Psyllid ID: psy11795

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310---
MGFDLEINGVMINFPPNVCRSRYRDYCCPGWTLKQATGLCIIHYRTGPCYTKVVNDMCQGQLEGVVCTKQLCCATVGRAWGHPCEHCPAQLDCDEGHLKNIHSGQCVDIDECEAVPDIDECEAVPGLCRGGRCINTPGSFTCECARGKSRNPDTNACEDRNECREEPNICANGKCVNTDGGFYCICNPGFIPTQDRMSCIDARQGSCYTSLTSDNQCKNKLPIRLSRKDCCCGKNMGKAWGDECLQCPMIGEDCLFPLLISDARQGSCYTSLTSDNQCKNKLPIRLSRKDCCCGKNMGKAWGDECLQCPMIGE
ccccccccccccccccccccccEEEccccccEEEcccccEEccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccEEEEccccEEEEcccccEEccccccccEEcccccccccccccEEEEcccccEEEcccccEEcccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccccccccEEEcccccEEEEcccccEEcccccEcccccccccccccccccEEccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccEEEcccccEEEEcccccEEcccccEEEEcHHHccccccccccEEEcccccEEEEcccccEEcccccEEEEccccccccccccccEEcccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccc
mgfdleingvminfppnvcrsryrdyccpgwtlkqatglciihyrtgpcytKVVNDMCQgqlegvvctkqlccatvgrawghpcehcpaqldcdeghlknihsgqcvdideceavpdideceavpglcrggrcintpgsftcecargksrnpdtnacedrnecreepnicangkcvntdggfycicnpgfiptqdrmscidarqgscytsltsdnqcknklpirlsrkdcccgknmgkawgdeclqcpmigedclfpllisdarqgscytsltsdnqcknklpirlsrkdcccgknmgkawgdeclqcpmige
mgfdleinGVMINFPPNVCRSRYRDYCCPGWTLKQATGLCIIHYRTGPCYTKVVNDMCQGQLEGVVCTKQLCCATVGRAWGHPCEHCPAQLDCDEGHLKNIHSGQCVDIDECEAVPDIDECEAVPGLCRGGRCINTPGSFTcecargksrnpdtnaCEDRNECREEPNICANGKCVNTDGGFYCICNPGFIPTQDRMSCIDARQGscytsltsdnqcknklpirlsrkdCCCGKNMGKAWGDECLQCPMIGEDCLFPLLISDARQGSCYtsltsdnqcknklpirlsrkdcCCGKNMgkawgdeclqcpmige
MGFDLEINGVMINFPPNVCRSRYRDYCCPGWTLKQATGLCIIHYRTGPCYTKVVNDMCQGQLEGVVCTKQLCCATVGRAWGHPCEHCPAQLDCDEGHLKNIHSGQCVDIDECEAVPDIDECEAVPGLCRGGRCINTPGSFTCECARGKSRNPDTNACEDRNECREEPNICANGKCVNTDGGFYCICNPGFIPTQDRMSCIDARQGSCYTSLTSDNQCKNKLPIRLSRKDCCCGKNMGKAWGDECLQCPMIGEDCLFPLLISDARQGSCYTSLTSDNQCKNKLPIRLSRKDCCCGKNMGKAWGDECLQCPMIGE
***DLEINGVMINFPPNVCRSRYRDYCCPGWTLKQATGLCIIHYRTGPCYTKVVNDMCQGQLEGVVCTKQLCCATVGRAWGHPCEHCPAQLDCDEGHLKNIHSGQCVDIDECEAVPDIDECEAVPGLCRGGRCINTPGSFTCECA*********************PNICANGKCVNTDGGFYCICNPGFIPTQDRMSCIDARQGSCYTSLTSDNQCKNKLPIRLSRKDCCCGKNMGKAWGDECLQCPMIGEDCLFPLLISDARQGSCYTSLTSDNQCKNKLPIRLSRKDCCCGKNMGKAWGDECLQCPM***
MGFDLEINGVMINFPPNVCRSRYRDYCCPGWTLKQATGLCIIHYRTGPCYTKVVNDMCQGQLEGVVCTKQLCCATVGRAWGHPCEHCPAQLDCDEGHLKNIHSGQCVDIDECEAVPDIDECEAVPGLCRGGRCINTPGSFTCECARGKSRNPDTNACEDRNECREEPNICANGKCVNTDGGFYCICNPGFIPTQDRMSCIDARQGSCYTSLTSDNQCKNKLPIRLSRKDCCCGKNMGKAWGDECLQCPMIGEDCLFPLLISDARQGSCYTSLTSDNQCKNKLPIRLSRKDCCCGKNMGKAWGDECLQCPM***
MGFDLEINGVMINFPPNVCRSRYRDYCCPGWTLKQATGLCIIHYRTGPCYTKVVNDMCQGQLEGVVCTKQLCCATVGRAWGHPCEHCPAQLDCDEGHLKNIHSGQCVDIDECEAVPDIDECEAVPGLCRGGRCINTPGSFTCECAR****************CREEPNICANGKCVNTDGGFYCICNPGFIPTQDRMSCIDARQGSCYTSLTSDNQCKNKLPIRLSRKDCCCGKNMGKAWGDECLQCPMIGEDCLFPLLISDARQGSCYTSLTSDNQCKNKLPIRLSRKDCCCGKNMGKAWGDECLQCPMIGE
***DLEINGVMINFPPNVCRSRYRDYCCPGWTLKQATGLCIIHYRTGPCYTKVVNDMCQGQLEGVVCTKQLCCATVGRAWGHPCEHCPAQLDCDEGHLKNIHSGQCVDIDECEAVPDIDECEAVPGLCRGGRCINTPGSFTCECARGKSRNPDTNACEDRNECREEPNICANGKCVNTDGGFYCICNPGFIPTQDRMSCIDARQGSCYTSLTSDNQCKNKLPIRLSRKDCCCGKNMGKAWGDECLQCPMIGEDCLFPLLISDARQGSCYTSLTSDNQCKNKLPIRLSRKDCCCGKNMGKAWGDECLQC*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGFDLEINGVMINFPPNVCRSRYRDYCCPGWTLKQATGLCIIHYRTGPCYTKVVNDMCQGQLEGVVCTKQLCCATVGRAWGHPCEHCPAQLDCDEGHLKNIHSGQCVDIDECEAVPDIDECEAVPGLCRGGRCINTPGSFTCECARGKSRNPDTNACEDRNECREEPNICANGKCVNTDGGFYCICNPGFIPTQDRMSCIDARQGSCYTSLTSDNQCKNKLPIRLSRKDCCCGKNMGKAWGDECLQCPMIGEDCLFPLLISDARQGSCYTSLTSDNQCKNKLPIRLSRKDCCCGKNMGKAWGDECLQCPMIGE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query313 2.2.26 [Sep-21-2011]
Q9TV36 2871 Fibrillin-1 OS=Sus scrofa yes N/A 0.658 0.071 0.497 3e-50
P35555 2871 Fibrillin-1 OS=Homo sapie yes N/A 0.658 0.071 0.493 5e-50
P98133 2871 Fibrillin-1 OS=Bos taurus yes N/A 0.658 0.071 0.488 2e-49
Q61554 2871 Fibrillin-1 OS=Mus muscul yes N/A 0.658 0.071 0.479 2e-49
Q61555 2907 Fibrillin-2 OS=Mus muscul no N/A 0.680 0.073 0.464 1e-48
P35556 2912 Fibrillin-2 OS=Homo sapie no N/A 0.674 0.072 0.465 1e-48
Q75N90 2809 Fibrillin-3 OS=Homo sapie no N/A 0.728 0.081 0.350 1e-30
Q8K4G1 1666 Latent-transforming growt no N/A 0.642 0.120 0.306 2e-16
O35806 1764 Latent-transforming growt no N/A 0.658 0.116 0.300 2e-15
Q14766 1721 Latent-transforming growt no N/A 0.613 0.111 0.310 2e-15
>sp|Q9TV36|FBN1_PIG Fibrillin-1 OS=Sus scrofa GN=FBN1 PE=2 SV=1 Back     alignment and function desciption
 Score =  199 bits (505), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 111/223 (49%), Positives = 138/223 (61%), Gaps = 17/223 (7%)

Query: 19  CRSRYRDYCCPGWTLKQATGLCIIHYRTGPCYTKVVNDMCQGQLEGVVCTKQLCCATVGR 78
           C +  R  C  G+T  Q    C   YRTGPC+T V N MCQGQL G+VCTK LCCATVGR
Sbjct: 160 CVAPNRCACTYGFTGPQ----CERDYRTGPCFTVVSNQMCQGQLSGIVCTKTLCCATVGR 215

Query: 79  AWGHPCEHCPAQLD-CDEGHLKNIHSGQCVDIDECEAVPDIDECEAVPGLCRGGRCINTP 137
           AWGHPCE CPAQ   C  G + NI +G C          D+DEC+A+PGLC+GG CINT 
Sbjct: 216 AWGHPCEMCPAQPHPCRRGFIPNIRTGAC---------QDVDECQAIPGLCQGGNCINTV 266

Query: 138 GSFTCECARGKSRNPDTNACEDRNECREEPNICANGKCVNTDGGFYCICNPGFIPTQDRM 197
           GSF C+C  G   N  +  CED +EC   P IC  G+C NT   ++C C PGF  + D  
Sbjct: 267 GSFECKCPAGHKFNEVSQKCEDIDECSTIPGICDGGECTNTVSSYFCKCPPGFYTSPDGT 326

Query: 198 SCIDARQGSCYTSLTSDNQCKNKLPIRLSRKDCCCGKNMGKAW 240
            CID R G CYT+LT + +C N+LP  +++  CCC  ++G+ W
Sbjct: 327 RCIDVRPGYCYTALT-NGRCSNQLPQSITKMQCCC--DVGRCW 366
Fibrillins are structural components of 10-12 nm extracellular calcium-binding microfibrils, which occur either in association with elastin or in elastin-free bundles. Fibrillin-1-containing microfibrils provide long-term force bearing structural support. Regulates osteoblast maturation by controlling TGF-beta bioavailability and calibrating TGF-beta and BMP levels, respectively.
Sus scrofa (taxid: 9823)
>sp|P35555|FBN1_HUMAN Fibrillin-1 OS=Homo sapiens GN=FBN1 PE=1 SV=3 Back     alignment and function description
>sp|P98133|FBN1_BOVIN Fibrillin-1 OS=Bos taurus GN=FBN1 PE=1 SV=1 Back     alignment and function description
>sp|Q61554|FBN1_MOUSE Fibrillin-1 OS=Mus musculus GN=Fbn1 PE=1 SV=1 Back     alignment and function description
>sp|Q61555|FBN2_MOUSE Fibrillin-2 OS=Mus musculus GN=Fbn2 PE=1 SV=2 Back     alignment and function description
>sp|P35556|FBN2_HUMAN Fibrillin-2 OS=Homo sapiens GN=FBN2 PE=1 SV=3 Back     alignment and function description
>sp|Q75N90|FBN3_HUMAN Fibrillin-3 OS=Homo sapiens GN=FBN3 PE=2 SV=3 Back     alignment and function description
>sp|Q8K4G1|LTBP4_MOUSE Latent-transforming growth factor beta-binding protein 4 OS=Mus musculus GN=Ltbp4 PE=2 SV=2 Back     alignment and function description
>sp|O35806|LTBP2_RAT Latent-transforming growth factor beta-binding protein 2 OS=Rattus norvegicus GN=Ltbp2 PE=2 SV=1 Back     alignment and function description
>sp|Q14766|LTBP1_HUMAN Latent-transforming growth factor beta-binding protein 1 OS=Homo sapiens GN=LTBP1 PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query313
242016322 2816 Fibrillin-2 precursor, putative [Pedicul 0.651 0.072 0.644 5e-75
350416792 2865 PREDICTED: fibrillin-2-like [Bombus impa 0.677 0.073 0.625 2e-74
340721645 2865 PREDICTED: fibrillin-2-like [Bombus terr 0.677 0.073 0.625 3e-74
383864528 2865 PREDICTED: fibrillin-2-like [Megachile r 0.677 0.073 0.621 2e-73
380016550 2868 PREDICTED: fibrillin-2-like [Apis florea 0.677 0.073 0.616 2e-73
328787226 2870 PREDICTED: fibrillin-2-like [Apis mellif 0.677 0.073 0.616 6e-73
332018680 2757 Fibrillin-2 [Acromyrmex echinatior] 0.677 0.076 0.607 4e-72
321472519 2762 hypothetical protein DAPPUDRAFT_315775 [ 0.667 0.075 0.610 9e-72
307196014 2862 Fibrillin-2 [Harpegnathos saltator] 0.677 0.074 0.603 1e-71
322786670 458 hypothetical protein SINV_08004 [Solenop 0.648 0.443 0.630 1e-71
>gi|242016322|ref|XP_002428778.1| Fibrillin-2 precursor, putative [Pediculus humanus corporis] gi|212513463|gb|EEB16040.1| Fibrillin-2 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  287 bits (734), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 170/214 (79%), Gaps = 10/214 (4%)

Query: 40  CIIHYRTGPCYTKVVNDMCQGQLEGVVCTKQLCCATVGRAWGHPCEHCPAQLDCDEGHLK 99
           C   YRTGPCYT V NDMC GQLEG+VCTK LCCATVG+AWGHPCE CP  LDCD+G+LK
Sbjct: 119 CEADYRTGPCYTIVKNDMCLGQLEGIVCTKNLCCATVGKAWGHPCEQCPTTLDCDQGYLK 178

Query: 100 NIHSGQCVDIDECEAVPDIDECEAVPGLCRGGRCINTPGSFTCECARGKSRNPDTNACED 159
           NIHS +C+         D+DECEA+PGLC GGRC+NT GSFTCEC  G++R   TN CED
Sbjct: 179 NIHSQECL---------DVDECEAIPGLCSGGRCLNTIGSFTCECPEGQARGLTTNRCED 229

Query: 160 RNECREEPNICANGKCVNTDGGFYCICNPGFIPTQDRMSCIDARQGSCYTSLTSDNQCKN 219
           R+EC   PN+C +G+CVNT+G +YC+CNPGFIP+QDR +C+DARQG+C+T+L  + +C+N
Sbjct: 230 RDECL-IPNVCLDGRCVNTNGSYYCVCNPGFIPSQDRKTCLDARQGNCFTTLGYNGECQN 288

Query: 220 KLPIRLSRKDCCCGKNMGKAWGDECLQCPMIGED 253
            L I+LS+KDCCCG NMG+ WG+EC  CPM GE+
Sbjct: 289 PLNIKLSKKDCCCGVNMGRGWGEECDICPMAGEE 322

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350416792|ref|XP_003491105.1| PREDICTED: fibrillin-2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340721645|ref|XP_003399227.1| PREDICTED: fibrillin-2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|383864528|ref|XP_003707730.1| PREDICTED: fibrillin-2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380016550|ref|XP_003692245.1| PREDICTED: fibrillin-2-like [Apis florea] Back     alignment and taxonomy information
>gi|328787226|ref|XP_003250904.1| PREDICTED: fibrillin-2-like [Apis mellifera] Back     alignment and taxonomy information
>gi|332018680|gb|EGI59252.1| Fibrillin-2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|321472519|gb|EFX83489.1| hypothetical protein DAPPUDRAFT_315775 [Daphnia pulex] Back     alignment and taxonomy information
>gi|307196014|gb|EFN77739.1| Fibrillin-2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322786670|gb|EFZ13054.1| hypothetical protein SINV_08004 [Solenopsis invicta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query313
UNIPROTKB|F1PIA3 2871 FBN1 "Uncharacterized protein" 0.738 0.080 0.465 1.5e-67
UNIPROTKB|Q9TV36 2871 FBN1 "Fibrillin-1" [Sus scrofa 0.738 0.080 0.461 8.2e-67
UNIPROTKB|G3V9M6 2872 Fbn1 "Fibrillin 1, isoform CRA 0.722 0.078 0.464 1.1e-66
RGD|620908 2872 Fbn1 "fibrillin 1" [Rattus nor 0.722 0.078 0.464 1.1e-66
UNIPROTKB|P35555 2871 FBN1 "Fibrillin-1" [Homo sapie 0.722 0.078 0.464 1.3e-66
UNIPROTKB|F1SN67 2336 FBN1 "Fibrillin-1" [Sus scrofa 0.741 0.099 0.459 1.5e-66
UNIPROTKB|F1N4K8 2871 FBN1 "Fibrillin-1" [Bos taurus 0.738 0.080 0.457 2.2e-66
RGD|620910 2906 Fbn2 "fibrillin 2" [Rattus nor 0.699 0.075 0.466 2.9e-66
UNIPROTKB|E2RS46 2921 FBN2 "Uncharacterized protein" 0.699 0.074 0.462 2.9e-66
UNIPROTKB|P98133 2871 FBN1 "Fibrillin-1" [Bos taurus 0.738 0.080 0.457 3.6e-66
UNIPROTKB|F1PIA3 FBN1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 609 (219.4 bits), Expect = 1.5e-67, Sum P(2) = 1.5e-67
 Identities = 120/258 (46%), Positives = 152/258 (58%)

Query:    19 CRSRYRDYCCPGWTLKQATGLCIIHYRTGPCYTKVVNDMCQGQLEGVVCTKQLCCATVGR 78
             C +  R  C  G+T  Q    C   YRTGPC+T V N MCQGQL G+VCTK LCCATVGR
Sbjct:   160 CVAPNRCACTYGFTGPQ----CERDYRTGPCFTVVSNQMCQGQLSGIVCTKTLCCATVGR 215

Query:    79 AWGHPCEHCPAQLD-CDEGHLKNIHSGQCVDIDECEAVPDIDECEAVPGLCRGGRCINTP 137
             AWGHPCE CPAQ   C  G + NI +G C          D+DEC+A+PGLC+GG CINT 
Sbjct:   216 AWGHPCEMCPAQPHPCRRGFIPNIRTGAC---------QDVDECQAIPGLCQGGNCINTV 266

Query:   138 GSFTCECARGKSRNPDTNACEDRNECREEPNICANGKCVNTDGGFYCICNPGFIPTQDRM 197
             GSF C+C  G   N  +  CED +EC   P IC  G+C NT   ++C C PGF P+ D  
Sbjct:   267 GSFECKCPAGHKFNEASQKCEDIDECSTIPGICDGGECTNTVSSYFCKCPPGFYPSPDGT 326

Query:   198 SCIDARQGSCYTSLTSDNQCKNKLPIRLSRKDCCCGKNMGKAWGDECL----QCPMIG-E 252
              C+D R G CYT+L ++ +C N+LP  +++  CCC  ++G+ W          CP+   E
Sbjct:   327 RCVDVRPGYCYTAL-ANGRCSNQLPQSITKMQCCC--DVGRCWSPGVTVAPEMCPIRATE 383

Query:   253 D----CLFPLLISDARQG 266
             D    C  PL+I + R G
Sbjct:   384 DFNKLCSVPLVIPE-RPG 400
GO:0005578 "proteinaceous extracellular matrix" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
GO:0005201 "extracellular matrix structural constituent" evidence=IEA
UNIPROTKB|Q9TV36 FBN1 "Fibrillin-1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|G3V9M6 Fbn1 "Fibrillin 1, isoform CRA_a" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|620908 Fbn1 "fibrillin 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P35555 FBN1 "Fibrillin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SN67 FBN1 "Fibrillin-1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1N4K8 FBN1 "Fibrillin-1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|620910 Fbn2 "fibrillin 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RS46 FBN2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P98133 FBN1 "Fibrillin-1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query313
pfam0068342 pfam00683, TB, TB domain 6e-06
pfam0764542 pfam07645, EGF_CA, Calcium-binding EGF domain 1e-04
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 3e-04
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 8e-04
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 0.001
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 0.001
>gnl|CDD|201391 pfam00683, TB, TB domain Back     alignment and domain information 
 Score = 42.3 bits (100), Expect = 6e-06
 Identities = 19/38 (50%), Positives = 22/38 (57%), Gaps = 1/38 (2%)

Query: 57 MCQGQLEGVVCTKQLCCATVGRAWGHPCEHCPAQLDCD 94
           C   L G V TK  CC ++GRAWG PCE CP Q   +
Sbjct: 2  RCSNPLPGNV-TKSECCCSLGRAWGTPCEPCPVQGTAE 38

This domain is also known as the 8 cysteine domain. This family includes the hybrid domains. This cysteine rich repeat is found in TGF binding protein and fibrillin. Length = 42
>gnl|CDD|219496 pfam07645, EGF_CA, Calcium-binding EGF domain Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 313
KOG1214|consensus 1289 99.35
KOG1214|consensus 1289 99.21
KOG1219|consensus 4289 99.2
KOG1219|consensus 4289 99.07
KOG1217|consensus487 98.98
KOG4289|consensus 2531 98.96
KOG4260|consensus350 98.9
KOG1217|consensus 487 98.87
PF0068342 TB: TB domain; InterPro: IPR002212 Transforming gr 98.68
KOG4289|consensus 2531 98.63
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 98.62
KOG4260|consensus350 98.45
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 98.41
PF1266224 cEGF: Complement Clr-like EGF-like 97.98
PF1266224 cEGF: Complement Clr-like EGF-like 97.9
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 97.79
KOG1225|consensus525 97.7
KOG1225|consensus525 97.59
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.43
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 97.42
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 97.39
KOG0994|consensus 1758 97.33
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 97.22
PF0000832 EGF: EGF-like domain This is a sub-family of the P 97.11
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 97.04
KOG0994|consensus 1758 97.01
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.0
PF0000832 EGF: EGF-like domain This is a sub-family of the P 96.99
smart0018135 EGF Epidermal growth factor-like domain. 96.53
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 96.5
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 96.45
PF0068342 TB: TB domain; InterPro: IPR002212 Transforming gr 96.38
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 96.18
cd0005336 EGF Epidermal growth factor domain, found in epide 96.17
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 95.99
KOG1226|consensus783 95.98
smart0018135 EGF Epidermal growth factor-like domain. 95.83
cd0005336 EGF Epidermal growth factor domain, found in epide 95.77
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 95.57
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 95.25
KOG1226|consensus 783 94.19
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 93.0
PHA03099139 epidermal growth factor-like protein (EGF-like pro 88.71
KOG1836|consensus 1705 86.49
>KOG1214|consensus Back     alignment and domain information 
Probab=99.35  E-value=3.6e-12  Score=125.43  Aligned_cols=156  Identities=26%  Similarity=0.555  Sum_probs=118.1

Q ss_pred             CCCeeecCCCCCCCCCeEeeCCCCCeecCCCcceecCCCCC--CCccCCCCCccCCCCCCceecCCcccccCCcccCCCC
Q psy11795          7 INGVMINFPPNVCRSRYRDYCCPGWTLKQATGLCIIHYRTG--PCYTKVVNDMCQGQLEGVVCTKQLCCATVGRAWGHPC   84 (313)
Q Consensus         7 ~ng~C~n~~g~~c~~~y~C~C~~G~~g~~~~~~~~~~c~~~--~C~~~~~~~~C~~~~~~~~C~~~~C~~~~~~~~~~~C   84 (313)
                      .++.|...++    -.|.|+|..||.|+.-..+.+++|+..  .|   ..++.|++..+.|.|.                
T Consensus       704 t~a~C~pg~~----~~~tcecs~g~~gdgr~c~d~~eca~~~~~C---Gp~s~Cin~pg~~rce----------------  760 (1289)
T KOG1214|consen  704 TTARCHPGTG----VDYTCECSSGYQGDGRNCVDENECATGFHRC---GPNSVCINLPGSYRCE----------------  760 (1289)
T ss_pred             CCccccCCCC----cceEEEEeeccCCCCCCCCChhhhccCCCCC---CCCceeecCCCceeEE----------------
Confidence            3566777766    589999999999987554445555433  34   3578999988889988                


Q ss_pred             CCCCCCCCCCCCceecCCCCCcccCccCCCCCCcCccccCCCCCC-C--CeeeeCC-CCeeeecCCCcccCCCCCCcccC
Q psy11795         85 EHCPAQLDCDEGHLKNIHSGQCVDIDECEAVPDIDECEAVPGLCR-G--GRCINTP-GSFTCECARGKSRNPDTNACEDR  160 (313)
Q Consensus        85 ~~C~~~~~C~~Gf~~~~~~~~C~dideC~~~~d~~~C~~~~~~C~-~--~~C~n~~-gsy~C~C~~G~~~~~~~~~C~di  160 (313)
                              |..||....+...|..|-.   ...++.|....+.|. +  ++|+..- ++|.|.|.+||.+  ++..|.++
T Consensus       761 --------C~~gy~F~dd~~tCV~i~~---pap~n~Ce~g~h~C~i~g~a~c~~hGgs~y~C~CLPGfsG--DG~~c~dv  827 (1289)
T KOG1214|consen  761 --------CRSGYEFADDRHTCVLITP---PAPANPCEDGSHTCAIAGQARCVHHGGSTYSCACLPGFSG--DGHQCTDV  827 (1289)
T ss_pred             --------EeecceeccCCcceEEecC---CCCCCccccCccccCcCCceEEEecCCceEEEeecCCccC--Cccccccc
Confidence                    8888887776677874321   012333466667775 3  6676654 5699999999998  56889999


Q ss_pred             ccccCCCCCCCC-CEEEeCCCCcEEecCCCceeCCCCCceeeC
Q psy11795        161 NECREEPNICAN-GKCVNTDGGFYCICNPGFIPTQDRMSCIDA  202 (313)
Q Consensus       161 deC~~~~~~C~~-~~C~n~~g~y~C~C~~Gy~~~~~~~~C~d~  202 (313)
                      |||.  ++.|+. ++|+|++|+|.|+|.+||.+  |+..|++-
T Consensus       828 DeC~--psrChp~A~CyntpgsfsC~C~pGy~G--DGf~CVP~  866 (1289)
T KOG1214|consen  828 DECS--PSRCHPAATCYNTPGSFSCRCQPGYYG--DGFQCVPD  866 (1289)
T ss_pred             cccC--ccccCCCceEecCCCcceeecccCccC--CCceecCC
Confidence            9999  888986 99999999999999999998  58888753

>KOG1214|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>PF00683 TB: TB domain; InterPro: IPR002212 Transforming growth factor beta (TGF-beta)-binding protein-like (TB) domain comes from human fibrillin-1[] Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>PF00683 TB: TB domain; InterPro: IPR002212 Transforming growth factor beta (TGF-beta)-binding protein-like (TB) domain comes from human fibrillin-1[] Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query313
2w86_A147 Crystal Structure Of Fibrillin-1 Domains Cbegf9hyb2 5e-14
2w86_A147 Crystal Structure Of Fibrillin-1 Domains Cbegf9hyb2 1e-04
1uzj_A162 Integrin Binding Cbegf22-Tb4-Cbegf33 Fragment Of Hu 1e-13
1uzj_A162 Integrin Binding Cbegf22-Tb4-Cbegf33 Fragment Of Hu 8e-13
1uzj_A162 Integrin Binding Cbegf22-Tb4-Cbegf33 Fragment Of Hu 7e-04
1uzk_A162 Integrin Binding Cbegf22-tb4-cbegf33 Fragment Of Hu 1e-13
1uzk_A162 Integrin Binding Cbegf22-tb4-cbegf33 Fragment Of Hu 1e-12
1uzk_A162 Integrin Binding Cbegf22-tb4-cbegf33 Fragment Of Hu 8e-04
1z6c_A87 Solution Structure Of An Egf Pair (Egf34) From Vita 8e-11
1lmj_A86 Nmr Study Of The Fibrillin-1 Cbegf12-13 Pair Of Ca2 8e-11
1emn_A82 Nmr Study Of A Pair Of Fibrillin Ca2+ Binding Epide 3e-08
2vj3_A135 Human Notch-1 Egfs 11-13 Length = 135 4e-05
1toz_A116 Nmr Structure Of The Human Notch-1 Ligand Binding R 1e-04
3v65_B 386 Crystal Structure Of Agrin And Lrp4 Complex Length 2e-04
2bo2_A143 Egf Domains 1,2,5 Of Human Emr2, A 7-Tm Immune Syst 9e-04
>pdb|2W86|A Chain A, Crystal Structure Of Fibrillin-1 Domains Cbegf9hyb2cbegf10, Calcium Saturated Form Length = 147 Back     alignment and structure 
Iteration: 1

 Score = 74.7 bits (182), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 51/151 (33%), Positives = 71/151 (47%), Gaps = 17/151 (11%)
Query: 7   INGVMINFPPNVCRSRYRDYCCPGWTLKQATGLCIIHYRTGPCYTKVVNDMCQGQLEGVV 66
           INGV  N P       +   C    TL     +CI   + G C+  V++  C+  + G  
Sbjct: 13  INGVCKNSP-----GSFICECSSESTLDPTKTICIETIK-GTCWQTVIDGRCEININGAT 66
Query: 67  CTKQLCCATVGRAWGHPCEHCPAQLDCDEGHLKNIHSGQCVDIDECEAVPDIDECEAVPG 126
             K  CC+++G AWG PC  C     C +G+ + I   QC          DIDECE  PG
Sbjct: 67  -LKSQCCSSLGAAWGSPCTLCQVDPICGKGYSR-IKGTQC---------EDIDECEVFPG 115
Query: 127 LCRGGRCINTPGSFTCECARGKSRNPDTNAC 157
           +C+ G C+NT GSF C+C  G + +     C
Sbjct: 116 VCKNGLCVNTRGSFKCQCPSGMTLDATGRIC 146
>pdb|2W86|A Chain A, Crystal Structure Of Fibrillin-1 Domains Cbegf9hyb2cbegf10, Calcium Saturated Form Length = 147 Back     alignment and structure
>pdb|1UZJ|A Chain A, Integrin Binding Cbegf22-Tb4-Cbegf33 Fragment Of Human Fibrillin-1, Holo Form. Length = 162 Back     alignment and structure
>pdb|1UZJ|A Chain A, Integrin Binding Cbegf22-Tb4-Cbegf33 Fragment Of Human Fibrillin-1, Holo Form. Length = 162 Back     alignment and structure
>pdb|1UZJ|A Chain A, Integrin Binding Cbegf22-Tb4-Cbegf33 Fragment Of Human Fibrillin-1, Holo Form. Length = 162 Back     alignment and structure
>pdb|1UZK|A Chain A, Integrin Binding Cbegf22-tb4-cbegf33 Fragment Of Human Fibrillin-1, Ca Bound To Cbegf23 Domain Only Length = 162 Back     alignment and structure
>pdb|1UZK|A Chain A, Integrin Binding Cbegf22-tb4-cbegf33 Fragment Of Human Fibrillin-1, Ca Bound To Cbegf23 Domain Only Length = 162 Back     alignment and structure
>pdb|1UZK|A Chain A, Integrin Binding Cbegf22-tb4-cbegf33 Fragment Of Human Fibrillin-1, Ca Bound To Cbegf23 Domain Only Length = 162 Back     alignment and structure
>pdb|1Z6C|A Chain A, Solution Structure Of An Egf Pair (Egf34) From Vitamin K- Dependent Protein S Length = 87 Back     alignment and structure
>pdb|1LMJ|A Chain A, Nmr Study Of The Fibrillin-1 Cbegf12-13 Pair Of Ca2+ Binding Epidermal Growth Factor-like Domains Length = 86 Back     alignment and structure
>pdb|1EMN|A Chain A, Nmr Study Of A Pair Of Fibrillin Ca2+ Binding Epidermal Growth Factor-Like Domains, Minimized Average Structure Length = 82 Back     alignment and structure
>pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 Back     alignment and structure
>pdb|1TOZ|A Chain A, Nmr Structure Of The Human Notch-1 Ligand Binding Region Length = 116 Back     alignment and structure
>pdb|3V65|B Chain B, Crystal Structure Of Agrin And Lrp4 Complex Length = 386 Back     alignment and structure
>pdb|2BO2|A Chain A, Egf Domains 1,2,5 Of Human Emr2, A 7-Tm Immune System Molecule, In Complex With Calcium. Length = 143 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query313
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 2e-23
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 7e-08
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 4e-19
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 8e-10
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 8e-06
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 4e-17
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 6e-14
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 1e-07
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 2e-16
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 6e-07
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 7e-04
2bou_A143 EGF-like module containing mucin-like hormone rece 8e-16
2bou_A143 EGF-like module containing mucin-like hormone rece 4e-09
2bou_A143 EGF-like module containing mucin-like hormone rece 9e-07
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 1e-13
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 4e-09
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 7e-08
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 1e-12
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 2e-10
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 2e-04
1aut_L114 Activated protein C; serine proteinase, plasma cal 2e-11
3v65_B 386 Low-density lipoprotein receptor-related protein; 8e-11
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 8e-09
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 7e-06
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 5e-08
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 4e-06
1apj_A74 Fibrillin; microfibril, TB module, marfan syndrome 1e-07
1apj_A74 Fibrillin; microfibril, TB module, marfan syndrome 2e-06
1apj_A74 Fibrillin; microfibril, TB module, marfan syndrome 9e-06
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 1e-07
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 1e-07
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 7e-07
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 1e-06
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 4e-06
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 4e-05
2vh0_B134 Activated factor XA light chain; serine protease, 6e-06
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 2e-05
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 9e-05
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 1e-04
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 4e-04
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
 Score = 90.8 bits (226), Expect = 2e-23
 Identities = 36/85 (42%), Positives = 49/85 (57%), Gaps = 1/85 (1%)

Query: 117 DIDECEAVPGLCRGGRCINTPGSFTCECARG-KSRNPDTNACEDRNECREEPNICANGKC 175
           DIDEC   P LC  G+C+NTPG F C+C  G +S       C D +EC+ +P +C  G C
Sbjct: 2   DIDECRISPDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGVC 61

Query: 176 VNTDGGFYCICNPGFIPTQDRMSCI 200
            NT+G + C C PG   + +  +CI
Sbjct: 62  HNTEGSYRCECPPGHQLSPNISACI 86
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>1apj_A Fibrillin; microfibril, TB module, marfan syndrome, connective tissue, novel fold, extracellular matrix; NMR {Homo sapiens} SCOP: g.23.1.1 Length = 74 Back     alignment and structure
>1apj_A Fibrillin; microfibril, TB module, marfan syndrome, connective tissue, novel fold, extracellular matrix; NMR {Homo sapiens} SCOP: g.23.1.1 Length = 74 Back     alignment and structure
>1apj_A Fibrillin; microfibril, TB module, marfan syndrome, connective tissue, novel fold, extracellular matrix; NMR {Homo sapiens} SCOP: g.23.1.1 Length = 74 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query313
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.84
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.78
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.74
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 99.72
2bou_A143 EGF-like module containing mucin-like hormone rece 99.72
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.71
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 99.69
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.67
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 99.67
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.62
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.59
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.59
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 99.59
2bou_A143 EGF-like module containing mucin-like hormone rece 99.56
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.55
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.55
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.55
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.55
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 99.52
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 99.47
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.46
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.44
1aut_L114 Activated protein C; serine proteinase, plasma cal 99.42
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 99.41
2vh0_B134 Activated factor XA light chain; serine protease, 99.37
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 99.35
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.34
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.31
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 99.31
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.28
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.26
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.25
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.23
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 99.21
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.17
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.17
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 99.16
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 99.11
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 99.11
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.09
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 99.08
3v65_B 386 Low-density lipoprotein receptor-related protein; 99.06
1aut_L114 Activated protein C; serine proteinase, plasma cal 99.06
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 99.03
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.01
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 98.97
2vh0_B134 Activated factor XA light chain; serine protease, 98.94
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 98.89
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 98.87
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 98.82
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.81
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 98.72
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.72
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 98.69
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 98.64
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 98.62
1apj_A74 Fibrillin; microfibril, TB module, marfan syndrome 98.57
3v65_B 386 Low-density lipoprotein receptor-related protein; 98.54
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 98.48
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 98.43
1ksq_A75 Latent transforming growth factor beta binding pro 98.41
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 98.37
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 98.34
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 98.28
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 98.28
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 98.22
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 98.2
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 98.1
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 98.04
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 98.0
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 97.98
2wph_E59 Coagulation factor IXA light chain; serine proteas 97.96
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 97.93
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 97.89
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 97.78
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 97.74
2k2s_B61 Micronemal protein 6; microneme protein complex, c 97.7
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 97.68
2wph_E59 Coagulation factor IXA light chain; serine proteas 97.59
2k2s_B61 Micronemal protein 6; microneme protein complex, c 97.59
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 97.56
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 97.55
1a3p_A45 Epidermal growth factor; disulfide connectivities, 97.5
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 97.5
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 97.49
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 97.48
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 97.47
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 97.42
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 97.38
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 97.36
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 97.34
1szb_A170 Mannose binding lectin-associated serine protease- 97.23
1nql_B53 Epidermal growth factor; cell surface receptor, ty 97.21
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 97.15
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 97.14
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 97.09
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 97.04
1apj_A74 Fibrillin; microfibril, TB module, marfan syndrome 96.98
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 96.96
1a3p_A45 Epidermal growth factor; disulfide connectivities, 96.88
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 96.88
1szb_A170 Mannose binding lectin-associated serine protease- 96.83
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 96.63
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 96.6
1ob1_C99 Major merozoite surface protein; immune system, im 96.6
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 96.47
1nzi_A159 Complement C1S component; calcium, innate immunity 96.44
3f1s_B 283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 96.21
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 96.19
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 96.18
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 96.17
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 96.04
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 96.0
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 95.99
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 95.6
1nzi_A159 Complement C1S component; calcium, innate immunity 95.5
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 95.35
1nql_B53 Epidermal growth factor; cell surface receptor, ty 95.3
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 95.1
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 95.09
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 94.72
1ksq_A75 Latent transforming growth factor beta binding pro 94.63
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 93.47
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 92.94
1ob1_C99 Major merozoite surface protein; immune system, im 92.88
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 92.04
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 91.56
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 90.83
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 90.7
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 90.47
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 89.37
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 88.49
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 88.47
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 88.42
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 88.14
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 87.87
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 87.2
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 87.0
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 86.32
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 86.3
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 85.34
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 84.55
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 83.96
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 82.67
2i9a_A145 Urokinase-type plasminogen activator; growth facto 82.59
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 80.03
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
Probab=99.84  E-value=7.5e-22  Score=168.33  Aligned_cols=146  Identities=25%  Similarity=0.560  Sum_probs=120.5

Q ss_pred             ccCCCCeeecCCCCCCCCCeEeeCCCCCeec---CCCcceecCCC----CCCCccCCCCCccCCCC-----CCceecCCc
Q psy11795          4 DLEINGVMINFPPNVCRSRYRDYCCPGWTLK---QATGLCIIHYR----TGPCYTKVVNDMCQGQL-----EGVVCTKQL   71 (313)
Q Consensus         4 ~~c~ng~C~n~~g~~c~~~y~C~C~~G~~g~---~~~~~~~~~c~----~~~C~~~~~~~~C~~~~-----~~~~C~~~~   71 (313)
                      +||.||+|+++.+     +|+|.|++||+|.   .|+  .+++|.    ..||.   ++++|++..     ++|.|.   
T Consensus        11 ~pC~ng~C~~~~g-----~~~C~C~~G~~g~~~~~C~--~id~C~~~~~~~~C~---~~~~C~~~~~~~~~g~y~C~---   77 (186)
T 1z1y_A           11 TICXNGQLVQMSN-----HFXCMCNEGLVHLSENTCE--EXNECXXETLGXACG---EFGQCIENPDPAQVNMYXCG---   77 (186)
T ss_dssp             CCCBTEEEEECSS-----CEEEEECTTEEEEETTEEE--ECCCCSGGGTTSEEE---TTEEEEECSSTTSSCSEEEE---
T ss_pred             CCCCCCEeECCCC-----CeEeECCCCCccCCCCccC--CCCcccCCCCCCCCC---CCCEeecCCCCcCCCCEECC---
Confidence            6899999999997     9999999999998   443  356777    67884   678999887     789998   


Q ss_pred             ccccCCcccCCCCCCCCCCCCCCCCceecCCCCCcccCccCCCCCCcCccccCCCCCC-CCeee----eCCCCeeeecCC
Q psy11795         72 CCATVGRAWGHPCEHCPAQLDCDEGHLKNIHSGQCVDIDECEAVPDIDECEAVPGLCR-GGRCI----NTPGSFTCECAR  146 (313)
Q Consensus        72 C~~~~~~~~~~~C~~C~~~~~C~~Gf~~~~~~~~C~dideC~~~~d~~~C~~~~~~C~-~~~C~----n~~gsy~C~C~~  146 (313)
                                           |++||++..  ..|+ +|+|         ..  .+|. +++|+    ++.++|+|.|++
T Consensus        78 ---------------------C~~G~~g~~--~~C~-~d~C---------~~--~~C~~~g~C~~~~~~~~g~~~C~C~~  122 (186)
T 1z1y_A           78 ---------------------CIEGYTLXE--DTCV-LDVC---------QY--XNCGESGECIVEYLSEIQSAGCSCAI  122 (186)
T ss_dssp             ---------------------ECTTEEEET--TEEE-EGGG---------TT--CCCCTTEEEEEEEETTEEEEEEEECT
T ss_pred             ---------------------CCCCCccCC--CCCC-CCcC---------cC--CCCCCCCEEeeCCcCCCCCceEECCC
Confidence                                 999999986  2355 8888         33  3587 58999    888999999999


Q ss_pred             CcccCC-CCCCcccC--ccccCCCCCC-CC-CEEEeCCCCcEEecCCCceeCCCCCcee
Q psy11795        147 GKSRNP-DTNACEDR--NECREEPNIC-AN-GKCVNTDGGFYCICNPGFIPTQDRMSCI  200 (313)
Q Consensus       147 G~~~~~-~~~~C~di--deC~~~~~~C-~~-~~C~n~~g~y~C~C~~Gy~~~~~~~~C~  200 (313)
                      ||++.. ++..|+++  ++|.   .+| .+ ++|+++.++|+|.|++||++..+.....
T Consensus       123 Gy~g~~~~~~~C~~~~~~~C~---~~C~~~~~~C~n~~g~y~C~C~~G~~g~~~~~~~~  178 (186)
T 1z1y_A          123 GXVPNPEDEXXCTXTGETACQ---LXCNTDNEVCXNVEGVYXCQCMEGFTFDXEXNVCL  178 (186)
T ss_dssp             EEEEETTTTTEEEEEECCCCC---CCCCTTTEEEEEETTEEEEEECTTCEEETTTTEEE
T ss_pred             CCcccCCCCCcceEcCCCccc---ccccccCcceecCCCCeeeECCCCCccCcccccCC
Confidence            999854 55789865  8997   389 65 9999999999999999999887666544
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>1apj_A Fibrillin; microfibril, TB module, marfan syndrome, connective tissue, novel fold, extracellular matrix; NMR {Homo sapiens} SCOP: g.23.1.1 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>1ksq_A Latent transforming growth factor beta binding protein 1; structure, LTBP-1, TGF-beta, TB domain, latency associated propeptide, LAP; NMR {Homo sapiens} SCOP: g.23.1.1 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1apj_A Fibrillin; microfibril, TB module, marfan syndrome, connective tissue, novel fold, extracellular matrix; NMR {Homo sapiens} SCOP: g.23.1.1 Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>1ksq_A Latent transforming growth factor beta binding protein 1; structure, LTBP-1, TGF-beta, TB domain, latency associated propeptide, LAP; NMR {Homo sapiens} SCOP: g.23.1.1 Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 313
d1apja_74 g.23.1.1 (A:) Fibrillin {Human (Homo sapiens) [Tax 1e-10
d1apja_74 g.23.1.1 (A:) Fibrillin {Human (Homo sapiens) [Tax 6e-08
d1apja_74 g.23.1.1 (A:) Fibrillin {Human (Homo sapiens) [Tax 2e-06
d1uzka376 g.23.1.1 (A:1529-1604) Fibrillin {Human (Homo sapi 2e-08
d1uzka376 g.23.1.1 (A:1529-1604) Fibrillin {Human (Homo sapi 7e-06
d1uzka376 g.23.1.1 (A:1529-1604) Fibrillin {Human (Homo sapi 1e-05
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 2e-08
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 1e-07
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 5e-08
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 6e-08
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 2e-06
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 1e-05
d1lmja144 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens 3e-06
d1lmja144 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens 1e-05
d1ksqa_75 g.23.1.1 (A:) Transforming growth factor-beta bind 3e-05
d1ksqa_75 g.23.1.1 (A:) Transforming growth factor-beta bind 3e-05
d1ksqa_75 g.23.1.1 (A:) Transforming growth factor-beta bind 5e-04
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 5e-05
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 0.001
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 6e-05
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 5e-04
d1szba245 g.3.11.1 (A:124-168) Mannose-binding protein assoc 9e-05
d1szba245 g.3.11.1 (A:124-168) Mannose-binding protein assoc 0.001
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 4e-04
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 6e-04
d1nzia242 g.3.11.1 (A:118-159) Complement C1S component {Hum 0.001
d1i0ua241 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r 0.001
>d1apja_ g.23.1.1 (A:) Fibrillin {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure

class: Small proteins
fold: TB module/8-cys domain
superfamily: TB module/8-cys domain
family: TB module/8-cys domain
domain: Fibrillin
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 54.5 bits (131), Expect = 1e-10
 Identities = 16/47 (34%), Positives = 19/47 (40%)

Query: 44 YRTGPCYTKVVNDMCQGQLEGVVCTKQLCCATVGRAWGHPCEHCPAQ 90
           R   CY K     C          ++ CCA  G  WG PCE CP +
Sbjct: 5  LRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTE 51
>d1apja_ g.23.1.1 (A:) Fibrillin {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1apja_ g.23.1.1 (A:) Fibrillin {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1uzka3 g.23.1.1 (A:1529-1604) Fibrillin {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1uzka3 g.23.1.1 (A:1529-1604) Fibrillin {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1uzka3 g.23.1.1 (A:1529-1604) Fibrillin {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1ksqa_ g.23.1.1 (A:) Transforming growth factor-beta binding protein-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1ksqa_ g.23.1.1 (A:) Transforming growth factor-beta binding protein-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1ksqa_ g.23.1.1 (A:) Transforming growth factor-beta binding protein-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query313
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.94
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.9
d1uzka376 Fibrillin {Human (Homo sapiens) [TaxId: 9606]} 98.85
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.84
d1ksqa_75 Transforming growth factor-beta binding protein-1 98.84
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.83
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.82
d1apja_74 Fibrillin {Human (Homo sapiens) [TaxId: 9606]} 98.82
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.8
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.7
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.68
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.66
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.65
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.65
d1szba245 Mannose-binding protein associated serine protease 98.64
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.62
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.61
d1nt0a345 Mannose-binding protein associated serine protease 98.61
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.52
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.51
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.4
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 98.35
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 98.35
d1szba245 Mannose-binding protein associated serine protease 98.31
d1nt0a345 Mannose-binding protein associated serine protease 98.31
d3bpse140 Low density lipoprotein (LDL) receptor, different 98.22
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.21
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.19
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.17
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 98.13
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 98.09
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.07
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.04
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.01
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 98.01
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 98.0
d3bpse140 Low density lipoprotein (LDL) receptor, different 97.96
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 97.93
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 97.91
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 97.91
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 97.9
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 97.89
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 97.79
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 97.72
d1apja_74 Fibrillin {Human (Homo sapiens) [TaxId: 9606]} 97.69
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 97.68
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 97.61
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 97.57
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 97.54
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 97.52
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.52
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.46
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 97.45
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.45
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 97.42
d1ijqa250 Low density lipoprotein (LDL) receptor, different 97.41
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.32
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.3
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 97.25
d1ijqa250 Low density lipoprotein (LDL) receptor, different 97.18
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 97.17
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 97.14
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 97.12
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.01
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 96.98
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 96.96
d1uzka376 Fibrillin {Human (Homo sapiens) [TaxId: 9606]} 96.95
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 96.81
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 96.8
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 96.71
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 96.6
d1ksqa_75 Transforming growth factor-beta binding protein-1 96.56
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 96.39
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 96.05
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 95.51
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 95.31
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 95.21
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 94.8
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 94.5
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 94.0
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 90.63
d1dx5i143 Thrombomodulin, different EGF-like domains {Human 88.84
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 84.38
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 81.36
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Fibrillin-1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.94  E-value=1.4e-10  Score=71.99  Aligned_cols=42  Identities=38%  Similarity=0.969  Sum_probs=38.0

Q ss_pred             cCccccCCCCCCCCCEEEeCCCCcEEecCCCceeCCCCCcee
Q psy11795        159 DRNECREEPNICANGKCVNTDGGFYCICNPGFIPTQDRMSCI  200 (313)
Q Consensus       159 dideC~~~~~~C~~~~C~n~~g~y~C~C~~Gy~~~~~~~~C~  200 (313)
                      |||||+..+..|.+++|+|++|+|+|.|++||++..+++.|+
T Consensus         1 DidEC~~~~~~C~~~~C~Nt~Gsy~C~C~~Gy~l~~d~~~Cv   42 (42)
T d1lmja2           1 DIDECQRDPLLCRGGVCHNTEGSYRCECPPGHQLSPNISACI   42 (42)
T ss_dssp             ECCHHHHCSSTTTTSEEEEETTEEEEESCTTSCCCSSSCCCC
T ss_pred             CccccCCCCCCCCCCEeECCCCCeEEeCCCCCeECcCCCccC
Confidence            689999888889878999999999999999999988887763
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka3 g.23.1.1 (A:1529-1604) Fibrillin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksqa_ g.23.1.1 (A:) Transforming growth factor-beta binding protein-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apja_ g.23.1.1 (A:) Fibrillin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apja_ g.23.1.1 (A:) Fibrillin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uzka3 g.23.1.1 (A:1529-1604) Fibrillin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksqa_ g.23.1.1 (A:) Transforming growth factor-beta binding protein-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure