |
| TIGR01988 | 385 | Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub | 96.82 | |
| KOG1399|consensus | 448 | 96.8 | ||
| PLN02697 | 529 | lycopene epsilon cyclase | 96.79 | |
| PRK06467 | 471 | dihydrolipoamide dehydrogenase; Reviewed | 96.79 | |
| PRK06292 | 460 | dihydrolipoamide dehydrogenase; Validated | 96.75 | |
| TIGR01984 | 382 | UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T | 96.75 | |
| TIGR02053 | 463 | MerA mercuric reductase. This model represents the | 96.74 | |
| COG3075 | 421 | GlpB Anaerobic glycerol-3-phosphate dehydrogenase | 96.74 | |
| COG1252 | 405 | Ndh NADH dehydrogenase, FAD-containing subunit [En | 96.73 | |
| PRK08849 | 384 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 96.72 | |
| KOG0685|consensus | 498 | 96.72 | ||
| TIGR01989 | 437 | COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T | 96.71 | |
| PRK13748 | 561 | putative mercuric reductase; Provisional | 96.7 | |
| PRK07190 | 487 | hypothetical protein; Provisional | 96.69 | |
| PRK07818 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 96.66 | |
| PTZ00367 | 567 | squalene epoxidase; Provisional | 96.64 | |
| TIGR03169 | 364 | Nterm_to_SelD pyridine nucleotide-disulfide oxidor | 96.63 | |
| PRK12809 | 639 | putative oxidoreductase Fe-S binding subunit; Revi | 96.59 | |
| PRK09897 | 534 | hypothetical protein; Provisional | 96.57 | |
| PRK08850 | 405 | 2-octaprenyl-6-methoxyphenol hydroxylase; Validate | 96.56 | |
| PRK05732 | 395 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 96.56 | |
| KOG2311|consensus | 679 | 96.53 | ||
| PRK06327 | 475 | dihydrolipoamide dehydrogenase; Validated | 96.52 | |
| PRK06617 | 374 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 96.52 | |
| PLN02507 | 499 | glutathione reductase | 96.5 | |
| PRK06184 | 502 | hypothetical protein; Provisional | 96.47 | |
| PRK06847 | 375 | hypothetical protein; Provisional | 96.46 | |
| PLN02546 | 558 | glutathione reductase | 96.46 | |
| KOG2852|consensus | 380 | 96.46 | ||
| PRK07588 | 391 | hypothetical protein; Provisional | 96.4 | |
| PF13434 | 341 | K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi | 96.4 | |
| KOG2853|consensus | 509 | 96.39 | ||
| COG1249 | 454 | Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, | 96.39 | |
| TIGR01423 | 486 | trypano_reduc trypanothione-disulfide reductase. T | 96.38 | |
| PRK08243 | 392 | 4-hydroxybenzoate 3-monooxygenase; Validated | 96.37 | |
| PRK06753 | 373 | hypothetical protein; Provisional | 96.37 | |
| PRK06834 | 488 | hypothetical protein; Provisional | 96.36 | |
| PTZ00052 | 499 | thioredoxin reductase; Provisional | 96.34 | |
| KOG0029|consensus | 501 | 96.28 | ||
| PRK08294 | 634 | phenol 2-monooxygenase; Provisional | 96.24 | |
| PLN02576 | 496 | protoporphyrinogen oxidase | 96.24 | |
| PF00996 | 438 | GDI: GDP dissociation inhibitor; InterPro: IPR0182 | 96.24 | |
| PRK07236 | 386 | hypothetical protein; Provisional | 96.23 | |
| PRK14989 | 847 | nitrite reductase subunit NirD; Provisional | 96.22 | |
| PRK11883 | 451 | protoporphyrinogen oxidase; Reviewed | 96.2 | |
| TIGR00562 | 462 | proto_IX_ox protoporphyrinogen oxidase. This prote | 96.17 | |
| PTZ00153 | 659 | lipoamide dehydrogenase; Provisional | 96.12 | |
| TIGR02360 | 390 | pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. | 96.11 | |
| PRK14727 | 479 | putative mercuric reductase; Provisional | 96.1 | |
| PRK08163 | 396 | salicylate hydroxylase; Provisional | 96.03 | |
| PLN02268 | 435 | probable polyamine oxidase | 96.02 | |
| PF07992 | 201 | Pyr_redox_2: Pyridine nucleotide-disulphide oxidor | 96.02 | |
| KOG3855|consensus | 481 | 95.93 | ||
| PF06100 | 500 | Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross | 95.79 | |
| TIGR02374 | 785 | nitri_red_nirB nitrite reductase [NAD(P)H], large | 95.65 | |
| COG2907 | 447 | Predicted NAD/FAD-binding protein [General functio | 95.63 | |
| PRK05868 | 372 | hypothetical protein; Validated | 95.58 | |
| PRK07846 | 451 | mycothione reductase; Reviewed | 95.47 | |
| TIGR03197 | 381 | MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri | 95.43 | |
| TIGR03452 | 452 | mycothione_red mycothione reductase. Mycothiol, a | 95.42 | |
| PRK12416 | 463 | protoporphyrinogen oxidase; Provisional | 95.37 | |
| PLN02676 | 487 | polyamine oxidase | 95.36 | |
| PLN02568 | 539 | polyamine oxidase | 95.35 | |
| PRK05335 | 436 | tRNA (uracil-5-)-methyltransferase Gid; Reviewed | 95.3 | |
| TIGR03315 | 1012 | Se_ygfK putative selenate reductase, YgfK subunit. | 95.27 | |
| KOG2844|consensus | 856 | 95.16 | ||
| PRK06912 | 458 | acoL dihydrolipoamide dehydrogenase; Validated | 95.07 | |
| TIGR01816 | 565 | sdhA_forward succinate dehydrogenase, flavoprotein | 95.06 | |
| KOG2960|consensus | 328 | 95.02 | ||
| PLN02927 | 668 | antheraxanthin epoxidase/zeaxanthin epoxidase | 94.89 | |
| TIGR02352 | 337 | thiamin_ThiO glycine oxidase ThiO. This family con | 94.86 | |
| COG2072 | 443 | TrkA Predicted flavoprotein involved in K+ transpo | 94.85 | |
| KOG0405|consensus | 478 | 94.81 | ||
| TIGR03219 | 414 | salicylate_mono salicylate 1-monooxygenase. Member | 94.75 | |
| PRK06475 | 400 | salicylate hydroxylase; Provisional | 94.74 | |
| COG1231 | 450 | Monoamine oxidase [Amino acid transport and metabo | 94.73 | |
| PRK12831 | 464 | putative oxidoreductase; Provisional | 94.68 | |
| TIGR00137 | 433 | gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo | 94.53 | |
| PRK11749 | 457 | dihydropyrimidine dehydrogenase subunit A; Provisi | 94.14 | |
| PRK07845 | 466 | flavoprotein disulfide reductase; Reviewed | 93.83 | |
| PRK12778 | 752 | putative bifunctional 2-polyprenylphenol hydroxyla | 93.67 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 93.57 | |
| PLN02852 | 491 | ferredoxin-NADP+ reductase | 93.5 | |
| PRK08255 | 765 | salicylyl-CoA 5-hydroxylase; Reviewed | 93.3 | |
| PRK12814 | 652 | putative NADPH-dependent glutamate synthase small | 93.09 | |
| PRK09853 | 1019 | putative selenate reductase subunit YgfK; Provisio | 93.02 | |
| PRK12770 | 352 | putative glutamate synthase subunit beta; Provisio | 92.93 | |
| PRK12779 | 944 | putative bifunctional glutamate synthase subunit b | 92.75 | |
| PLN02328 | 808 | lysine-specific histone demethylase 1 homolog | 92.62 | |
| PLN03000 | 881 | amine oxidase | 92.6 | |
| COG3349 | 485 | Uncharacterized conserved protein [Function unknow | 92.49 | |
| COG3486 | 436 | IucD Lysine/ornithine N-monooxygenase [Secondary m | 92.24 | |
| TIGR01317 | 485 | GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal | 92.2 | |
| KOG2614|consensus | 420 | 91.86 | ||
| COG0446 | 415 | HcaD Uncharacterized NAD(FAD)-dependent dehydrogen | 91.76 | |
| PRK13512 | 438 | coenzyme A disulfide reductase; Provisional | 91.69 | |
| KOG4716|consensus | 503 | 91.68 | ||
| PLN02976 | 1713 | amine oxidase | 91.63 | |
| PTZ00188 | 506 | adrenodoxin reductase; Provisional | 91.22 | |
| PF13454 | 156 | NAD_binding_9: FAD-NAD(P)-binding | 91.19 | |
| TIGR01318 | 467 | gltD_gamma_fam glutamate synthase small subunit fa | 91.03 | |
| PRK13984 | 604 | putative oxidoreductase; Provisional | 90.24 | |
| PF13738 | 203 | Pyr_redox_3: Pyridine nucleotide-disulphide oxidor | 89.38 | |
| KOG2403|consensus | 642 | 89.21 | ||
| KOG1335|consensus | 506 | 87.98 | ||
| PRK12771 | 564 | putative glutamate synthase (NADPH) small subunit; | 87.81 | |
| COG1252 | 405 | Ndh NADH dehydrogenase, FAD-containing subunit [En | 87.12 | |
| COG1148 | 622 | HdrA Heterodisulfide reductase, subunit A and rela | 86.89 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 86.8 | |
| PF00743 | 531 | FMO-like: Flavin-binding monooxygenase-like; Inter | 86.54 | |
| KOG1276|consensus | 491 | 84.64 | ||
| PF02558 | 151 | ApbA: Ketopantoate reductase PanE/ApbA; InterPro: | 83.83 | |
| COG5044 | 434 | MRS6 RAB proteins geranylgeranyltransferase compon | 82.44 | |
| COG0446 | 415 | HcaD Uncharacterized NAD(FAD)-dependent dehydrogen | 82.33 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 82.17 | |
| TIGR01292 | 300 | TRX_reduct thioredoxin-disulfide reductase. This m | 81.31 | |
| KOG1439|consensus | 440 | 80.41 | ||
| KOG2755|consensus | 334 | 80.37 |
| >KOG1238|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.9e-131 Score=1165.89 Aligned_cols=558 Identities=36% Similarity=0.549 Sum_probs=499.4
Q ss_pred cCCCCCCcccC--CCCcccEEEECCCchHHHHHHHHhccCCCeEEEEeccCCCCCccccCCccccccCCcccCccccccc
Q psy11618 148 IYPPDMTPYVK--SGDCFDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTPIHSRIPGMSSVLSLSEFDHAYLAEPS 225 (1381)
Q Consensus 148 ~~p~~~~~~~~--~~~~YDYIIVGGGTAG~VLAsRLSEdpg~sVLVLEAG~d~~~~~~iP~~~~~l~~s~~DW~Y~TePq 225 (1381)
+...++.++.. ..++|||||||||||||++|+||||+|++|||+||||++++...++|......+.+.+||+|+|+||
T Consensus 41 ~~~~~~~~~~~~~~~~~yDyIVVGgGtAGcvlAarLSEn~~~~VLLLEaGg~~~~~~~~p~~~~~~q~s~~dw~y~t~Ps 120 (623)
T KOG1238|consen 41 DPESRPSDATGSELDSSYDYIVVGGGTAGCVLAARLSENPNWSVLLLEAGGDPPLYSDPPLLAANLQLSLYDWSYHTEPS 120 (623)
T ss_pred CcccccccccccccccCCCEEEECCCchhHHHHHhhccCCCceEEEEecCCCCcccccchHHHHHhccccccccCcCccC
Confidence 33344444444 5678999999999999999999999999999999999999888899977778888999999999999
Q ss_pred ccccccCCCceeecccccccCccccccceEEecCCccchHHHhhcCCCCCChhhHHHHHHHhcccccCCcccCCCCCCCC
Q psy11618 226 QFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAKLGYNGWGYDETLKYFVKSEDYRSVIYNESKAVHGTQ 305 (1381)
Q Consensus 226 ~~a~~gl~~r~i~~pRGKvLGGSSsINgmvy~RGs~~DFD~Wa~lGn~GWswedLlPYFkKsE~~~~p~~~~d~~~HG~~ 305 (1381)
+++|+++++++|+|||||++||||++|+|+|+||+++|||+|++.||+||+|++++|||+|+|+...++.+. .++||+.
T Consensus 121 ~~ac~~m~~~~c~wpRGrVLGGsS~iN~m~Y~RG~r~Dyd~W~~~gnpgW~y~~vl~yf~k~E~~~~~~~~~-~~y~~~~ 199 (623)
T KOG1238|consen 121 QHACLAMSEDRCYWPRGRVLGGSSVLNAMFYVRGNRRDYDRWAAEGNPGWSYDEVLPYFKKSEDKVVPDPEL-TPYHGAG 199 (623)
T ss_pred hhhhhhhcCCceecCccceecccccccceEEecCCccchHHHHHhcCCCCCHHHHHHHHHHHhhccCCCccc-CcccccC
Confidence 999999999999999999999999999999999999999999999999999999999999999998877665 5699999
Q ss_pred CCccccCCCCCCCchHHHHHHHHHHHcCCCCCCCCCCCCCCcccccCCCCCCCCcccchhhhcchhhhcCCCCeEEEcCc
Q psy11618 306 GYLPVGLFKNKENNIIREIFETSAQELGYPCPKDMNDRYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRTNLYVLKRS 385 (1381)
Q Consensus 306 GPL~Vs~~p~~e~~pl~~~f~eA~eeLG~p~~~D~N~g~~~~G~s~~~~ti~~G~RsSAa~AYL~Pa~~~R~NLtILTnA 385 (1381)
||..++..+++ ++..+++.++.+|+|.+.. |+||+. +.|++..+.++++|+|+|++++|++|+...|+|+|+..++
T Consensus 200 g~~~ve~~~~~--~~~~~~~~~ag~e~G~~~~-D~nG~~-~tg~~~l~~t~~~g~R~s~~~a~l~~~~~~R~NL~~~~~~ 275 (623)
T KOG1238|consen 200 GPLLVEAGVYP--NNLFTAFHRAGTEIGGSIF-DRNGER-HTGASLLQYTIRNGIRVSLAKAYLKPIRLTRPNLHISRNA 275 (623)
T ss_pred Ccceecccccc--CchhhHhHHhHHhcCCCcc-CCCCcc-ccchhhhhccccCCEEEEehhhhhhhhhccCccccccccc
Confidence 99999998888 8999999999999996544 999999 9999999999999999999999999998349999999999
Q ss_pred EEEEEEec-CCCeEEEEEEEecCCeEEEEecCcEEEEcCCchhhHHHHHHcCCCCCCccccCCCCcccCCc-cchhcccc
Q psy11618 386 KVTKVIIN-DQNVATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQDLR-VGENLKLN 463 (1381)
Q Consensus 386 ~VtRIlfd-~g~RAtGVE~vd~~Gr~~tV~ArKEVILSAGAI~SPqLLmlSGIGPkd~Le~lGIpVVvDLP-VGrNLQDH 463 (1381)
.|+||.+| .+++|+||+++++.|++++++|+|||||||||||||||||+|||||++||+++|||+++|+| ||||||||
T Consensus 276 ~vtrvl~D~~~~~a~gv~~~~~~~~~~~v~a~kEVILSAGAi~SPQLLMLSGIGP~~~L~~~gIpvv~dLP~VG~nLqDH 355 (623)
T KOG1238|consen 276 AVTRVLIDPAGKRAKGVEFVRDGGKEHTVKARKEVILSAGAINSPQLLMLSGIGPADHLKKLGIPVVLDLPGVGQNLQDH 355 (623)
T ss_pred eEEEEEEcCCCceEEEEEEEecCceeeeecccceEEEeccccCCHHHHHHcCCCcHHHHHhcCCCeeccCcccccccccc
Confidence 99999999 78899999999833899999999999999999999999999999999999999999999999 99999999
Q ss_pred ccCCceEEEecCCccccchhhHHHHHHhhccCCCCCCccccccccccccccccccccccccccccccccccCCCcccccc
Q psy11618 464 AQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLSNMHSYCYCLAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSA 543 (1381)
Q Consensus 464 p~v~~vvf~l~~~vs~sl~~a~a~~~Y~~nrtGPls~~~s~~~~~~~LDe~~~~~~~~l~vg~~~~~~~~~a~~~~a~~~ 543 (1381)
+..+ +....+++++ . ...+.
T Consensus 356 ~~~~-~~~~~~~~~~--~-----------------------------------------------~~~~~---------- 375 (623)
T KOG1238|consen 356 PMNP-GFVFSTNPVE--L-----------------------------------------------SLIRL---------- 375 (623)
T ss_pred cccc-eeeecCCCcc--c-----------------------------------------------ccccc----------
Confidence 9985 3333333321 0 00000
Q ss_pred cchhhhhhHHHHHHHHHcCCCCCccccccceEEEeecCCCC---CCCCeeeeeeccccccchhhhhhhhccccchhHHHH
Q psy11618 544 PLKRTVYSQEMVFKYLVNRIGPLSNAGLWSFTGYIDTLQNT---ARPDLEIHLLYFQQNDIRNMCKIKRAYDFNDEVQTA 620 (1381)
Q Consensus 544 pl~~tv~s~~~~~eYl~~~sGPLss~g~~e~~gFl~S~~~~---~~PDIq~~~~p~s~~~~d~~~~vk~~~g~~~~~~~~ 620 (1381)
.......+|+..++||.++.+ .+..+|.+++.+. ++||+|.++.+.+. ..+.....++..+ +++++
T Consensus 376 ------~~~~~~~~yl~~~~G~~~~~~-~e~~~f~~t~~~~~~~~~PD~~~~~~~~~~-~~~~~~~~~~~~~---~~y~~ 444 (623)
T KOG1238|consen 376 ------VGITTVGQYLEGGSGPLASPG-VETLGFINTVSSNLSLDWPDIELHFVAGSL-SSDGLTALRKALG---EIYQA 444 (623)
T ss_pred ------ccchHHHHHHHcCCCCcccCc-ceeeEEeccccccCcCCCCCeeEEeccccc-cccchhhhhhhcc---hHHHH
Confidence 013456789999999999877 7889999887654 89999988877665 3344444554444 66777
Q ss_pred HhccCCCCCeEEEEEeecccCcCcEEEeecCCCCCCccccCCCCCChhhHHHHHHHHHHHHHHhcCHHHHHhcccccccC
Q psy11618 621 YVNLNKRTDMGVISMSLVNPKSCGKVTLKSADPLAPPCIDTGILSEPEDLATLIRGTDYITRLEQTEAIRLAGGTLMSLN 700 (1381)
Q Consensus 621 ~~~p~~~~~~~tI~v~Ll~P~SRGsV~L~SsDP~d~PvIDpNYLSdP~Dle~LveGVR~arrIl~Tp~Lk~~g~~e~~~p 700 (1381)
.+.+..+++.+.+...+++|+|||+++|+|+||.++|.|++||++||+|+++++||+|.+.|+.+|++|++++++++.++
T Consensus 445 ~~~~~~~~~~~~i~~~~l~P~SrG~l~L~s~nP~~~P~I~~NY~~~p~Dv~~~vegi~~~~~l~~s~af~~~~~r~~~~~ 524 (623)
T KOG1238|consen 445 LFGELTNSDSFVIFPKLLRPKSRGRLKLRSTNPRDNPLITPNYFTHPEDVATLVEGIRTIIRLSNSKAFQRFGARLWKKP 524 (623)
T ss_pred hhhhhhcCceeEEeehhcCCCccceEEecCCCCCcCceeccCcCCCHHHHHHHHHHHHHHHHHHcCHHHHHhcchhcccc
Confidence 66666666778999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CccCCCCCCCCchhHHHHHhcccCCCcccccCccccCCCCCCcccCCCCeEeCcCCcEEecccCCCCCCCCCchHHHHHH
Q psy11618 701 LEACSQYPWRSTHSWTCYIRHLTTTTSNPVGTVMMGNADDPNAVVTPDLKVKGIKGLRVADISVLPNAIITQSDAISFLL 780 (1381)
Q Consensus 701 lPg~~~~~~~SDEeIe~yIR~~a~T~yHPvGTCRMGP~dDp~GVVDs~LRVhGVdNLRVVDASVfPtiPSgNpqApVyMI 780 (1381)
.|+|+.....||++|+|++|+.+.|.|||+|||||||+.||++|||+|+|||||+|||||||||||.+|++|||||||||
T Consensus 525 ~~~c~~~~~~sd~yw~c~~R~~~~TiyH~~GtckMGp~~D~~aVVD~~lrV~Gv~~LRVVDaSimP~~psgN~nA~v~MI 604 (623)
T KOG1238|consen 525 VPGCDLLAFLSDAYWECFCRHTVVTIYHYSGTCKMGPSSDPTAVVDPQLRVHGVRGLRVVDASIMPESPSGNPNAPVMMI 604 (623)
T ss_pred CCCcccccCCCHHHHHHHHHhccceeeccCCceEeCCccCCCcccCCcceeccccCceEeeccccCCCCCCCccHHHHHH
Confidence 99999888999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred H
Q psy11618 781 L 781 (1381)
Q Consensus 781 A 781 (1381)
|
T Consensus 605 g 605 (623)
T KOG1238|consen 605 G 605 (623)
T ss_pred H
Confidence 8
|
|
| >TIGR01810 betA choline dehydrogenase | Back alignment and domain information |
|---|
| >PRK02106 choline dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02785 Protein HOTHEAD | Back alignment and domain information |
|---|
| >COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] | Back alignment and domain information |
|---|
| >TIGR02462 pyranose_ox pyranose oxidase | Back alignment and domain information |
|---|
| >PF05199 GMC_oxred_C: GMC oxidoreductase; InterPro: IPR007867 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] | Back alignment and domain information |
|---|
| >PRK07121 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08274 tricarballylate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF00890 FAD_binding_2: FAD binding domain of the Pfam family | Back alignment and domain information |
|---|
| >PRK06175 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >TIGR01813 flavo_cyto_c flavocytochrome c | Back alignment and domain information |
|---|
| >PRK06854 adenylylsulfate reductase subunit alpha; Validated | Back alignment and domain information |
|---|
| >PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12842 putative succinate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06134 putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08275 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12843 putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00306 NADH-dependent fumarate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05257 malate:quinone oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit | Back alignment and domain information |
|---|
| >PRK12839 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06481 fumarate reductase flavoprotein subunit; Validated | Back alignment and domain information |
|---|
| >COG0579 Predicted dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07395 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK07804 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12409 D-amino acid dehydrogenase small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08071 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup | Back alignment and domain information |
|---|
| >PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12834 putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK09077 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase | Back alignment and domain information |
|---|
| >PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK00711 D-amino acid dehydrogenase small subunit; Validated | Back alignment and domain information |
|---|
| >PRK09231 fumarate reductase flavoprotein subunit; Validated | Back alignment and domain information |
|---|
| >PLN02815 L-aspartate oxidase | Back alignment and domain information |
|---|
| >PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PTZ00383 malate:quinone oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK11728 hydroxyglutarate oxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit | Back alignment and domain information |
|---|
| >PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR00551 nadB L-aspartate oxidase | Back alignment and domain information |
|---|
| >PRK08626 fumarate reductase flavoprotein subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01377 soxA_mon sarcosine oxidase, monomeric form | Back alignment and domain information |
|---|
| >PRK07512 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK13339 malate:quinone oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >PRK10157 putative oxidoreductase FixC; Provisional | Back alignment and domain information |
|---|
| >PLN02464 glycerol-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase | Back alignment and domain information |
|---|
| >PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle | Back alignment and domain information |
|---|
| >PTZ00363 rab-GDP dissociation inhibitor; Provisional | Back alignment and domain information |
|---|
| >PLN02661 Putative thiazole synthesis | Back alignment and domain information |
|---|
| >TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup | Back alignment and domain information |
|---|
| >PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit | Back alignment and domain information |
|---|
| >PRK11259 solA N-methyltryptophan oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK13977 myosin-cross-reactive antigen; Provisional | Back alignment and domain information |
|---|
| >PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG1298|consensus | Back alignment and domain information |
|---|
| >PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases | Back alignment and domain information |
|---|
| >COG2081 Predicted flavoproteins [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 | Back alignment and domain information |
|---|
| >PRK10015 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK04176 ribulose-1,5-biphosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A | Back alignment and domain information |
|---|
| >PRK06185 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02485 CobZ_N-term precorrin 3B synthase CobZ | Back alignment and domain information |
|---|
| >PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
| >PRK08401 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00292 thiazole biosynthesis enzyme | Back alignment and domain information |
|---|
| >PRK13369 glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG3573 Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02730 carot_isom carotene isomerase | Back alignment and domain information |
|---|
| >COG0029 NadB Aspartate oxidase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PLN02985 squalene monooxygenase | Back alignment and domain information |
|---|
| >PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated | Back alignment and domain information |
|---|
| >PRK07208 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01292 TRX_reduct thioredoxin-disulfide reductase | Back alignment and domain information |
|---|
| >TIGR02734 crtI_fam phytoene desaturase | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >KOG2404|consensus | Back alignment and domain information |
|---|
| >PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated | Back alignment and domain information |
|---|
| >TIGR02733 desat_CrtD C-3',4' desaturase CrtD | Back alignment and domain information |
|---|
| >PRK06126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit | Back alignment and domain information |
|---|
| >TIGR00275 flavoprotein, HI0933 family | Back alignment and domain information |
|---|
| >PRK07233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02731 phytoene_desat phytoene desaturase | Back alignment and domain information |
|---|
| >PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A | Back alignment and domain information |
|---|
| >COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >PLN02612 phytoene desaturase | Back alignment and domain information |
|---|
| >PRK08244 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4254|consensus | Back alignment and domain information |
|---|
| >PLN02172 flavin-containing monooxygenase FMO GS-OX | Back alignment and domain information |
|---|
| >PRK11445 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02732 zeta_caro_desat carotene 7,8-desaturase | Back alignment and domain information |
|---|
| >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit | Back alignment and domain information |
|---|
| >PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria | Back alignment and domain information |
|---|
| >PLN02487 zeta-carotene desaturase | Back alignment and domain information |
|---|
| >TIGR00136 gidA glucose-inhibited division protein A | Back alignment and domain information |
|---|
| >KOG0042|consensus | Back alignment and domain information |
|---|
| >COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] | Back alignment and domain information |
|---|
| >PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan | Back alignment and domain information |
|---|
| >PRK10262 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN00093 geranylgeranyl diphosphate reductase; Provisional | Back alignment and domain information |
|---|
| >KOG2415|consensus | Back alignment and domain information |
|---|
| >PRK07538 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12810 gltD glutamate synthase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein | Back alignment and domain information |
|---|
| >PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins | Back alignment and domain information |
|---|
| >TIGR01316 gltA glutamate synthase (NADPH), homotetrameric | Back alignment and domain information |
|---|
| >PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways | Back alignment and domain information |
|---|
| >TIGR02032 GG-red-SF geranylgeranyl reductase family | Back alignment and domain information |
|---|
| >TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit | Back alignment and domain information |
|---|
| >TIGR02023 BchP-ChlP geranylgeranyl reductase | Back alignment and domain information |
|---|
| >KOG2665|consensus | Back alignment and domain information |
|---|
| >PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K | Back alignment and domain information |
|---|
| >COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK09564 coenzyme A disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01789 lycopene_cycl lycopene cyclase | Back alignment and domain information |
|---|
| >COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional | Back alignment and domain information |
|---|
| >PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional | Back alignment and domain information |
|---|
| >PTZ00318 NADH dehydrogenase-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial | Back alignment and domain information |
|---|
| >PLN02463 lycopene beta cyclase | Back alignment and domain information |
|---|
| >PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK09126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional | Back alignment and domain information |
|---|
| >PRK06116 glutathione reductase; Validated | Back alignment and domain information |
|---|
| >TIGR02028 ChlP geranylgeranyl reductase | Back alignment and domain information |
|---|
| >PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >KOG3851|consensus | Back alignment and domain information |
|---|
| >PRK06370 mercuric reductase; Validated | Back alignment and domain information |
|---|
| >PTZ00058 glutathione reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06996 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06416 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08013 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07045 putative monooxygenase; Reviewed | Back alignment and domain information |
|---|
| >PLN02529 lysine-specific histone demethylase 1 | Back alignment and domain information |
|---|
| >PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G | Back alignment and domain information |
|---|
| >PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase | Back alignment and domain information |
|---|
| >TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant | Back alignment and domain information |
|---|
| >TIGR01790 carotene-cycl lycopene cyclase family protein | Back alignment and domain information |
|---|
| >PRK05976 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] | Back alignment and domain information |
|---|
| >KOG2820|consensus | Back alignment and domain information |
|---|
| >PRK14694 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK08132 FAD-dependent oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06115 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family | Back alignment and domain information |
|---|
| >KOG1399|consensus | Back alignment and domain information |
|---|
| >PLN02697 lycopene epsilon cyclase | Back alignment and domain information |
|---|
| >PRK06467 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06292 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase | Back alignment and domain information |
|---|
| >TIGR02053 MerA mercuric reductase | Back alignment and domain information |
|---|
| >COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >KOG0685|consensus | Back alignment and domain information |
|---|
| >TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 | Back alignment and domain information |
|---|
| >PRK13748 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07190 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07818 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00367 squalene epoxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein | Back alignment and domain information |
|---|
| >PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK09897 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >KOG2311|consensus | Back alignment and domain information |
|---|
| >PRK06327 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PLN02507 glutathione reductase | Back alignment and domain information |
|---|
| >PRK06184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06847 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02546 glutathione reductase | Back alignment and domain information |
|---|
| >KOG2852|consensus | Back alignment and domain information |
|---|
| >PRK07588 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B | Back alignment and domain information |
|---|
| >KOG2853|consensus | Back alignment and domain information |
|---|
| >COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01423 trypano_reduc trypanothione-disulfide reductase | Back alignment and domain information |
|---|
| >PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated | Back alignment and domain information |
|---|
| >PRK06753 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06834 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00052 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >KOG0029|consensus | Back alignment and domain information |
|---|
| >PRK08294 phenol 2-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >PLN02576 protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function | Back alignment and domain information |
|---|
| >PRK07236 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14989 nitrite reductase subunit NirD; Provisional | Back alignment and domain information |
|---|
| >PRK11883 protoporphyrinogen oxidase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00562 proto_IX_ox protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >PTZ00153 lipoamide dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase | Back alignment and domain information |
|---|
| >PRK14727 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08163 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PLN02268 probable polyamine oxidase | Back alignment and domain information |
|---|
| >PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >KOG3855|consensus | Back alignment and domain information |
|---|
| >PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] | Back alignment and domain information |
|---|
| >TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit | Back alignment and domain information |
|---|
| >COG2907 Predicted NAD/FAD-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05868 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK07846 mycothione reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain | Back alignment and domain information |
|---|
| >TIGR03452 mycothione_red mycothione reductase | Back alignment and domain information |
|---|
| >PRK12416 protoporphyrinogen oxidase; Provisional | Back alignment and domain information |
|---|
| >PLN02676 polyamine oxidase | Back alignment and domain information |
|---|
| >PLN02568 polyamine oxidase | Back alignment and domain information |
|---|
| >PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed | Back alignment and domain information |
|---|
| >TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit | Back alignment and domain information |
|---|
| >KOG2844|consensus | Back alignment and domain information |
|---|
| >PRK06912 acoL dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E | Back alignment and domain information |
|---|
| >KOG2960|consensus | Back alignment and domain information |
|---|
| >PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase | Back alignment and domain information |
|---|
| >TIGR02352 thiamin_ThiO glycine oxidase ThiO | Back alignment and domain information |
|---|
| >COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0405|consensus | Back alignment and domain information |
|---|
| >TIGR03219 salicylate_mono salicylate 1-monooxygenase | Back alignment and domain information |
|---|
| >PRK06475 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >COG1231 Monoamine oxidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12831 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase | Back alignment and domain information |
|---|
| >PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >PRK07845 flavoprotein disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >PLN02852 ferredoxin-NADP+ reductase | Back alignment and domain information |
|---|
| >PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09853 putative selenate reductase subunit YgfK; Provisional | Back alignment and domain information |
|---|
| >PRK12770 putative glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PLN02328 lysine-specific histone demethylase 1 homolog | Back alignment and domain information |
|---|
| >PLN03000 amine oxidase | Back alignment and domain information |
|---|
| >COG3349 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit | Back alignment and domain information |
|---|
| >KOG2614|consensus | Back alignment and domain information |
|---|
| >COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13512 coenzyme A disulfide reductase; Provisional | Back alignment and domain information |
|---|
| >KOG4716|consensus | Back alignment and domain information |
|---|
| >PLN02976 amine oxidase | Back alignment and domain information |
|---|
| >PTZ00188 adrenodoxin reductase; Provisional | Back alignment and domain information |
|---|
| >PF13454 NAD_binding_9: FAD-NAD(P)-binding | Back alignment and domain information |
|---|
| >TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial | Back alignment and domain information |
|---|
| >PRK13984 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A | Back alignment and domain information |
|---|
| >KOG2403|consensus | Back alignment and domain information |
|---|
| >KOG1335|consensus | Back alignment and domain information |
|---|
| >PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional | Back alignment and domain information |
|---|
| >COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] | Back alignment and domain information |
|---|
| >KOG1276|consensus | Back alignment and domain information |
|---|
| >PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 | Back alignment and domain information |
|---|
| >COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >TIGR01292 TRX_reduct thioredoxin-disulfide reductase | Back alignment and domain information |
|---|
| >KOG1439|consensus | Back alignment and domain information |
|---|
| >KOG2755|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 1381 | ||||
| 3q9t_A | 577 | Crystal Structure Analysis Of Formate Oxidase Lengt | 6e-26 | ||
| 3t37_A | 526 | Crystal Structure Of Pyridoxine 4-Oxidase From Meso | 5e-24 | ||
| 3fim_B | 566 | Crystal Structure Of Aryl-Alcohol-Oxidase From Pleu | 4e-23 | ||
| 3fim_B | 566 | Crystal Structure Of Aryl-Alcohol-Oxidase From Pleu | 5e-08 | ||
| 1gpe_A | 587 | Glucose Oxidase From Penicillium Amagasakiense Leng | 3e-20 | ||
| 1cf3_A | 583 | Glucose Oxidase From Apergillus Niger Length = 583 | 7e-20 | ||
| 2jbv_A | 546 | Crystal Structure Of Choline Oxidase Reveals Insigh | 2e-17 | ||
| 2jbv_A | 546 | Crystal Structure Of Choline Oxidase Reveals Insigh | 8e-11 | ||
| 3ljp_A | 546 | Crystal Structure Of Choline Oxidase V464a Mutant L | 3e-17 | ||
| 3ljp_A | 546 | Crystal Structure Of Choline Oxidase V464a Mutant L | 8e-11 | ||
| 3nne_A | 546 | Crystal Structure Of Choline Oxidase S101a Mutant L | 4e-17 | ||
| 3nne_A | 546 | Crystal Structure Of Choline Oxidase S101a Mutant L | 8e-11 | ||
| 1ju2_A | 536 | Crystal Structure Of The Hydroxynitrile Lyase From | 3e-11 | ||
| 3gdn_A | 521 | Almond Hydroxynitrile Lyase In Complex With Benzald | 3e-11 | ||
| 3red_A | 521 | 3.0 A Structure Of The Prunus Mume Hydroxynitrile L | 6e-11 | ||
| 1naa_A | 541 | Cellobiose Dehydrogenase Flavoprotein Fragment In C | 1e-04 | ||
| 1kdg_A | 546 | Crystal Structure Of The Flavin Domain Of Cellobios | 2e-04 |
| >pdb|3Q9T|A Chain A, Crystal Structure Analysis Of Formate Oxidase Length = 577 | Back alignment and structure |
|
| >pdb|3T37|A Chain A, Crystal Structure Of Pyridoxine 4-Oxidase From Mesorbium Loti Length = 526 | Back alignment and structure |
| >pdb|3FIM|B Chain B, Crystal Structure Of Aryl-Alcohol-Oxidase From Pleurotus Eryingii Length = 566 | Back alignment and structure |
| >pdb|3FIM|B Chain B, Crystal Structure Of Aryl-Alcohol-Oxidase From Pleurotus Eryingii Length = 566 | Back alignment and structure |
| >pdb|1GPE|A Chain A, Glucose Oxidase From Penicillium Amagasakiense Length = 587 | Back alignment and structure |
| >pdb|1CF3|A Chain A, Glucose Oxidase From Apergillus Niger Length = 583 | Back alignment and structure |
| >pdb|2JBV|A Chain A, Crystal Structure Of Choline Oxidase Reveals Insights Into The Catalytic Mechanism Length = 546 | Back alignment and structure |
| >pdb|2JBV|A Chain A, Crystal Structure Of Choline Oxidase Reveals Insights Into The Catalytic Mechanism Length = 546 | Back alignment and structure |
| >pdb|3LJP|A Chain A, Crystal Structure Of Choline Oxidase V464a Mutant Length = 546 | Back alignment and structure |
| >pdb|3LJP|A Chain A, Crystal Structure Of Choline Oxidase V464a Mutant Length = 546 | Back alignment and structure |
| >pdb|3NNE|A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant Length = 546 | Back alignment and structure |
| >pdb|3NNE|A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant Length = 546 | Back alignment and structure |
| >pdb|1JU2|A Chain A, Crystal Structure Of The Hydroxynitrile Lyase From Almond Length = 536 | Back alignment and structure |
| >pdb|3GDN|A Chain A, Almond Hydroxynitrile Lyase In Complex With Benzaldehyde Length = 521 | Back alignment and structure |
| >pdb|3RED|A Chain A, 3.0 A Structure Of The Prunus Mume Hydroxynitrile Lyase Isozyme-1 Length = 521 | Back alignment and structure |
| >pdb|1NAA|A Chain A, Cellobiose Dehydrogenase Flavoprotein Fragment In Complex With Cellobionolactam Length = 541 | Back alignment and structure |
| >pdb|1KDG|A Chain A, Crystal Structure Of The Flavin Domain Of Cellobiose Dehydrogenase Length = 546 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1381 | |||
| 3q9t_A | 577 | Choline dehydrogenase and related flavoproteins; g | 1e-124 | |
| 1gpe_A | 587 | Protein (glucose oxidase); oxidoreductase(flavopro | 1e-98 | |
| 1gpe_A | 587 | Protein (glucose oxidase); oxidoreductase(flavopro | 5e-40 | |
| 3qvp_A | 583 | Glucose oxidase; oxidoreductase; HET: NAG BMA MAN | 5e-95 | |
| 3qvp_A | 583 | Glucose oxidase; oxidoreductase; HET: NAG BMA MAN | 7e-36 | |
| 3fim_B | 566 | ARYL-alcohol oxidase; AAO, lignin degradation, oxi | 3e-91 | |
| 3fim_B | 566 | ARYL-alcohol oxidase; AAO, lignin degradation, oxi | 3e-41 | |
| 2jbv_A | 546 | Choline oxidase; alcohol oxidation, flavoenyzme ox | 1e-86 | |
| 2jbv_A | 546 | Choline oxidase; alcohol oxidation, flavoenyzme ox | 8e-32 | |
| 3t37_A | 526 | Probable dehydrogenase; BET alpha beta fold, ADP b | 2e-85 | |
| 3t37_A | 526 | Probable dehydrogenase; BET alpha beta fold, ADP b | 4e-31 | |
| 1kdg_A | 546 | CDH, cellobiose dehydrogenase; GMC oxidoreductase, | 1e-82 | |
| 1kdg_A | 546 | CDH, cellobiose dehydrogenase; GMC oxidoreductase, | 7e-31 | |
| 1ju2_A | 536 | HydroxynitrIle lyase; flavin, GMC oxidoreductase, | 2e-74 | |
| 1ju2_A | 536 | HydroxynitrIle lyase; flavin, GMC oxidoreductase, | 1e-28 | |
| 3pl8_A | 623 | Pyranose 2-oxidase; substrate complex, H167A mutan | 6e-29 | |
| 1n4w_A | 504 | CHOD, cholesterol oxidase; flavoenzyme, steroid me | 2e-26 | |
| 1n4w_A | 504 | CHOD, cholesterol oxidase; flavoenzyme, steroid me | 5e-06 | |
| 1coy_A | 507 | Cholesterol oxidase; oxidoreductase(oxygen recepto | 9e-24 | |
| 1coy_A | 507 | Cholesterol oxidase; oxidoreductase(oxygen recepto | 3e-04 | |
| 3rce_A | 724 | Oligosaccharide transferase to N-glycosylate PROT; | 1e-08 | |
| 3rce_A | 724 | Oligosaccharide transferase to N-glycosylate PROT; | 4e-05 | |
| 1qo8_A | 566 | Flavocytochrome C3 fumarate reductase; oxidoreduct | 9e-06 | |
| 1y0p_A | 571 | Fumarate reductase flavoprotein subunit; flavocyto | 1e-05 | |
| 1d4d_A | 572 | Flavocytochrome C fumarate reductase; oxidoreducta | 2e-05 | |
| 3b8c_A | 885 | ATPase 2, plasma membrane-type; P-type ATPase, pro | 8e-05 | |
| 3b8c_A | 885 | ATPase 2, plasma membrane-type; P-type ATPase, pro | 8e-05 | |
| 3b8c_A | 885 | ATPase 2, plasma membrane-type; P-type ATPase, pro | 8e-05 | |
| 1rp0_A | 284 | ARA6, thiazole biosynthetic enzyme; protein ligand | 9e-05 | |
| 1mhs_A | 920 | Proton pump, plasma membrane ATPase; ION transport | 1e-04 | |
| 1mhs_A | 920 | Proton pump, plasma membrane ATPase; ION transport | 1e-04 | |
| 1mhs_A | 920 | Proton pump, plasma membrane ATPase; ION transport | 1e-04 | |
| 1mhs_A | 920 | Proton pump, plasma membrane ATPase; ION transport | 1e-04 | |
| 1mhs_A | 920 | Proton pump, plasma membrane ATPase; ION transport | 1e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-04 | |
| 3ayf_A | 800 | Nitric oxide reductase; oxidoreductase; HET: HEM B | 1e-04 | |
| 3ayf_A | 800 | Nitric oxide reductase; oxidoreductase; HET: HEM B | 3e-04 | |
| 4at0_A | 510 | 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore | 4e-04 | |
| 1v0j_A | 399 | UDP-galactopyranose mutase; flavoprotein, isomeras | 6e-04 |
| >3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Length = 577 | Back alignment and structure |
|---|
Score = 396 bits (1019), Expect = e-124
Identities = 140/628 (22%), Positives = 218/628 (34%), Gaps = 102/628 (16%)
Query: 163 FDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTP-----IHSRIPGMSSVLSLSEFD 217
FD +IVG AG +A RL+E ++ VL++EAG P I P + L S++D
Sbjct: 7 FDFVIVGGGTAGNTVAGRLAENPNVTVLIVEAGIGNPEDIPEIT--TPSSAMDLRNSKYD 64
Query: 218 HAYLAEPSQFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAKLGYNGWGY 277
AY T GK LGGSS++ + G ++ + + G W +
Sbjct: 65 WAYKTTMV--RRDDYERIEKPNTRGKTLGGSSSLNYFTWVPGHKATFDQWEEFGGKEWTW 122
Query: 278 DETLKYFVKSEDYR--SVIYNESKAVHGTQGYLPVGLFKNK-ENNIIREIFETSAQELGY 334
D + Y KS Y +Y+ G G +P+ + E RE + + +G
Sbjct: 123 DPLVPYLRKSATYHDDPRLYSPELEKIGGGGPIPISHAELIDEMAPFRENLTKAWKSMGQ 182
Query: 335 PCPKDMNDRYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRTNLYVLKRSKVTKVIIND 394
P +++ D G G R + + N+ ++ ++IIN+
Sbjct: 183 PLIENIYD-GEMDGLTHCCDTIYRGQRSGSFLF-----VKNKPNITIVPEVHSKRLIINE 236
Query: 395 QN-VATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQD 453
+ GV V + G + A++EVIL+ G +LL+LSGIGP L I D
Sbjct: 237 ADRTCKGVTVVTAAGNELNFFADREVILSQGVFETPKLLMLSGIGPTRELSRHGINTIVD 296
Query: 454 LR-VGENL----KLNAQF--TGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLSNMHSYCY 506
R VG+NL + L+ +V Y NR GP+ +
Sbjct: 297 SRHVGQNLMDHPGVPFVLRVKDGFGMDDVLLRHGPKRDAVVSAYNKNRSGPVGSGLLE-- 354
Query: 507 CLAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPL 566
++ F + + K R
Sbjct: 355 -------------------------------LVGF-------PRIDKYLEKDAEYRKAKA 376
Query: 567 SNAGLWSFTGYIDTLQNTARPDLEIHLLYFQQNDIRNMCKIKRAYDFNDEVQTAYVNLNK 626
+N G F+ P + H F Q +
Sbjct: 377 ANGGKDPFS-----------PLGQPHFELDF------------VCMFGTAFQWHFPTPKT 413
Query: 627 RTDMGVISMSLVNPKS-CGKVTLKSADPLAPPCIDTGILSEPEDLATLIRGTDYITR--L 683
+ V+ + P S G+VTL SADP P I+ + D+ + G + L
Sbjct: 414 GDHLTVVVDLV-RPISDPGEVTLNSADPFQQPNINLNFFANDLDIIAMREGIR-FSYDLL 471
Query: 684 EQTEAIRLAGGTLMSLNLEACSQYPWRSTHSWTCYIRHLTTTTSNPVGTVMMGNADDPNA 743
+ E + + + S + T +P GT + +
Sbjct: 472 FKGEGFKDLVESEYPWEMPL------DSDKEMHRAVLDRCQTAFHPTGTARLS-KNIDQG 524
Query: 744 VVTPDLKVKGIKGLRVADISVLPNAIIT 771
VV P LKV GIK LRVAD SV+P I
Sbjct: 525 VVDPKLKVHGIKKLRVADASVIPI-IPD 551
|
| >1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Length = 587 | Back alignment and structure |
|---|
| >1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Length = 587 | Back alignment and structure |
|---|
| >3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Length = 583 | Back alignment and structure |
|---|
| >3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Length = 583 | Back alignment and structure |
|---|
| >3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Length = 566 | Back alignment and structure |
|---|
| >3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Length = 566 | Back alignment and structure |
|---|
| >2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Length = 546 | Back alignment and structure |
|---|
| >2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Length = 546 | Back alignment and structure |
|---|
| >3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Length = 526 | Back alignment and structure |
|---|
| >3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Length = 526 | Back alignment and structure |
|---|
| >1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Length = 546 | Back alignment and structure |
|---|
| >1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Length = 546 | Back alignment and structure |
|---|
| >1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Length = 536 | Back alignment and structure |
|---|
| >1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Length = 536 | Back alignment and structure |
|---|
| >3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Length = 623 | Back alignment and structure |
|---|
| >1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Length = 504 | Back alignment and structure |
|---|
| >1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Length = 504 | Back alignment and structure |
|---|
| >1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Length = 507 | Back alignment and structure |
|---|
| >1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Length = 507 | Back alignment and structure |
|---|
| >3rce_A Oligosaccharide transferase to N-glycosylate PROT; oligosaccharyltransferase, membrane protein, helical bundle, glycosylation, acceptor peptide, plasma membrane; HET: PPN; 3.40A {Campylobacter lari} Length = 724 | Back alignment and structure |
|---|
| >3rce_A Oligosaccharide transferase to N-glycosylate PROT; oligosaccharyltransferase, membrane protein, helical bundle, glycosylation, acceptor peptide, plasma membrane; HET: PPN; 3.40A {Campylobacter lari} Length = 724 | Back alignment and structure |
|---|
| >1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Length = 566 | Back alignment and structure |
|---|
| >1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571 | Back alignment and structure |
|---|
| >1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 | Back alignment and structure |
|---|
| >3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} Length = 885 | Back alignment and structure |
|---|
| >3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} Length = 885 | Back alignment and structure |
|---|
| >3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} Length = 885 | Back alignment and structure |
|---|
| >1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Length = 284 | Back alignment and structure |
|---|
| >1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Length = 920 | Back alignment and structure |
|---|
| >1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Length = 920 | Back alignment and structure |
|---|
| >1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Length = 920 | Back alignment and structure |
|---|
| >1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Length = 920 | Back alignment and structure |
|---|
| >1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Length = 920 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3ayf_A Nitric oxide reductase; oxidoreductase; HET: HEM BOG EPE LOP; 2.50A {Geobacillus stearothermophilus} PDB: 3ayg_A* Length = 800 | Back alignment and structure |
|---|
| >3ayf_A Nitric oxide reductase; oxidoreductase; HET: HEM BOG EPE LOP; 2.50A {Geobacillus stearothermophilus} PDB: 3ayg_A* Length = 800 | Back alignment and structure |
|---|
| >4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Length = 510 | Back alignment and structure |
|---|
| >1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Length = 399 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1381 | |||
| 3fim_B | 566 | ARYL-alcohol oxidase; AAO, lignin degradation, oxi | 100.0 | |
| 3qvp_A | 583 | Glucose oxidase; oxidoreductase; HET: NAG BMA MAN | 100.0 | |
| 3q9t_A | 577 | Choline dehydrogenase and related flavoproteins; g | 100.0 | |
| 3t37_A | 526 | Probable dehydrogenase; BET alpha beta fold, ADP b | 100.0 | |
| 1gpe_A | 587 | Protein (glucose oxidase); oxidoreductase(flavopro | 100.0 | |
| 2jbv_A | 546 | Choline oxidase; alcohol oxidation, flavoenyzme ox | 100.0 | |
| 1ju2_A | 536 | HydroxynitrIle lyase; flavin, GMC oxidoreductase, | 100.0 | |
| 1kdg_A | 546 | CDH, cellobiose dehydrogenase; GMC oxidoreductase, | 100.0 | |
| 1n4w_A | 504 | CHOD, cholesterol oxidase; flavoenzyme, steroid me | 100.0 | |
| 1coy_A | 507 | Cholesterol oxidase; oxidoreductase(oxygen recepto | 100.0 | |
| 3pl8_A | 623 | Pyranose 2-oxidase; substrate complex, H167A mutan | 100.0 | |
| 4at0_A | 510 | 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore | 99.55 | |
| 3dme_A | 369 | Conserved exported protein; structural genomics, P | 99.12 | |
| 1qo8_A | 566 | Flavocytochrome C3 fumarate reductase; oxidoreduct | 99.09 | |
| 2gag_B | 405 | Heterotetrameric sarcosine oxidase beta-subunit; f | 99.09 | |
| 1y0p_A | 571 | Fumarate reductase flavoprotein subunit; flavocyto | 99.08 | |
| 2wdq_A | 588 | Succinate dehydrogenase flavoprotein subunit; succ | 98.96 | |
| 3da1_A | 561 | Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 | 98.96 | |
| 2h88_A | 621 | Succinate dehydrogenase flavoprotein subunit; comp | 98.93 | |
| 1chu_A | 540 | Protein (L-aspartate oxidase); flavoenzyme, NAD bi | 98.91 | |
| 1y56_B | 382 | Sarcosine oxidase; dehydrogenase, protein-protein | 98.91 | |
| 1d4d_A | 572 | Flavocytochrome C fumarate reductase; oxidoreducta | 98.89 | |
| 2rgh_A | 571 | Alpha-glycerophosphate oxidase; flavoprotein oxida | 98.88 | |
| 3nyc_A | 381 | D-arginine dehydrogenase; FAD, imino-arginine, oxi | 98.87 | |
| 1jnr_A | 643 | Adenylylsulfate reductase; oxidoreductase; HET: FA | 98.86 | |
| 2bs2_A | 660 | Quinol-fumarate reductase flavoprotein subunit A; | 98.85 | |
| 3dje_A | 438 | Fructosyl amine: oxygen oxidoreductase; fructosyl- | 98.83 | |
| 2gf3_A | 389 | MSOX, monomeric sarcosine oxidase; flavoprotein ox | 98.83 | |
| 3gyx_A | 662 | Adenylylsulfate reductase; oxidoreductase; HET: FA | 98.83 | |
| 1kf6_A | 602 | Fumarate reductase flavoprotein; respiration, fuma | 98.81 | |
| 3ps9_A | 676 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 98.78 | |
| 2oln_A | 397 | NIKD protein; flavoprotein, rossmann fold, oxidore | 98.77 | |
| 1pj5_A | 830 | N,N-dimethylglycine oxidase; channelling, FAD bind | 98.75 | |
| 3itj_A | 338 | Thioredoxin reductase 1; disulfide B flavoprotein, | 98.72 | |
| 3pvc_A | 689 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 98.68 | |
| 1ryi_A | 382 | Glycine oxidase; flavoprotein, protein-inhibitor c | 98.67 | |
| 2uzz_A | 372 | N-methyl-L-tryptophan oxidase; N-methyltryptophan | 98.67 | |
| 3cgv_A | 397 | Geranylgeranyl reductase related protein; NP_39399 | 98.67 | |
| 3axb_A | 448 | Putative oxidoreductase; dinucleotide-binding fold | 98.66 | |
| 3oz2_A | 397 | Digeranylgeranylglycerophospholipid reductase; str | 98.66 | |
| 2i0z_A | 447 | NAD(FAD)-utilizing dehydrogenases; structural geno | 98.63 | |
| 1rp0_A | 284 | ARA6, thiazole biosynthetic enzyme; protein ligand | 98.61 | |
| 3f8d_A | 323 | Thioredoxin reductase (TRXB-3); redox protein, nuc | 98.58 | |
| 3nlc_A | 549 | Uncharacterized protein VP0956; FAD-binding protei | 98.57 | |
| 3p1w_A | 475 | Rabgdi protein; GDI RAB, malaria, structural genom | 98.56 | |
| 2qcu_A | 501 | Aerobic glycerol-3-phosphate dehydrogenase; glycer | 98.56 | |
| 3ka7_A | 425 | Oxidoreductase; structural genomics, PSI-2, protei | 98.55 | |
| 3e1t_A | 512 | Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro | 98.47 | |
| 4dgk_A | 501 | Phytoene dehydrogenase; the FAD/NAD(P)-binding ros | 98.45 | |
| 3v76_A | 417 | Flavoprotein; structural genomics, PSI-biology, NE | 98.44 | |
| 3lxd_A | 415 | FAD-dependent pyridine nucleotide-disulphide oxido | 98.41 | |
| 2e5v_A | 472 | L-aspartate oxidase; archaea, oxidoreductase; HET: | 98.41 | |
| 3nix_A | 421 | Flavoprotein/dehydrogenase; structural genomics, P | 98.39 | |
| 3r9u_A | 315 | Thioredoxin reductase; structural genomics, center | 98.38 | |
| 3i3l_A | 591 | Alkylhalidase CMLS; flavin-dependent halogenase, c | 98.33 | |
| 2bcg_G | 453 | Secretory pathway GDP dissociation inhibitor; RABG | 98.31 | |
| 3jsk_A | 344 | Cypbp37 protein; octameric thiazole synthase, bios | 98.29 | |
| 3cty_A | 319 | Thioredoxin reductase; FAD, oxidoreductase, flavin | 98.28 | |
| 2gmh_A | 584 | Electron transfer flavoprotein-ubiquinone oxidored | 98.26 | |
| 1fl2_A | 310 | Alkyl hydroperoxide reductase subunit F; reactive | 98.25 | |
| 3atr_A | 453 | Conserved archaeal protein; saturating double bond | 98.24 | |
| 3i6d_A | 470 | Protoporphyrinogen oxidase; protein-inhibitor comp | 98.23 | |
| 2gjc_A | 326 | Thiazole biosynthetic enzyme, mitochondrial; gluta | 98.21 | |
| 1trb_A | 320 | Thioredoxin reductase; oxidoreductase(flavoenzyme) | 98.21 | |
| 3nrn_A | 421 | Uncharacterized protein PF1083; alpha-beta protein | 98.2 | |
| 1mo9_A | 523 | ORF3; nucleotide binding motifs, nucleotide bindin | 98.19 | |
| 3k7m_X | 431 | 6-hydroxy-L-nicotine oxidase; enantiomeric substra | 98.18 | |
| 3fg2_P | 404 | Putative rubredoxin reductase; ferredoxin reductas | 98.17 | |
| 4a5l_A | 314 | Thioredoxin reductase; oxidoreductase, redox metab | 98.16 | |
| 1d5t_A | 433 | Guanine nucleotide dissociation inhibitor; ultra-h | 98.16 | |
| 2q0l_A | 311 | TRXR, thioredoxin reductase; bacterial thiredoxin | 98.16 | |
| 2gqf_A | 401 | Hypothetical protein HI0933; structural genomics, | 98.15 | |
| 2q7v_A | 325 | Thioredoxin reductase; rossman fold, FAD, flavopro | 98.15 | |
| 3kkj_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 98.11 | |
| 3ab1_A | 360 | Ferredoxin--NADP reductase; oxidoreductase, electr | 98.11 | |
| 3ihg_A | 535 | RDME; flavoenzyme, anthracycline, polyketide biosy | 98.09 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 98.08 | |
| 2a87_A | 335 | TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL | 98.06 | |
| 3h28_A | 430 | Sulfide-quinone reductase; monotopic membrane prot | 98.02 | |
| 1yvv_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 98.02 | |
| 1vdc_A | 333 | NTR, NADPH dependent thioredoxin reductase; hypoth | 97.98 | |
| 3lzw_A | 332 | Ferredoxin--NADP reductase 2; ferredoxin reductase | 97.97 | |
| 3hyw_A | 430 | Sulfide-quinone reductase; monotopic membrane prot | 97.97 | |
| 1q1r_A | 431 | Putidaredoxin reductase; glutathione reductase fol | 97.93 | |
| 2ivd_A | 478 | PPO, PPOX, protoporphyrinogen oxidase; porphyrin b | 97.93 | |
| 3iwa_A | 472 | FAD-dependent pyridine nucleotide-disulphide oxido | 97.89 | |
| 4a9w_A | 357 | Monooxygenase; baeyer-villiger, FAD, oxidoreductas | 97.88 | |
| 3fmw_A | 570 | Oxygenase; mithramycin, baeyer-villiger, flavin bi | 97.86 | |
| 3sx6_A | 437 | Sulfide-quinone reductase, putative; sulfide:quino | 97.78 | |
| 3qj4_A | 342 | Renalase; FAD/NAD(P)-binding rossmann fold superfa | 97.76 | |
| 3fpz_A | 326 | Thiazole biosynthetic enzyme; FAD, mitochondrion, | 97.73 | |
| 2cdu_A | 452 | NADPH oxidase; flavoenzyme, oxidoreductase; HET: F | 97.72 | |
| 3lov_A | 475 | Protoporphyrinogen oxidase; structural genomics, J | 97.71 | |
| 1m6i_A | 493 | Programmed cell death protein 8; apoptosis, AIF, o | 97.68 | |
| 3oc4_A | 452 | Oxidoreductase, pyridine nucleotide-disulfide FAM; | 97.68 | |
| 3kd9_A | 449 | Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o | 97.66 | |
| 3h8l_A | 409 | NADH oxidase; membrane protein, complete form, ros | 97.65 | |
| 4gut_A | 776 | Lysine-specific histone demethylase 1B; histone de | 97.64 | |
| 4gde_A | 513 | UDP-galactopyranose mutase; flavin adenine dinucle | 97.64 | |
| 2v3a_A | 384 | Rubredoxin reductase; alkane degradation, NADH oxi | 97.63 | |
| 3vrd_B | 401 | FCCB subunit, flavocytochrome C flavin subunit; su | 97.59 | |
| 2gag_A | 965 | Heterotetrameric sarcosine oxidase alpha-subunit; | 97.55 | |
| 4gcm_A | 312 | TRXR, thioredoxin reductase; FAD/NAD-linked reduct | 97.54 | |
| 3cgb_A | 480 | Pyridine nucleotide-disulfide oxidoreductase, CLA; | 97.54 | |
| 3ef6_A | 410 | Toluene 1,2-dioxygenase system ferredoxin--NAD(+) | 97.53 | |
| 3rp8_A | 407 | Flavoprotein monooxygenase; FAD-binding protein, o | 97.52 | |
| 4fk1_A | 304 | Putative thioredoxin reductase; structural genomic | 97.5 | |
| 4b63_A | 501 | L-ornithine N5 monooxygenase; oxidoreductase, side | 97.43 | |
| 2gqw_A | 408 | Ferredoxin reductase; flavoprotein, oxidoreductase | 97.4 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 97.26 | |
| 1v0j_A | 399 | UDP-galactopyranose mutase; flavoprotein, isomeras | 97.26 | |
| 1c0p_A | 363 | D-amino acid oxidase; alpha-beta-alpha motif, flav | 97.25 | |
| 3urh_A | 491 | Dihydrolipoyl dehydrogenase; PSI-biology, structur | 97.19 | |
| 3dk9_A | 478 | Grase, GR, glutathione reductase; flavoenzyme, nic | 97.14 | |
| 2x3n_A | 399 | Probable FAD-dependent monooxygenase; oxidoreducta | 97.13 | |
| 1i8t_A | 367 | UDP-galactopyranose mutase; rossman fold, FAD, con | 97.13 | |
| 3o0h_A | 484 | Glutathione reductase; ssgcid, structur genomics, | 97.13 | |
| 2xdo_A | 398 | TETX2 protein; tetracycline degradation, tigecycli | 97.12 | |
| 3lad_A | 476 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 97.1 | |
| 3c4n_A | 405 | Uncharacterized protein DR_0571; alpha-beta protei | 97.08 | |
| 2cul_A | 232 | Glucose-inhibited division protein A-related PROT | 97.04 | |
| 3alj_A | 379 | 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; | 97.03 | |
| 3hdq_A | 397 | UDP-galactopyranose mutase; substrate and inhibito | 96.99 | |
| 2qa1_A | 500 | PGAE, polyketide oxygenase PGAE; FAD, angucycline, | 96.95 | |
| 4dna_A | 463 | Probable glutathione reductase; structural genomic | 96.92 | |
| 2zbw_A | 335 | Thioredoxin reductase; redox protein, oxidoreducta | 96.92 | |
| 2qa2_A | 499 | CABE, polyketide oxygenase CABE; FAD, angucycline, | 96.92 | |
| 1k0i_A | 394 | P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h | 96.91 | |
| 3dgh_A | 483 | TRXR-1, thioredoxin reductase 1, mitochondrial; ox | 96.9 | |
| 2e4g_A | 550 | Tryptophan halogenase; flavin-binding, rebeccamyci | 96.9 | |
| 3fbs_A | 297 | Oxidoreductase; structural genomics, PSI2, MCSG, p | 96.89 | |
| 2aqj_A | 538 | Tryptophan halogenase, pRNA; flavin-dependent halo | 96.88 | |
| 2vou_A | 397 | 2,6-dihydroxypyridine hydroxylase; oxidoreductase, | 96.87 | |
| 3c96_A | 410 | Flavin-containing monooxygenase; FAD, oxidoreducta | 96.86 | |
| 2b9w_A | 424 | Putative aminooxidase; isomerase, conjugated linol | 96.86 | |
| 2yg5_A | 453 | Putrescine oxidase; oxidoreductase, flavin; HET: F | 96.83 | |
| 3ic9_A | 492 | Dihydrolipoamide dehydrogenase; APC62701, colwelli | 96.82 | |
| 2ywl_A | 180 | Thioredoxin reductase related protein; uncharacter | 96.81 | |
| 3dgz_A | 488 | Thioredoxin reductase 2; oxidoreductase, rossmann, | 96.81 | |
| 2vvm_A | 495 | Monoamine oxidase N; FAD, peroxisome, flavoprotein | 96.81 | |
| 3g3e_A | 351 | D-amino-acid oxidase; FAD, flavoprotein, oxidoredu | 96.79 | |
| 3ihm_A | 430 | Styrene monooxygenase A; rossman fold, anti-parall | 96.78 | |
| 2r0c_A | 549 | REBC; flavin adenine dinucleotide, monooxygenase, | 96.78 | |
| 2jae_A | 489 | L-amino acid oxidase; oxidoreductase, dimerisation | 96.77 | |
| 3l8k_A | 466 | Dihydrolipoyl dehydrogenase; redox-active center, | 96.77 | |
| 1s3e_A | 520 | Amine oxidase [flavin-containing] B; human monoami | 96.75 | |
| 3ces_A | 651 | MNMG, tRNA uridine 5-carboxymethylaminomethyl modi | 96.75 | |
| 3qfa_A | 519 | Thioredoxin reductase 1, cytoplasmic; protein-prot | 96.74 | |
| 3s5w_A | 463 | L-ornithine 5-monooxygenase; class B flavin depend | 96.74 | |
| 1rsg_A | 516 | FMS1 protein; FAD binding motif, oxidoreductase; H | 96.71 | |
| 4g6h_A | 502 | Rotenone-insensitive NADH-ubiquinone oxidoreducta | 96.7 | |
| 3d1c_A | 369 | Flavin-containing putative monooxygenase; NP_37310 | 96.7 | |
| 3nks_A | 477 | Protoporphyrinogen oxidase; FAD containing protein | 96.68 | |
| 1dxl_A | 470 | Dihydrolipoamide dehydrogenase; oxidoreductase, mu | 96.68 | |
| 2weu_A | 511 | Tryptophan 5-halogenase; regioselectivity, antifun | 96.67 | |
| 3c4a_A | 381 | Probable tryptophan hydroxylase VIOD; alpha-beta p | 96.66 | |
| 2qae_A | 468 | Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin | 96.66 | |
| 1w4x_A | 542 | Phenylacetone monooxygenase; baeyer-villiger, FAD; | 96.65 | |
| 2dkh_A | 639 | 3-hydroxybenzoate hydroxylase; flavoprotein, monoo | 96.65 | |
| 1ges_A | 450 | Glutathione reductase; oxidoreductase(flavoenzyme) | 96.63 | |
| 3cp8_A | 641 | TRNA uridine 5-carboxymethylaminomethyl modificati | 96.63 | |
| 2pyx_A | 526 | Tryptophan halogenase; structural genomics, JOI fo | 96.63 | |
| 2bry_A | 497 | NEDD9 interacting protein with calponin homology a | 96.63 | |
| 1sez_A | 504 | Protoporphyrinogen oxidase, mitochondrial; FAD-bin | 96.62 | |
| 2zxi_A | 637 | TRNA uridine 5-carboxymethylaminomethyl modificat | 96.62 | |
| 2hqm_A | 479 | GR, grase, glutathione reductase; glutathione redu | 96.61 | |
| 2yqu_A | 455 | 2-oxoglutarate dehydrogenase E3 component; lipoami | 96.6 | |
| 4b1b_A | 542 | TRXR, thioredoxin reductase; oxidoreductase, FAD, | 96.59 | |
| 1v59_A | 478 | Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog | 96.58 | |
| 2r9z_A | 463 | Glutathione amide reductase; NAD, FAD, substrate s | 96.56 | |
| 1zmd_A | 474 | Dihydrolipoyl dehydrogenase; lipoamide dehydrogena | 96.55 | |
| 1ojt_A | 482 | Surface protein; redox-active center, glycolysis, | 96.53 | |
| 1onf_A | 500 | GR, grase, glutathione reductase; oxidoreductase; | 96.5 | |
| 2bi7_A | 384 | UDP-galactopyranose mutase; FAD, flavoprotein, iso | 96.49 | |
| 1zk7_A | 467 | HGII, reductase, mercuric reductase; mercuric ION | 96.48 | |
| 1ebd_A | 455 | E3BD, dihydrolipoamide dehydrogenase; redox-active | 96.48 | |
| 1y56_A | 493 | Hypothetical protein PH1363; dehydrogenase, protei | 96.46 | |
| 2gv8_A | 447 | Monooxygenase; FMO, FAD, NADPH, cofactor complex, | 96.45 | |
| 1lvl_A | 458 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 96.41 | |
| 3k30_A | 690 | Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi | 96.4 | |
| 1fec_A | 490 | Trypanothione reductase; redox-active center, oxid | 96.4 | |
| 4dsg_A | 484 | UDP-galactopyranose mutase; rossmann fold, flavin | 96.38 | |
| 4hb9_A | 412 | Similarities with probable monooxygenase; flavin, | 96.37 | |
| 2a8x_A | 464 | Dihydrolipoyl dehydrogenase, E3 component of alpha | 96.36 | |
| 2iid_A | 498 | L-amino-acid oxidase; flavoenzyme, FAD binding dom | 96.31 | |
| 2eq6_A | 464 | Pyruvate dehydrogenase complex, dihydrolipoamide d | 96.3 | |
| 1xdi_A | 499 | RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun | 96.3 | |
| 1vg0_A | 650 | RAB proteins geranylgeranyltransferase component A | 96.22 | |
| 2wpf_A | 495 | Trypanothione reductase; oxidoreductase, trypanoso | 96.21 | |
| 2e1m_A | 376 | L-glutamate oxidase; L-amino acid oxidase, FAD, L- | 96.19 | |
| 4ap3_A | 549 | Steroid monooxygenase; oxidoreductase, baeyer-vill | 96.19 | |
| 3gwf_A | 540 | Cyclohexanone monooxygenase; flavoprotein biocatal | 96.18 | |
| 1b37_A | 472 | Protein (polyamine oxidase); flavin-dependent amin | 96.14 | |
| 2x8g_A | 598 | Thioredoxin glutathione reductase; redox-active ce | 96.11 | |
| 3g5s_A | 443 | Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy | 96.07 | |
| 1pn0_A | 665 | Phenol 2-monooxygenase; two dimers, TLS refinement | 96.03 | |
| 3uox_A | 545 | Otemo; baeyer-villiger monooxygenase, oxidoreducta | 95.98 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 95.83 | |
| 1nhp_A | 447 | NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA | 95.82 | |
| 2vdc_G | 456 | Glutamate synthase [NADPH] small chain; oxidoreduc | 95.71 | |
| 2bc0_A | 490 | NADH oxidase; flavoprotein, pyridine nucleotide di | 95.67 | |
| 2xve_A | 464 | Flavin-containing monooxygenase; oxidoreductase; H | 95.63 | |
| 1ps9_A | 671 | 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel | 95.59 | |
| 1o94_A | 729 | Tmadh, trimethylamine dehydrogenase; electron tran | 95.58 | |
| 1xhc_A | 367 | NADH oxidase /nitrite reductase; southe collaborat | 95.53 | |
| 2z3y_A | 662 | Lysine-specific histone demethylase 1; chromatin, | 95.16 | |
| 3s5w_A | 463 | L-ornithine 5-monooxygenase; class B flavin depend | 95.1 | |
| 1cjc_A | 460 | Protein (adrenodoxin reductase); flavoenzyme, MAD | 94.7 | |
| 1lqt_A | 456 | FPRA; NADP+ derivative, oxidoreductase, structural | 94.53 | |
| 1gte_A | 1025 | Dihydropyrimidine dehydrogenase; electron transfer | 94.05 | |
| 2xag_A | 852 | Lysine-specific histone demethylase 1; amine oxida | 93.94 | |
| 4eqs_A | 437 | Coenzyme A disulfide reductase; oxidoreductase; HE | 93.93 | |
| 3klj_A | 385 | NAD(FAD)-dependent dehydrogenase, NIRB-family (N- | 93.46 | |
| 3ayj_A | 721 | Pro-enzyme of L-phenylalanine oxidase; amino acid | 92.68 | |
| 4gcm_A | 312 | TRXR, thioredoxin reductase; FAD/NAD-linked reduct | 89.05 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 87.87 | |
| 3d1c_A | 369 | Flavin-containing putative monooxygenase; NP_37310 | 87.8 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 86.94 | |
| 4a5l_A | 314 | Thioredoxin reductase; oxidoreductase, redox metab | 86.54 | |
| 1nhp_A | 447 | NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA | 85.22 | |
| 4a9w_A | 357 | Monooxygenase; baeyer-villiger, FAD, oxidoreductas | 84.88 | |
| 3itj_A | 338 | Thioredoxin reductase 1; disulfide B flavoprotein, | 84.72 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 84.54 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 83.28 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 82.99 | |
| 3iwa_A | 472 | FAD-dependent pyridine nucleotide-disulphide oxido | 82.85 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 82.84 | |
| 3uox_A | 545 | Otemo; baeyer-villiger monooxygenase, oxidoreducta | 81.98 | |
| 3gwf_A | 540 | Cyclohexanone monooxygenase; flavoprotein biocatal | 81.03 | |
| 4ap3_A | 549 | Steroid monooxygenase; oxidoreductase, baeyer-vill | 80.83 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 80.21 | |
| 3fbs_A | 297 | Oxidoreductase; structural genomics, PSI2, MCSG, p | 80.2 | |
| 3f8d_A | 323 | Thioredoxin reductase (TRXB-3); redox protein, nuc | 80.16 |
| >3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.8e-118 Score=1067.26 Aligned_cols=524 Identities=27% Similarity=0.343 Sum_probs=443.6
Q ss_pred cccEEEECCCchHHHHHHHHhccCCCeEEEEeccCCC--CCccccCCccccccC-CcccCcccccccccccccCCCceee
Q psy11618 162 CFDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDT--PIHSRIPGMSSVLSL-SEFDHAYLAEPSQFAGLGVRNARIK 238 (1381)
Q Consensus 162 ~YDYIIVGGGTAG~VLAsRLSEdpg~sVLVLEAG~d~--~~~~~iP~~~~~l~~-s~~DW~Y~TePq~~a~~gl~~r~i~ 238 (1381)
+|||||||||+|||++|+||||++++||+|||||++. +...++|..+..... +++||+|+|+||++ .+||++.
T Consensus 2 ~yD~IIVG~G~aG~v~A~rLse~~~~~VlllEaG~~~~~~~~~~~p~~~~~~~~~~~~~w~~~t~pq~~----~~~r~~~ 77 (566)
T 3fim_B 2 DFDYVVVGAGNAGNVVAARLTEDPDVSVLVLEAGVSDENVLGAEAPLLAPGLVPNSIFDWNYTTTAQAG----YNGRSIA 77 (566)
T ss_dssp CEEEEESCCSTTHHHHHHHHTTSTTCCEEEECSSBCCTTCGGGTSGGGSGGGSSSSTTBCCCBCCCCGG----GTTCCCB
T ss_pred CcCEEEECCcHHHHHHHHHHHhCcCCcEEEEecCCcccCCCceeCcchHHHhcCCCccccccccccCCC----CCCceEe
Confidence 6999999999999999999999999999999999975 445678887665554 78999999999984 6899999
Q ss_pred cccccccCccccccceEEecCCccchHHHhhc-CCCCCChhhHHHHHHHhcccccCCc------ccCCCCCCCCCCcccc
Q psy11618 239 ITAGKGLGGSSAVQNILYQRGTSYDYENFAKL-GYNGWGYDETLKYFVKSEDYRSVIY------NESKAVHGTQGYLPVG 311 (1381)
Q Consensus 239 ~pRGKvLGGSSsINgmvy~RGs~~DFD~Wa~l-Gn~GWswedLlPYFkKsE~~~~p~~------~~d~~~HG~~GPL~Vs 311 (1381)
|+|||++||||+||+|+|+||+++|||+|++. |++||+||+++|||+|+|++..+.. ..|+++||.+||++++
T Consensus 78 ~~rGk~lGGsS~iN~m~~~Rg~~~d~d~W~~~~G~~gWs~~~~~pyf~k~E~~~~~~~~~~~~~~~~~~~hG~~Gp~~v~ 157 (566)
T 3fim_B 78 YPRGRMLGGSSSVHYMVMMRGSTEDFDRYAAVTGDEGWNWDNIQQFVRKNEMVVPPADNHNTSGEFIPAVHGTNGSVSIS 157 (566)
T ss_dssp CCCBCBTTGGGGTSCCBCCCCCHHHHHHHHHHHTCTTSSHHHHHHHHHHHEEECCCTTCCCCTTTSCGGGSCBSSSEEEB
T ss_pred ccCCcEEcCcccccceEEecCCHHHHHHHHhcCCCCCcCHHHHHHHHHHHhccCCccccccccccCCccccCCCCCeeee
Confidence 99999999999999999999999999999997 9999999999999999999986532 1245799999999999
Q ss_pred CCCCCCCchHHHHHHHHHHHc--CCCCCCCCCCCCCCcccccCCCCCCCCcccchhhhcchhhhcCCCCeEEEcCcEEEE
Q psy11618 312 LFKNKENNIIREIFETSAQEL--GYPCPKDMNDRYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRTNLYVLKRSKVTK 389 (1381)
Q Consensus 312 ~~p~~e~~pl~~~f~eA~eeL--G~p~~~D~N~g~~~~G~s~~~~ti~~G~RsSAa~AYL~Pa~~~R~NLtILTnA~VtR 389 (1381)
++++. +|..+.+.+|++++ |++.++|.|+++ +.|+++.+.++++|+|+|++++|++|+. +|+|++|+|+|+|+|
T Consensus 158 ~~~~~--~~~~~~~~~a~~~~~~G~~~~~d~n~~~-~~G~~~~~~~~~~g~R~sa~~ayL~p~~-~r~NL~Vlt~a~V~r 233 (566)
T 3fim_B 158 LPGFP--TPLDDRVLATTQEQSEEFFFNPDMGTGH-PLGISWSIASVGNGQRSSSSTAYLRPAQ-SRPNLSVLINAQVTK 233 (566)
T ss_dssp SCSSC--CTHHHHHHHHHHHTHHHHCBCSCGGGSC-CCEEEECCBSEETTEECCHHHHTHHHHT-TCTTEEEESSCEEEE
T ss_pred cCCCC--CHHHHHHHHHHHHHhcCCCccCCCCCCC-cceEEeeeeecCCCEEcCHHHHHhhhhc-cCCCeEEECCCEEEE
Confidence 98876 89999999999999 999988999888 8899999999999999999999999988 899999999999999
Q ss_pred EEec---CC-CeEEEEEEEecCC-eEEEEecCcEEEEcCCchhhHHHHHHcCCCCCCccccCCCCcccCCc-cchhcccc
Q psy11618 390 VIIN---DQ-NVATGVEYVNSKG-ETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQDLR-VGENLKLN 463 (1381)
Q Consensus 390 Ilfd---~g-~RAtGVE~vd~~G-r~~tV~ArKEVILSAGAI~SPqLLmlSGIGPkd~Le~lGIpVVvDLP-VGrNLQDH 463 (1381)
|++| ++ +||+|||+.+.+| ++++++|+|||||||||++||||||+|||||++||+++||||++|+| ||||||||
T Consensus 234 Il~~~~~~g~~rA~GVe~~~~~g~~~~~v~A~kEVILsAGai~SPqlL~lSGIGp~~~L~~~gI~vv~dlPgVG~NLqDH 313 (566)
T 3fim_B 234 LVNSGTTNGLPAFRCVEYAEQEGAPTTTVCAKKEVVLSAGSVGTPILLQLSGIGDENDLSSVGIDTIVNNPSVGRNLSDH 313 (566)
T ss_dssp EECCEEETTEEECCEEEEESSTTSCCEEEEEEEEEEECCHHHHHHHHHHHTTEECHHHHHHTTCCCSEECTTTTCSBBCC
T ss_pred EEeecCCCCCCEEEEEEEEECCCceEEEEEeeeEEEEecCCcCChHHHHhcCCCChHHHhhcCCCceecCcchhhhhhcC
Confidence 9998 34 7999999998546 88999999999999999999999999999999999999999999999 99999999
Q ss_pred ccCCceEEEecCCccccchhhHHHHHHhhccCCCCCCccccccccccccccccccccccccccccccccccCCCcccccc
Q psy11618 464 AQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPLSNMHSYCYCLAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSA 543 (1381)
Q Consensus 464 p~v~~vvf~l~~~vs~sl~~a~a~~~Y~~nrtGPls~~~s~~~~~~~LDe~~~~~~~~l~vg~~~~~~~~~a~~~~a~~~ 543 (1381)
+.+. +.++.+++.+.+.. . . +
T Consensus 314 ~~~~-~~~~~~~~~~~~~~-------------------------------~---------------~-~----------- 334 (566)
T 3fim_B 314 LLLP-AAFFVNSNQTFDNI-------------------------------F---------------R-D----------- 334 (566)
T ss_dssp EEEC-CEEEESCSCSSGGG-------------------------------G---------------T-C-----------
T ss_pred ccce-EEEEeCCCcccchh-------------------------------h---------------c-C-----------
Confidence 9984 77877654320000 0 0 0
Q ss_pred cchhhhhhHHHHHHHHHcCCCCCccccccceEEEeecCC-------------CCCCCCeeeeeeccccccchhhhhhhhc
Q psy11618 544 PLKRTVYSQEMVFKYLVNRIGPLSNAGLWSFTGYIDTLQ-------------NTARPDLEIHLLYFQQNDIRNMCKIKRA 610 (1381)
Q Consensus 544 pl~~tv~s~~~~~eYl~~~sGPLss~g~~e~~gFl~S~~-------------~~~~PDIq~~~~p~s~~~~d~~~~vk~~ 610 (1381)
.....+...+|..+++||+++.+ .+..+|.+++. ....||+|+++.+... .+
T Consensus 335 ----~~~~~~~~~~~~~~~~G~l~~~~-~~~~~f~~~~~~~~~~~~~~~~~~~~~~pd~~~~~~~~~~--~~-------- 399 (566)
T 3fim_B 335 ----SSEFNVDLDQWTNTRTGPLTALI-ANHLAWLRLPSNSSIFQTFPDPAAGPNSAHWETIFSNQWF--HP-------- 399 (566)
T ss_dssp ----HHHHHHHHHHHHHHSCSGGGCCS-CSEEEEECCCTTCGGGGTSCCCSSSTTSCSEEEEEESSCC--CT--------
T ss_pred ----hHHHHHHHHHHHhcCCCCcccCh-hhheeeeccccchhhhhhhccccccCCCCCEEEEecccch--hh--------
Confidence 00002334556666666666543 34455555431 2256888765533211 00
Q ss_pred cccchhHHHHHhccCCCCCeEEEEEeecccCcCcEEEeecCCCCCCccccCCCCCChhhHHHHHHHHHHHHHHhcCHHHH
Q psy11618 611 YDFNDEVQTAYVNLNKRTDMGVISMSLVNPKSCGKVTLKSADPLAPPCIDTGILSEPEDLATLIRGTDYITRLEQTEAIR 690 (1381)
Q Consensus 611 ~g~~~~~~~~~~~p~~~~~~~tI~v~Ll~P~SRGsV~L~SsDP~d~PvIDpNYLSdP~Dle~LveGVR~arrIl~Tp~Lk 690 (1381)
...+..+.+++++.+++++|+|||+|||+|+||.++|.||+||++||.|++.+++|+|.+||++++++++
T Consensus 400 ----------~~~~~~~~~~~~~~~~l~~P~SrG~V~L~s~dp~~~P~i~~~yl~~~~D~~~~~~~~~~~~~i~~~~~~~ 469 (566)
T 3fim_B 400 ----------AIPRPDTGSFMSVTNALISPVARGDIKLATSNPFDKPLINPQYLSTEFDIFTMIQAVKSNLRFLSGQAWA 469 (566)
T ss_dssp ----------TSCCCSSCCEEEEEEEESSCSCCBEEECSSSCTTSCCEEECCTTCSHHHHHHHHHHHHHHHHHHTSGGGT
T ss_pred ----------cccCCCCCCEEEEEEeecCCccceEEEecCCCCCCCceeccccCCCccHHHHHHHHHHHHHHHHhCcccC
Confidence 0011123457889999999999999999999999999999999999999999999999999999999999
Q ss_pred HhcccccccCCccCCCCCCCCchhHHHHHhcccCCCcccccCccccCCCCCCcccCCCCeEeCcCCcEEecccCCCCCCC
Q psy11618 691 LAGGTLMSLNLEACSQYPWRSTHSWTCYIRHLTTTTSNPVGTVMMGNADDPNAVVTPDLKVKGIKGLRVADISVLPNAII 770 (1381)
Q Consensus 691 ~~g~~e~~~plPg~~~~~~~SDEeIe~yIR~~a~T~yHPvGTCRMGP~dDp~GVVDs~LRVhGVdNLRVVDASVfPtiPS 770 (1381)
++..++.. |++ .+.+|||||++|+|++..|.|||+||||||+++|++||||+++|||||+|||||||||||++|+
T Consensus 470 ~~~~~~~~---P~~--~~~~sd~~~~~~ir~~~~t~~H~~GTc~Mg~~~~~~~VVD~~lrV~Gv~~LrVvDaSv~P~~~~ 544 (566)
T 3fim_B 470 DFVIRPFD---PRL--RDPTDDAAIESYIRDNANTIFHPVGTASMSPRGASWGVVDPDLKVKGVDGLRIVDGSILPFAPN 544 (566)
T ss_dssp TTEEEESS---GGG--SCTTCHHHHHHHHHHHCEECSCCBCTTCBCCTTCSSCSBCTTCBBTTCBSEEECSGGGCCSCCS
T ss_pred CccccccC---CCc--ccccchHHHHHHHhhcccccccccCccccCCcccCCccCCCCCeEccCCCcEEcccccCCCCCC
Confidence 88766542 332 2457999999999999999999999999999877669999999999999999999999999999
Q ss_pred CCchHHHHHHHH
Q psy11618 771 TQSDAISFLLLF 782 (1381)
Q Consensus 771 gNpqApVyMIA~ 782 (1381)
+|||+|+||||-
T Consensus 545 ~n~~~~~~~iae 556 (566)
T 3fim_B 545 AHTQGPIYLVGK 556 (566)
T ss_dssp SCTHHHHHHHHH
T ss_pred cCcHHHHHHHHH
Confidence 999999999985
|
| >3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* | Back alignment and structure |
|---|
| >3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} | Back alignment and structure |
|---|
| >3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 | Back alignment and structure |
|---|
| >2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* | Back alignment and structure |
|---|
| >1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* | Back alignment and structure |
|---|
| >1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* | Back alignment and structure |
|---|
| >1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* | Back alignment and structure |
|---|
| >1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* | Back alignment and structure |
|---|
| >3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... | Back alignment and structure |
|---|
| >4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* | Back alignment and structure |
|---|
| >3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} | Back alignment and structure |
|---|
| >1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 | Back alignment and structure |
|---|
| >2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* | Back alignment and structure |
|---|
| >1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* | Back alignment and structure |
|---|
| >2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* | Back alignment and structure |
|---|
| >3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... | Back alignment and structure |
|---|
| >1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* | Back alignment and structure |
|---|
| >1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* | Back alignment and structure |
|---|
| >2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* | Back alignment and structure |
|---|
| >3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* | Back alignment and structure |
|---|
| >1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* | Back alignment and structure |
|---|
| >2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* | Back alignment and structure |
|---|
| >3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* | Back alignment and structure |
|---|
| >2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* | Back alignment and structure |
|---|
| >3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} | Back alignment and structure |
|---|
| >1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* | Back alignment and structure |
|---|
| >3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* | Back alignment and structure |
|---|
| >2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* | Back alignment and structure |
|---|
| >1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* | Back alignment and structure |
|---|
| >3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* | Back alignment and structure |
|---|
| >3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* | Back alignment and structure |
|---|
| >1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* | Back alignment and structure |
|---|
| >2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} | Back alignment and structure |
|---|
| >3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* | Back alignment and structure |
|---|
| >3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 | Back alignment and structure |
|---|
| >1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 | Back alignment and structure |
|---|
| >3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* | Back alignment and structure |
|---|
| >3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* | Back alignment and structure |
|---|
| >3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} | Back alignment and structure |
|---|
| >4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} | Back alignment and structure |
|---|
| >3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* | Back alignment and structure |
|---|
| >3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} | Back alignment and structure |
|---|
| >3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* | Back alignment and structure |
|---|
| >1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 | Back alignment and structure |
|---|
| >3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* | Back alignment and structure |
|---|
| >3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* | Back alignment and structure |
|---|
| >1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* | Back alignment and structure |
|---|
| >3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* | Back alignment and structure |
|---|
| >3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* | Back alignment and structure |
|---|
| >3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* | Back alignment and structure |
|---|
| >1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A | Back alignment and structure |
|---|
| >2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* | Back alignment and structure |
|---|
| >2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 | Back alignment and structure |
|---|
| >2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* | Back alignment and structure |
|---|
| >3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* | Back alignment and structure |
|---|
| >3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* | Back alignment and structure |
|---|
| >1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* | Back alignment and structure |
|---|
| >2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* | Back alignment and structure |
|---|
| >3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} | Back alignment and structure |
|---|
| >4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} | Back alignment and structure |
|---|
| >3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* | Back alignment and structure |
|---|
| >3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} | Back alignment and structure |
|---|
| >3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* | Back alignment and structure |
|---|
| >3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* | Back alignment and structure |
|---|
| >4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* | Back alignment and structure |
|---|
| >4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* | Back alignment and structure |
|---|
| >2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* | Back alignment and structure |
|---|
| >3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* | Back alignment and structure |
|---|
| >2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* | Back alignment and structure |
|---|
| >4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* | Back alignment and structure |
|---|
| >3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* | Back alignment and structure |
|---|
| >3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* | Back alignment and structure |
|---|
| >4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* | Back alignment and structure |
|---|
| >4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* | Back alignment and structure |
|---|
| >2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* | Back alignment and structure |
|---|
| >1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* | Back alignment and structure |
|---|
| >3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... | Back alignment and structure |
|---|
| >2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 | Back alignment and structure |
|---|
| >3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} | Back alignment and structure |
|---|
| >2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* | Back alignment and structure |
|---|
| >3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* | Back alignment and structure |
|---|
| >3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 | Back alignment and structure |
|---|
| >3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* | Back alignment and structure |
|---|
| >3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* | Back alignment and structure |
|---|
| >2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} | Back alignment and structure |
|---|
| >4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} | Back alignment and structure |
|---|
| >1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... | Back alignment and structure |
|---|
| >3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* | Back alignment and structure |
|---|
| >2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A | Back alignment and structure |
|---|
| >3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* | Back alignment and structure |
|---|
| >2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 | Back alignment and structure |
|---|
| >3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* | Back alignment and structure |
|---|
| >2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* | Back alignment and structure |
|---|
| >2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* | Back alignment and structure |
|---|
| >3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* | Back alignment and structure |
|---|
| >3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* | Back alignment and structure |
|---|
| >2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* | Back alignment and structure |
|---|
| >3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* | Back alignment and structure |
|---|
| >3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* | Back alignment and structure |
|---|
| >2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* | Back alignment and structure |
|---|
| >3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... | Back alignment and structure |
|---|
| >3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A | Back alignment and structure |
|---|
| >3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* | Back alignment and structure |
|---|
| >3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* | Back alignment and structure |
|---|
| >1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* | Back alignment and structure |
|---|
| >4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* | Back alignment and structure |
|---|
| >3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* | Back alignment and structure |
|---|
| >3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} | Back alignment and structure |
|---|
| >2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* | Back alignment and structure |
|---|
| >2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* | Back alignment and structure |
|---|
| >1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* | Back alignment and structure |
|---|
| >3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} | Back alignment and structure |
|---|
| >2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* | Back alignment and structure |
|---|
| >1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 | Back alignment and structure |
|---|
| >2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* | Back alignment and structure |
|---|
| >2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* | Back alignment and structure |
|---|
| >4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* | Back alignment and structure |
|---|
| >2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* | Back alignment and structure |
|---|
| >1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* | Back alignment and structure |
|---|
| >1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* | Back alignment and structure |
|---|
| >1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* | Back alignment and structure |
|---|
| >1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* | Back alignment and structure |
|---|
| >1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* | Back alignment and structure |
|---|
| >1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} | Back alignment and structure |
|---|
| >1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* | Back alignment and structure |
|---|
| >4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* | Back alignment and structure |
|---|
| >4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} | Back alignment and structure |
|---|
| >2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* | Back alignment and structure |
|---|
| >2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* | Back alignment and structure |
|---|
| >2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* | Back alignment and structure |
|---|
| >1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* | Back alignment and structure |
|---|
| >2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* | Back alignment and structure |
|---|
| >2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} | Back alignment and structure |
|---|
| >4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* | Back alignment and structure |
|---|
| >3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* | Back alignment and structure |
|---|
| >1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* | Back alignment and structure |
|---|
| >2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* | Back alignment and structure |
|---|
| >3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* | Back alignment and structure |
|---|
| >1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* | Back alignment and structure |
|---|
| >3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* | Back alignment and structure |
|---|
| >1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* | Back alignment and structure |
|---|
| >2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} | Back alignment and structure |
|---|
| >2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* | Back alignment and structure |
|---|
| >2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* | Back alignment and structure |
|---|
| >1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 | Back alignment and structure |
|---|
| >1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* | Back alignment and structure |
|---|
| >1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A | Back alignment and structure |
|---|
| >3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* | Back alignment and structure |
|---|
| >1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* | Back alignment and structure |
|---|
| >1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* | Back alignment and structure |
|---|
| >1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* | Back alignment and structure |
|---|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A | Back alignment and structure |
|---|
| >4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* | Back alignment and structure |
|---|
| >3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* | Back alignment and structure |
|---|
| >4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* | Back alignment and structure |
|---|
| >3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* | Back alignment and structure |
|---|
| >4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* | Back alignment and structure |
|---|
| >1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* | Back alignment and structure |
|---|
| >4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* | Back alignment and structure |
|---|
| >3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* | Back alignment and structure |
|---|
| >4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 1381 | ||||
| d1cf3a1 | 385 | c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Asper | 2e-59 | |
| d1cf3a1 | 385 | c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Asper | 1e-06 | |
| d1gpea1 | 391 | c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penic | 1e-58 | |
| d1gpea1 | 391 | c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penic | 3e-04 | |
| d2f5va1 | 379 | c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W | 1e-43 | |
| d2f5va1 | 379 | c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W | 3e-08 | |
| d1kdga1 | 360 | c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain | 4e-42 | |
| d1kdga1 | 360 | c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain | 5e-06 | |
| d1ju2a1 | 351 | c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase { | 5e-40 | |
| d3coxa1 | 370 | c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of | 4e-37 | |
| d1n4wa1 | 367 | c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of | 2e-36 | |
| d1cf3a2 | 196 | d.16.1.1 (A:325-520) Glucose oxidase {Aspergillus | 5e-12 | |
| d1gpea2 | 196 | d.16.1.1 (A:329-524) Glucose oxidase {Penicillium | 7e-12 | |
| d1ju2a2 | 170 | d.16.1.1 (A:294-463) Hydroxynitrile lyase {Almond | 2e-09 | |
| d1kdga2 | 181 | d.16.1.1 (A:513-693) Flavoprotein domain of flavoc | 3e-09 | |
| d2bcgg1 | 297 | c.3.1.3 (G:5-301) Guanine nucleotide dissociation | 3e-08 | |
| d2i0za1 | 251 | c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B | 8e-07 | |
| d1d5ta1 | 336 | c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di | 1e-06 | |
| d1rp0a1 | 278 | c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi | 3e-06 | |
| d1y0pa2 | 308 | c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( | 6e-06 | |
| d1qo8a2 | 317 | c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( | 6e-06 | |
| d3lada1 | 229 | c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd | 6e-06 | |
| d1ojta1 | 229 | c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh | 1e-05 | |
| d1onfa1 | 259 | c.3.1.5 (A:1-153,A:271-376) Glutathione reductase | 1e-05 | |
| d1chua2 | 305 | c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E | 1e-05 | |
| d1d4ca2 | 322 | c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( | 2e-05 | |
| d1dxla1 | 221 | c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd | 2e-05 | |
| d1neka2 | 330 | c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase | 4e-05 | |
| d1v59a1 | 233 | c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd | 5e-05 | |
| d1h6va1 | 235 | c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin | 5e-05 | |
| d3c96a1 | 288 | c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps | 5e-05 | |
| d2gqfa1 | 253 | c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H | 6e-05 | |
| d2gf3a1 | 281 | c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac | 8e-05 | |
| d1ryia1 | 276 | c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { | 8e-05 | |
| d1jnra2 | 356 | c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reduct | 8e-05 | |
| d3grsa1 | 221 | c.3.1.5 (A:18-165,A:291-363) Glutathione reductase | 9e-05 | |
| d1gesa1 | 217 | c.3.1.5 (A:3-146,A:263-335) Glutathione reductase | 1e-04 | |
| d2bs2a2 | 336 | c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo | 1e-04 | |
| d1lvla1 | 220 | c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd | 1e-04 | |
| d1kf6a2 | 311 | c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es | 2e-04 | |
| d1pj5a2 | 305 | c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine ox | 2e-04 | |
| d1mo9a1 | 261 | c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop | 3e-04 | |
| d2gjca1 | 311 | c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th | 3e-04 | |
| d2ivda1 | 347 | c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox | 3e-04 | |
| d2gmha1 | 380 | c.3.1.2 (A:4-236,A:336-482) Electron transfer flav | 8e-04 | |
| d1i8ta1 | 298 | c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu | 8e-04 | |
| d1ebda1 | 223 | c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd | 9e-04 | |
| d1kqfc_ | 216 | f.21.1.1 (C:) Formate dehydrogenase N, cytochrome | 0.001 | |
| d1kqfc_ | 216 | f.21.1.1 (C:) Formate dehydrogenase N, cytochrome | 0.001 | |
| d1kqfc_ | 216 | f.21.1.1 (C:) Formate dehydrogenase N, cytochrome | 0.001 | |
| d1kqfc_ | 216 | f.21.1.1 (C:) Formate dehydrogenase N, cytochrome | 0.001 | |
| d1kqfc_ | 216 | f.21.1.1 (C:) Formate dehydrogenase N, cytochrome | 0.001 | |
| d1kqfc_ | 216 | f.21.1.1 (C:) Formate dehydrogenase N, cytochrome | 0.001 | |
| d1kqfc_ | 216 | f.21.1.1 (C:) Formate dehydrogenase N, cytochrome | 0.001 | |
| d1kqfc_ | 216 | f.21.1.1 (C:) Formate dehydrogenase N, cytochrome | 0.001 | |
| d1kqfc_ | 216 | f.21.1.1 (C:) Formate dehydrogenase N, cytochrome | 0.001 | |
| d1kqfc_ | 216 | f.21.1.1 (C:) Formate dehydrogenase N, cytochrome | 0.001 | |
| d1kqfc_ | 216 | f.21.1.1 (C:) Formate dehydrogenase N, cytochrome | 0.001 | |
| d1kqfc_ | 216 | f.21.1.1 (C:) Formate dehydrogenase N, cytochrome | 0.001 | |
| d1kqfc_ | 216 | f.21.1.1 (C:) Formate dehydrogenase N, cytochrome | 0.001 | |
| d1pn0a1 | 360 | c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So | 0.001 | |
| d1nhpa1 | 198 | c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enter | 0.002 | |
| d1aoga1 | 238 | c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas | 0.003 | |
| d1b5qa1 | 347 | c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai | 0.003 | |
| d1fcda1 | 186 | c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulf | 0.004 | |
| d1feca1 | 240 | c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas | 0.004 | |
| d1xdia1 | 233 | c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehyd | 0.004 | |
| d1w4xa1 | 298 | c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy | 0.004 |
| >d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 385 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: FAD/NAD(P)-binding domain superfamily: FAD/NAD(P)-binding domain family: FAD-linked reductases, N-terminal domain domain: Glucose oxidase species: Aspergillus niger [TaxId: 5061]
Score = 207 bits (527), Expect = 2e-59
Identities = 95/373 (25%), Positives = 146/373 (39%), Gaps = 30/373 (8%)
Query: 155 PYVKSGDCFDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTPIHS---RIPGMSSVL 211
P SG D II G G A RL+E ++ VL+IE+G +
Sbjct: 10 PKDVSGRTVDYIIAGGGLTGLTTAARLTENPNISVLVIESGSYESDRGPIIEDLNAYGDI 69
Query: 212 SLSEFDHAYLAEPSQFAGLGVRNARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAKL- 270
S DHAY L N I +G GLGGS+ V + R +++ +
Sbjct: 70 FGSSVDHAYETVE-----LATNNQTALIRSGNGLGGSTLVNGGTWTRPHKAQVDSWETVF 124
Query: 271 GYNGWGYDETLKYFVKSEDYRSVIYNESKAVHGTQGYLPVG--------LFKNKENNIIR 322
G GW +D Y +++E R+ + A H + + I
Sbjct: 125 GNEGWNWDNVAAYSLQAERARAPNAKQIAAGHYFNASCHGVNGTVHAGPRDTGDDYSPIV 184
Query: 323 EIFETSAQELGYPCPKDMNDRYVDVGFAELPGMTRYGLRFSAADAYLTPIAGKRTNLYVL 382
+ ++ ++ G P KD + +R AA +L P +R NL VL
Sbjct: 185 KALMSAVEDRGVPTKKDFGCGDPHGVSMFPNTLHEDQVRSDAAREWLLPNY-QRPNLQVL 243
Query: 383 KRSKVTKVIINDQN---VATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGP 439
V KV+++ A GVE+ KG T V A EV+L AG+ + +L SGIG
Sbjct: 244 TGQYVGKVLLSQNGTTPRAVGVEFGTHKGNTHNVYAKHEVLLAAGSAVSPTILEYSGIGM 303
Query: 440 KAHLDEVKIPVKQDLRVGENLKLNAQFTGPVMAFSAPLKRTVYSQEMVFKYLVNRIGPL- 498
K+ L+ + I DL VG + + G V VY + + + + I P
Sbjct: 304 KSILEPLGIDTVVDLPVGLCSMMPKEMGGVVDNA-----ARVYGVQGL-RVIDGSIPPTQ 357
Query: 499 --SNMHSYCYCLA 509
S++ + Y +A
Sbjct: 358 MSSHVMTVFYAMA 370
|
| >d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 385 | Back information, alignment and structure |
|---|
| >d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 391 | Back information, alignment and structure |
|---|
| >d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 391 | Back information, alignment and structure |
|---|
| >d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 | Back information, alignment and structure |
|---|
| >d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 | Back information, alignment and structure |
|---|
| >d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360 | Back information, alignment and structure |
|---|
| >d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360 | Back information, alignment and structure |
|---|
| >d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Length = 351 | Back information, alignment and structure |
|---|
| >d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370 | Back information, alignment and structure |
|---|
| >d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Length = 367 | Back information, alignment and structure |
|---|
| >d1cf3a2 d.16.1.1 (A:325-520) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 196 | Back information, alignment and structure |
|---|
| >d1gpea2 d.16.1.1 (A:329-524) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 196 | Back information, alignment and structure |
|---|
| >d1ju2a2 d.16.1.1 (A:294-463) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Length = 170 | Back information, alignment and structure |
|---|
| >d1kdga2 d.16.1.1 (A:513-693) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), substrate-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 181 | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 | Back information, alignment and structure |
|---|
| >d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 | Back information, alignment and structure |
|---|
| >d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 | Back information, alignment and structure |
|---|
| >d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 | Back information, alignment and structure |
|---|
| >d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 | Back information, alignment and structure |
|---|
| >d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 | Back information, alignment and structure |
|---|
| >d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 | Back information, alignment and structure |
|---|
| >d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 | Back information, alignment and structure |
|---|
| >d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 | Back information, alignment and structure |
|---|
| >d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 | Back information, alignment and structure |
|---|
| >d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 | Back information, alignment and structure |
|---|
| >d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 | Back information, alignment and structure |
|---|
| >d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 | Back information, alignment and structure |
|---|
| >d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 | Back information, alignment and structure |
|---|
| >d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 | Back information, alignment and structure |
|---|
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 | Back information, alignment and structure |
|---|
| >d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 356 | Back information, alignment and structure |
|---|
| >d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 | Back information, alignment and structure |
|---|
| >d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 | Back information, alignment and structure |
|---|
| >d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 | Back information, alignment and structure |
|---|
| >d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311 | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Length = 305 | Back information, alignment and structure |
|---|
| >d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 | Back information, alignment and structure |
|---|
| >d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 | Back information, alignment and structure |
|---|
| >d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 | Back information, alignment and structure |
|---|
| >d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 | Back information, alignment and structure |
|---|
| >d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 | Back information, alignment and structure |
|---|
| >d1kqfc_ f.21.1.1 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli [TaxId: 562]} Length = 216 | Back information, alignment and structure |
|---|
| >d1kqfc_ f.21.1.1 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli [TaxId: 562]} Length = 216 | Back information, alignment and structure |
|---|
| >d1kqfc_ f.21.1.1 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli [TaxId: 562]} Length = 216 | Back information, alignment and structure |
|---|
| >d1kqfc_ f.21.1.1 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli [TaxId: 562]} Length = 216 | Back information, alignment and structure |
|---|
| >d1kqfc_ f.21.1.1 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli [TaxId: 562]} Length = 216 | Back information, alignment and structure |
|---|
| >d1kqfc_ f.21.1.1 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli [TaxId: 562]} Length = 216 | Back information, alignment and structure |
|---|
| >d1kqfc_ f.21.1.1 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli [TaxId: 562]} Length = 216 | Back information, alignment and structure |
|---|
| >d1kqfc_ f.21.1.1 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli [TaxId: 562]} Length = 216 | Back information, alignment and structure |
|---|
| >d1kqfc_ f.21.1.1 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli [TaxId: 562]} Length = 216 | Back information, alignment and structure |
|---|
| >d1kqfc_ f.21.1.1 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli [TaxId: 562]} Length = 216 | Back information, alignment and structure |
|---|
| >d1kqfc_ f.21.1.1 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli [TaxId: 562]} Length = 216 | Back information, alignment and structure |
|---|
| >d1kqfc_ f.21.1.1 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli [TaxId: 562]} Length = 216 | Back information, alignment and structure |
|---|
| >d1kqfc_ f.21.1.1 (C:) Formate dehydrogenase N, cytochrome (gamma) subunit {Escherichia coli [TaxId: 562]} Length = 216 | Back information, alignment and structure |
|---|
| >d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 | Back information, alignment and structure |
|---|
| >d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 198 | Back information, alignment and structure |
|---|
| >d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Length = 186 | Back information, alignment and structure |
|---|
| >d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 | Back information, alignment and structure |
|---|
| >d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 233 | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1381 | |||
| d1gpea1 | 391 | Glucose oxidase {Penicillium amagasakiense [TaxId: | 100.0 | |
| d1cf3a1 | 385 | Glucose oxidase {Aspergillus niger [TaxId: 5061]} | 100.0 | |
| d1kdga1 | 360 | Flavoprotein domain of flavocytochrome cellobiose | 100.0 | |
| d1ju2a1 | 351 | Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI | 100.0 | |
| d2f5va1 | 379 | Pyranose 2-oxidase {White-rot fungus (Peniophora s | 100.0 | |
| d3coxa1 | 370 | Cholesterol oxidase of GMC family {Brevibacterium | 100.0 | |
| d1n4wa1 | 367 | Cholesterol oxidase of GMC family {Streptomyces sp | 100.0 | |
| d1gpea2 | 196 | Glucose oxidase {Penicillium amagasakiense [TaxId: | 99.91 | |
| d1cf3a2 | 196 | Glucose oxidase {Aspergillus niger [TaxId: 5061]} | 99.9 | |
| d1kdga2 | 181 | Flavoprotein domain of flavocytochrome cellobiose | 99.89 | |
| d1ju2a2 | 170 | Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI | 99.83 | |
| d1y0pa2 | 308 | Flavocytochrome c3 (respiratory fumarate reductase | 99.55 | |
| d1d5ta1 | 336 | Guanine nucleotide dissociation inhibitor, GDI {Co | 99.53 | |
| d1d4ca2 | 322 | Flavocytochrome c3 (respiratory fumarate reductase | 99.46 | |
| d2bcgg1 | 297 | Guanine nucleotide dissociation inhibitor, GDI {Ba | 99.42 | |
| d1qo8a2 | 317 | Flavocytochrome c3 (respiratory fumarate reductase | 99.37 | |
| d2gf3a1 | 281 | Sarcosine oxidase {Bacillus sp., strain b0618 [Tax | 99.35 | |
| d1kf6a2 | 311 | Fumarate reductase {Escherichia coli [TaxId: 562]} | 99.31 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 99.23 | |
| d2ivda1 | 347 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 99.17 | |
| d2bs2a2 | 336 | Fumarate reductase {Wolinella succinogenes [TaxId: | 99.17 | |
| d1ryia1 | 276 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 99.14 | |
| d1jnra2 | 356 | Adenylylsulfate reductase A subunit {Archaeon Arch | 99.14 | |
| d2i0za1 | 251 | Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] | 99.09 | |
| d1chua2 | 305 | L-aspartate oxidase {Escherichia coli [TaxId: 562] | 99.06 | |
| d1neka2 | 330 | Succinate dehydogenase {Escherichia coli [TaxId: 5 | 98.97 | |
| d2gqfa1 | 253 | Hypothetical protein HI0933 {Haemophilus influenza | 98.91 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 98.5 | |
| d2v5za1 | 383 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 98.4 | |
| d2gmha1 | 380 | Electron transfer flavoprotein-ubiquinone oxidored | 98.25 | |
| d2cula1 | 230 | GidA-related protein TTHA1897 {Thermus thermophilu | 98.09 | |
| d3lada1 | 229 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 97.98 | |
| d1i8ta1 | 298 | UDP-galactopyranose mutase, N-terminal domain {Esc | 97.89 | |
| d1gesa1 | 217 | Glutathione reductase {Escherichia coli [TaxId: 56 | 97.88 | |
| d1v59a1 | 233 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 97.85 | |
| d1rp0a1 | 278 | Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara | 97.83 | |
| d1dxla1 | 221 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 97.83 | |
| d2gv8a1 | 335 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 97.81 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 97.79 | |
| d2dw4a2 | 449 | Lysine-specific histone demethylase 1, LSD1 {Human | 97.78 | |
| d1h6va1 | 235 | Mammalian thioredoxin reductase {Rat (Rattus norve | 97.76 | |
| d1ojta1 | 229 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 97.73 | |
| d3grsa1 | 221 | Glutathione reductase {Human (Homo sapiens) [TaxId | 97.7 | |
| d1ebda1 | 223 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 97.65 | |
| d1aoga1 | 238 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 97.57 | |
| d1pn0a1 | 360 | Phenol hydroxylase {Soil-living yeast (Trichosporo | 97.56 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 97.53 | |
| d1onfa1 | 259 | Glutathione reductase {Plasmodium falciparum [TaxI | 97.49 | |
| d1lvla1 | 220 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 97.47 | |
| d1fl2a1 | 184 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 97.44 | |
| d1c0pa1 | 268 | D-aminoacid oxidase, N-terminal domain {Rhodotorul | 97.39 | |
| d1mo9a1 | 261 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 97.35 | |
| d1feca1 | 240 | Trypanothione reductase {Crithidia fasciculata [Ta | 97.34 | |
| d3c96a1 | 288 | Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: | 97.27 | |
| d1w4xa1 | 298 | Phenylacetone monooxygenase {Thermobifida fusca [T | 97.14 | |
| d1k0ia1 | 292 | p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a | 97.11 | |
| d2gjca1 | 311 | Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( | 97.08 | |
| d2bi7a1 | 314 | UDP-galactopyranose mutase, N-terminal domain {Kle | 97.03 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 96.86 | |
| d1trba1 | 190 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 96.8 | |
| d1vdca1 | 192 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 96.78 | |
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 96.51 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 96.5 | |
| d1fcda1 | 186 | Flavocytochrome c sulfide dehydrogenase, FCSD, fla | 96.46 | |
| d1gtea4 | 196 | Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su | 96.13 | |
| d1cjca2 | 230 | Adrenodoxin reductase of mitochondrial p450 system | 96.13 | |
| d1lqta2 | 239 | Ferredoxin:NADP reductase FprA {Mycobacterium tube | 95.51 | |
| d1xdia1 | 233 | Dihydrolipoamide dehydrogenase {Mycobacterium tube | 95.2 | |
| d1m6ia1 | 213 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 95.2 | |
| d1q1ra1 | 185 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 94.76 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 94.52 | |
| d1kifa1 | 246 | D-aminoacid oxidase, N-terminal domain {Pig (Sus s | 94.41 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 94.24 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 94.12 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 93.87 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 93.36 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 93.22 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 93.15 | |
| d1nhpa1 | 198 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 92.63 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 92.5 | |
| d1d7ya1 | 183 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 92.19 | |
| d1xhca1 | 167 | NADH oxidase /nitrite reductase {Pyrococcus furios | 91.49 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 91.17 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 91.12 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 91.03 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 90.95 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 90.68 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 90.33 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 90.15 | |
| d1fl2a2 | 126 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 90.06 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 90.02 | |
| d1aoga2 | 117 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 89.84 | |
| d1vg0a1 | 491 | Rab escort protein 1 {Rat (Rattus norvegicus) [Tax | 89.41 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 89.22 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 88.84 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 88.17 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 87.69 | |
| d1m6ia2 | 137 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 87.64 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 87.03 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 85.87 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 85.57 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 84.91 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 80.44 |
| >d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: FAD/NAD(P)-binding domain superfamily: FAD/NAD(P)-binding domain family: FAD-linked reductases, N-terminal domain domain: Glucose oxidase species: Penicillium amagasakiense [TaxId: 63559]
Probab=100.00 E-value=4.3e-75 Score=658.07 Aligned_cols=300 Identities=29% Similarity=0.413 Sum_probs=262.2
Q ss_pred CCCCcccEEEECCCchHHHHHHHHhccCCCeEEEEeccCCCCC---ccccCCccccccCCcccCcccccccccccccCCC
Q psy11618 158 KSGDCFDIIIVGASAAGCVLANRLSEVSSLKVLLIEAGGDTPI---HSRIPGMSSVLSLSEFDHAYLAEPSQFAGLGVRN 234 (1381)
Q Consensus 158 ~~~~~YDYIIVGGGTAG~VLAsRLSEdpg~sVLVLEAG~d~~~---~~~iP~~~~~l~~s~~DW~Y~TePq~~a~~gl~~ 234 (1381)
..+++|||||||||+|||++|+||||++++||+|||||++... ..++|..+....++++||+|+|+||. +|
T Consensus 20 ~~~~tyD~IIVGsG~aG~vlA~rLae~~~~~VLlLEaG~~~~~~~~~~~~p~~~~~~~~~~~dw~~~t~p~~------~~ 93 (391)
T d1gpea1 20 VAGKTYDYIIAGGGLTGLTVAAKLTENPKIKVLVIEKGFYESNDGAIIEDPNAYGQIFGTTVDQNYLTVPLI------NN 93 (391)
T ss_dssp TTTCEEEEEEECCSHHHHHHHHHHHTSTTCCEEEEESSCCCTTSCHHHHCGGGTTTTTTSTTBCCEECCCCT------TS
T ss_pred ccCCeeeEEEECcCHHHHHHHHHHHHCCCCeEEEEcCCCCCCCCCceeeCHHHHHHhhCCCcccCceeeecC------CC
Confidence 3557899999999999999999999998899999999986432 34678877777888999999999984 68
Q ss_pred ceeecccccccCccccccceEEecCCccchHHHhh-cCCCCCChhhHHHHHHHhcccccCCcc-------cCCCCCCCCC
Q psy11618 235 ARIKITAGKGLGGSSAVQNILYQRGTSYDYENFAK-LGYNGWGYDETLKYFVKSEDYRSVIYN-------ESKAVHGTQG 306 (1381)
Q Consensus 235 r~i~~pRGKvLGGSSsINgmvy~RGs~~DFD~Wa~-lGn~GWswedLlPYFkKsE~~~~p~~~-------~d~~~HG~~G 306 (1381)
|+..|+|||++||||++|+|+|.|+++.|||.|++ .|++||+|++++|||+|+|++..+..+ .++++||.+|
T Consensus 94 r~~~~~~G~~lGGsS~in~~~~~rg~~~d~~~w~~~~G~~gW~~~~l~pyf~k~E~~~~~~~~~~~~~~~~~~~~~g~~~ 173 (391)
T d1gpea1 94 RTNNIKAGKGLGGSTLINGDSWTRPDKVQIDSWEKVFGMEGWNWDNMFEYMKKAEAARTPTAAQLAAGHSFNATCHGTNG 173 (391)
T ss_dssp CCCEECCBCSTTGGGGTSCCEECCCCHHHHHHHHHTTCCTTCSHHHHHHHHHHTEEECCCCHHHHHHTCCCCGGGCCBSS
T ss_pred cEeeeceeeccCcccceeeeEEeeccccccccccccCCCCccccchhHHHHHHhhhccCCcchhcccccCccccccCCCC
Confidence 89999999999999999999999999999999987 489999999999999999998755321 2567899999
Q ss_pred CccccCCCCC-CCchHHHHHHHHHHHcCCCCCCCCCCCCCCcccccCCCCC-CCCcccchhhhcchhhhcCCCCeEEEcC
Q psy11618 307 YLPVGLFKNK-ENNIIREIFETSAQELGYPCPKDMNDRYVDVGFAELPGMT-RYGLRFSAADAYLTPIAGKRTNLYVLKR 384 (1381)
Q Consensus 307 PL~Vs~~p~~-e~~pl~~~f~eA~eeLG~p~~~D~N~g~~~~G~s~~~~ti-~~G~RsSAa~AYL~Pa~~~R~NLtILTn 384 (1381)
|++++..+.. ..+|..+++.++++++|++.++|.|+++ +.|.+..+.++ .++.|++++++++.|.. +|+|++|+||
T Consensus 174 ~~~~~~~~~~~~~~p~~~~~~~a~~~~G~~~~~~~~~g~-~~~~~~~~~~~~~~~~r~s~a~~~~~p~~-~r~nl~i~t~ 251 (391)
T d1gpea1 174 TVQSGARDNGQPWSPIMKALMNTVSALGVPVQQDFLCGH-PRGVSMIMNNLDENQVRVDAARAWLLPNY-QRSNLEILTG 251 (391)
T ss_dssp SEEEBCCCCSSCBCTHHHHHHHHHHHTTCCBSCCTTSSC-CCEEECCEESBCTTCCBCCHHHHHTTTTT-TCTTEEEEES
T ss_pred cccccccccccccCHHHHHHHHHHHhcCCceeeccccCc-ccccccccceeeccccccchhhhccCccc-cchhhhhhcc
Confidence 9998765433 3478999999999999999888888887 66666555554 45689999999999988 8999999999
Q ss_pred cEEEEEEec---CCCeEEEEEEEecCCeEEEEecCcEEEEcCCchhhHHHHHHcCCCCCCccccCCCCcccCCc--cchh
Q psy11618 385 SKVTKVIIN---DQNVATGVEYVNSKGETVRVTANKEVILTAGAIANAQLLLLSGIGPKAHLDEVKIPVKQDLR--VGEN 459 (1381)
Q Consensus 385 A~VtRIlfd---~g~RAtGVE~vd~~Gr~~tV~ArKEVILSAGAI~SPqLLmlSGIGPkd~Le~lGIpVVvDLP--VGrN 459 (1381)
++|+||++| +++||+||||.+.+|++++++|+||||||||||+||||||+|||||+++|+++||++++|+| ||+|
T Consensus 252 a~V~rIl~~~~~~g~ra~GV~~~~~~g~~~~v~A~keVILaAGai~SP~LLl~SGIGp~~~L~~~gI~~v~dlP~Gvg~n 331 (391)
T d1gpea1 252 QMVGKVLFKQTASGPQAVGVNFGTNKAVNFDVFAKHEVLLAAGSAISPLILEYSGIGLKSVLDQANVTQLLDLPVGICSM 331 (391)
T ss_dssp CEEEEEEEEEETTEEEEEEEEEEEETTEEEEEEEEEEEEECSCTTTHHHHHHHTTEECHHHHHHTTCCCSEECCTTCTCB
T ss_pred ceeeEEeeeCCCCCceEEeeEEecCCCeEEEEEeCCEEEEecchhcchHHHHhcCCCcHHHHHHCCCCEEEECCcccccc
Confidence 999999997 24599999998867888999999999999999999999999999999999999999999998 7888
Q ss_pred cccccc
Q psy11618 460 LKLNAQ 465 (1381)
Q Consensus 460 LQDHp~ 465 (1381)
+|||+.
T Consensus 332 l~dh~~ 337 (391)
T d1gpea1 332 MSRELG 337 (391)
T ss_dssp SCGGGT
T ss_pred cccCcc
Confidence 888843
|
| >d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} | Back information, alignment and structure |
|---|
| >d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} | Back information, alignment and structure |
|---|
| >d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} | Back information, alignment and structure |
|---|
| >d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} | Back information, alignment and structure |
|---|
| >d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} | Back information, alignment and structure |
|---|
| >d1gpea2 d.16.1.1 (A:329-524) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} | Back information, alignment and structure |
|---|
| >d1cf3a2 d.16.1.1 (A:325-520) Glucose oxidase {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1kdga2 d.16.1.1 (A:513-693) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), substrate-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} | Back information, alignment and structure |
|---|
| >d1ju2a2 d.16.1.1 (A:294-463) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} | Back information, alignment and structure |
|---|
| >d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|