Psyllid ID: psy11801

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70---
MSEFRNGGSCLGGTRCVCRAGYKGDNCGEAECKEPCLNGGRCIGPDKCACLYGYAGRRCEADYRTGPCYTKMA
ccccccccEEccccEEEcccccccccccccccccccccccEEccccEEEcccccccccccccccccccccccc
ccccccccEEccccEcEcccccccccccccccccccccccEEccccccEcccccccccccccccccccEcEEc
msefrnggsclggtrcvcragykgdncgeaeckepclnggrcigpdkcaclygyagrrceadyrtgpcytkma
msefrnggsclggtrcvcraGYKGDNCGEAECKEPCLNGGRCIGPDKCACLYGYAGrrceadyrtgpcytkma
MSEFRNGGSCLGGTRCVCRAGYKGDNCGEAECKEPCLNGGRCIGPDKCACLYGYAGRRCEADYRTGPCYTKMA
********SCLGGTRCVCRAGYKGDNCGEAECKEPCLNGGRCIGPDKCACLYGYAGRRCEADYRTGPCY****
MSEFRNGGSCLGGTRCVCRAGYKGDNCGEAECKEPCLNGGRCIGPDKCACLYGYAGRRCEADYRTGPCYT***
*********CLGGTRCVCRAGYKGDNCGEAECKEPCLNGGRCIGPDKCACLYGYAGRRCEADYRTGPCYTKMA
*SEFRNGGSCLGGTRCVCRAGYKGDNCGEAECKEPCLNGGRCIGPDKCACLYGYAGRRCEADYRTGPCYTKMA
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooo
iiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEFRNGGSCLGGTRCVCRAGYKGDNCGEAECKEPCLNGGRCIGPDKCACLYGYAGRRCEADYRTGPCYTKMA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query73 2.2.26 [Sep-21-2011]
P98133 2871 Fibrillin-1 OS=Bos taurus yes N/A 0.917 0.023 0.544 4e-15
P35555 2871 Fibrillin-1 OS=Homo sapie yes N/A 0.917 0.023 0.544 4e-15
Q9TV36 2871 Fibrillin-1 OS=Sus scrofa yes N/A 0.917 0.023 0.544 5e-15
Q61554 2871 Fibrillin-1 OS=Mus muscul yes N/A 0.917 0.023 0.544 5e-15
Q61555 2907 Fibrillin-2 OS=Mus muscul no N/A 0.904 0.022 0.552 2e-14
P35556 2912 Fibrillin-2 OS=Homo sapie no N/A 0.904 0.022 0.552 2e-14
Q75N90 2809 Fibrillin-3 OS=Homo sapie no N/A 0.904 0.023 0.552 2e-14
P0C6B83564 Sushi, von Willebrand fac no N/A 0.671 0.013 0.459 7e-10
Q4LDE53571 Sushi, von Willebrand fac no N/A 0.712 0.014 0.442 2e-09
A2AVA03567 Sushi, von Willebrand fac no N/A 0.671 0.013 0.442 5e-09
>sp|P98133|FBN1_BOVIN Fibrillin-1 OS=Bos taurus GN=FBN1 PE=1 SV=1 Back     alignment and function desciption
 Score = 79.7 bits (195), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (73%), Gaps = 1/68 (1%)

Query: 6   NGGSCLGGTRCVCRAGYKGDNCGEAECKEPCLNGGRCIGPDKCACLYGYAGRRCEADYRT 65
           NGGSC     C+C+ GY G +CG+  C+  CLNGGRC+ P++CAC YG+ G +CE DYRT
Sbjct: 125 NGGSC-SDDHCLCQKGYIGTHCGQPVCESGCLNGGRCVAPNRCACTYGFTGPQCERDYRT 183

Query: 66  GPCYTKMA 73
           GPC+T ++
Sbjct: 184 GPCFTVIS 191
Fibrillins are structural components of 10-12 nm extracellular calcium-binding microfibrils, which occur either in association with elastin or in elastin-free bundles. Fibrillin-1-containing microfibrils provide long-term force bearing structural support. Regulates osteoblast maturation by controlling TGF-beta bioavailability and calibrating TGF-beta and BMP levels, respectively.
Bos taurus (taxid: 9913)
>sp|P35555|FBN1_HUMAN Fibrillin-1 OS=Homo sapiens GN=FBN1 PE=1 SV=3 Back     alignment and function description
>sp|Q9TV36|FBN1_PIG Fibrillin-1 OS=Sus scrofa GN=FBN1 PE=2 SV=1 Back     alignment and function description
>sp|Q61554|FBN1_MOUSE Fibrillin-1 OS=Mus musculus GN=Fbn1 PE=1 SV=1 Back     alignment and function description
>sp|Q61555|FBN2_MOUSE Fibrillin-2 OS=Mus musculus GN=Fbn2 PE=1 SV=2 Back     alignment and function description
>sp|P35556|FBN2_HUMAN Fibrillin-2 OS=Homo sapiens GN=FBN2 PE=1 SV=3 Back     alignment and function description
>sp|Q75N90|FBN3_HUMAN Fibrillin-3 OS=Homo sapiens GN=FBN3 PE=2 SV=3 Back     alignment and function description
>sp|P0C6B8|SVEP1_RAT Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Rattus norvegicus GN=Svep1 PE=1 SV=1 Back     alignment and function description
>sp|Q4LDE5|SVEP1_HUMAN Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Homo sapiens GN=SVEP1 PE=1 SV=3 Back     alignment and function description
>sp|A2AVA0|SVEP1_MOUSE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Mus musculus GN=Svep1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query73
321472519 2762 hypothetical protein DAPPUDRAFT_315775 [ 0.917 0.024 0.691 5e-20
328715164 3100 PREDICTED: fibrillin-2-like [Acyrthosiph 0.904 0.021 0.701 5e-19
383864528 2865 PREDICTED: fibrillin-2-like [Megachile r 0.876 0.022 0.707 9e-19
307166306 2876 Fibrillin-2 [Camponotus floridanus] 0.876 0.022 0.692 2e-18
328787226 2870 PREDICTED: fibrillin-2-like [Apis mellif 0.876 0.022 0.692 2e-18
380016550 2868 PREDICTED: fibrillin-2-like [Apis florea 0.876 0.022 0.692 2e-18
332018680 2757 Fibrillin-2 [Acromyrmex echinatior] 0.876 0.023 0.692 2e-18
340721645 2865 PREDICTED: fibrillin-2-like [Bombus terr 0.876 0.022 0.692 4e-18
350416792 2865 PREDICTED: fibrillin-2-like [Bombus impa 0.876 0.022 0.692 4e-18
242016322 2816 Fibrillin-2 precursor, putative [Pedicul 0.904 0.023 0.671 1e-17
>gi|321472519|gb|EFX83489.1| hypothetical protein DAPPUDRAFT_315775 [Daphnia pulex] Back     alignment and taxonomy information
 Score =  101 bits (252), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 58/68 (85%), Gaps = 1/68 (1%)

Query: 5  RNGGSCLGGTRCVCRAGYKGDNCGEAECKEPCLNGGRCIGPDKCACLYGYAGRRCEADYR 64
          +NGGSC+G  +CVCR G+ G+ C +  C EPCLNGGRCIGPD+CAC+YG+ GRRCEADYR
Sbjct: 27 QNGGSCIG-KKCVCRPGFSGEACEDGVCTEPCLNGGRCIGPDRCACVYGFTGRRCEADYR 85

Query: 65 TGPCYTKM 72
          TGPC+TK+
Sbjct: 86 TGPCFTKI 93

Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328715164|ref|XP_001945971.2| PREDICTED: fibrillin-2-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|383864528|ref|XP_003707730.1| PREDICTED: fibrillin-2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307166306|gb|EFN60488.1| Fibrillin-2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|328787226|ref|XP_003250904.1| PREDICTED: fibrillin-2-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380016550|ref|XP_003692245.1| PREDICTED: fibrillin-2-like [Apis florea] Back     alignment and taxonomy information
>gi|332018680|gb|EGI59252.1| Fibrillin-2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|340721645|ref|XP_003399227.1| PREDICTED: fibrillin-2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350416792|ref|XP_003491105.1| PREDICTED: fibrillin-2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|242016322|ref|XP_002428778.1| Fibrillin-2 precursor, putative [Pediculus humanus corporis] gi|212513463|gb|EEB16040.1| Fibrillin-2 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query73
UNIPROTKB|F6U495 302 FBN1 "Fibrillin-1" [Homo sapie 0.876 0.211 0.569 1.3e-20
UNIPROTKB|E9PHW4 341 FBN2 "Fibrillin-2" [Homo sapie 0.904 0.193 0.552 3.5e-20
UNIPROTKB|F1NII7 2822 FBN1 "Uncharacterized protein" 0.876 0.022 0.569 6e-19
UNIPROTKB|F1NJQ9 2838 FBN1 "Uncharacterized protein" 0.876 0.022 0.569 6e-19
UNIPROTKB|F1N4K8 2871 FBN1 "Fibrillin-1" [Bos taurus 0.876 0.022 0.569 1e-18
UNIPROTKB|P98133 2871 FBN1 "Fibrillin-1" [Bos taurus 0.876 0.022 0.569 1e-18
UNIPROTKB|F1PIA3 2871 FBN1 "Uncharacterized protein" 0.876 0.022 0.569 1e-18
UNIPROTKB|P35555 2871 FBN1 "Fibrillin-1" [Homo sapie 0.876 0.022 0.569 1e-18
UNIPROTKB|Q9TV36 2871 FBN1 "Fibrillin-1" [Sus scrofa 0.876 0.022 0.569 1e-18
MGI|MGI:95489 2871 Fbn1 "fibrillin 1" [Mus muscul 0.876 0.022 0.569 1e-18
UNIPROTKB|F6U495 FBN1 "Fibrillin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 243 (90.6 bits), Expect = 1.3e-20, P = 1.3e-20
 Identities = 37/65 (56%), Positives = 48/65 (73%)

Query:     6 NGGSCLGGTRCVCRAGYKGDNCGEAECKEPCLNGGRCIGPDKCACLYGYAGRRCEADYRT 65
             NGGSC     C+C+ GY G +CG+  C+  CLNGGRC+ P++CAC YG+ G +CE DYRT
Sbjct:   125 NGGSC-SDDHCLCQKGYIGTHCGQPVCESGCLNGGRCVAPNRCACTYGFTGPQCERDYRT 183

Query:    66 GPCYT 70
             GPC+T
Sbjct:   184 GPCFT 188
GO:0005201 "extracellular matrix structural constituent" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
GO:0005578 "proteinaceous extracellular matrix" evidence=IEA
UNIPROTKB|E9PHW4 FBN2 "Fibrillin-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NII7 FBN1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJQ9 FBN1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1N4K8 FBN1 "Fibrillin-1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P98133 FBN1 "Fibrillin-1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PIA3 FBN1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P35555 FBN1 "Fibrillin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9TV36 FBN1 "Fibrillin-1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:95489 Fbn1 "fibrillin 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P98133FBN1_BOVINNo assigned EC number0.54410.91780.0233yesN/A
P35555FBN1_HUMANNo assigned EC number0.54410.91780.0233yesN/A
Q9TV36FBN1_PIGNo assigned EC number0.54410.91780.0233yesN/A
Q61554FBN1_MOUSENo assigned EC number0.54410.91780.0233yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 73
KOG1219|consensus 4289 99.28
KOG4289|consensus 2531 98.9
KOG1225|consensus 525 98.86
KOG1219|consensus 4289 98.65
KOG1225|consensus 525 98.65
PF0000832 EGF: EGF-like domain This is a sub-family of the P 97.92
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 97.84
KOG1226|consensus 783 97.83
KOG1226|consensus 783 97.79
KOG4289|consensus 2531 97.66
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 97.38
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 97.38
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.14
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 96.96
cd0005336 EGF Epidermal growth factor domain, found in epide 96.94
smart0005163 DSL delta serrate ligand. 96.86
KOG1214|consensus 1289 96.62
smart0018135 EGF Epidermal growth factor-like domain. 96.4
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 94.21
PHA02887126 EGF-like protein; Provisional 92.76
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 92.44
KOG1217|consensus 487 91.34
PHA03099139 epidermal growth factor-like protein (EGF-like pro 91.13
KOG4260|consensus 350 90.9
PF1266224 cEGF: Complement Clr-like EGF-like 90.68
KOG3514|consensus 1591 88.41
PF0141463 DSL: Delta serrate ligand; InterPro: IPR001774 Lig 87.5
KOG1217|consensus 487 86.0
PF12955103 DUF3844: Domain of unknown function (DUF3844); Int 85.74
KOG3516|consensus 1306 85.01
PF0005349 Laminin_EGF: Laminin EGF-like (Domains III and V); 82.78
KOG3516|consensus 1306 80.38
>KOG1219|consensus Back     alignment and domain information 
Probab=99.28  E-value=1.1e-11  Score=83.71  Aligned_cols=72  Identities=39%  Similarity=0.947  Sum_probs=62.0

Q ss_pred             CCCCCCCCEecC----CCeEEcCCCCcCCCCCccc--c-CCCCCCCcEEe---CCCeeeeCCCCccCCCCcC----CCCC
Q psy11801          1 MSEFRNGGSCLG----GTRCVCRAGYKGDNCGEAE--C-KEPCLNGGRCI---GPDKCACLYGYAGRRCEAD----YRTG   66 (73)
Q Consensus         1 ~~~c~~~~~c~~----~~~c~c~~~~~g~~c~~~~--c-~~~c~~~g~c~---~~~~c~c~~g~~g~~c~~~----~~~~   66 (73)
                      .+||+++|+|..    +|.|.|++.|+|+.|+...  | ++||..+|+|.   ..+.|.|+.+|+|.+|+.+    ...+
T Consensus      3869 ~npCqhgG~C~~~~~ggy~CkCpsqysG~~CEi~~epC~snPC~~GgtCip~~n~f~CnC~~gyTG~~Ce~~Gi~eCs~n 3948 (4289)
T KOG1219|consen 3869 DNPCQHGGTCISQPKGGYKCKCPSQYSGNHCEIDLEPCASNPCLTGGTCIPFYNGFLCNCPNGYTGKRCEARGISECSKN 3948 (4289)
T ss_pred             cCcccCCCEecCCCCCceEEeCcccccCcccccccccccCCCCCCCCEEEecCCCeeEeCCCCccCceeecccccccccc
Confidence            378999999986    3899999999999998643  6 58999999998   3478999999999999987    3678


Q ss_pred             CCCCCC
Q psy11801         67 PCYTKM   72 (73)
Q Consensus        67 ~C~~g~   72 (73)
                      +|.+|+
T Consensus      3949 ~C~~gg 3954 (4289)
T KOG1219|consen 3949 VCGTGG 3954 (4289)
T ss_pred             cccCCc
Confidence            998886

>KOG4289|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>PHA02887 EGF-like protein; Provisional Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>KOG3514|consensus Back     alignment and domain information
>PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>PF12955 DUF3844: Domain of unknown function (DUF3844); InterPro: IPR024382 This presumed domain is found in fungal species Back     alignment and domain information
>KOG3516|consensus Back     alignment and domain information
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation Back     alignment and domain information
>KOG3516|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query73
3ho4_A481 Crystal Structure Of Hedgehog-Interacting Protein ( 2e-08
2ygq_A324 Wif Domain-Epidermal Growth Factor (Egf)-Like Domai 2e-08
2wg3_C463 Crystal Structure Of The Complex Between Human Hedg 9e-06
2wg4_B457 Crystal Structure Of The Complex Between Human Hedg 9e-06
2wft_A458 Crystal Structure Of The Human Hip Ectodomain Lengt 9e-06
3ho3_A481 Crystal Structure Of Hedgehog-interacting Protein ( 1e-05
2vj3_A135 Human Notch-1 Egfs 11-13 Length = 135 6e-04
>pdb|3HO4|A Chain A, Crystal Structure Of Hedgehog-Interacting Protein (Hhip) Length = 481 Back     alignment and structure 
Iteration: 1

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 32/53 (60%)
Query: 8   GSCLGGTRCVCRAGYKGDNCGEAECKEPCLNGGRCIGPDKCACLYGYAGRRCE 60
           G C    +C C  G++GD C  A+C+  C +GG C+ P+KC C  GY G +CE
Sbjct: 423 GYCTPTGKCCCSPGWEGDFCRTAKCEPACRHGGVCVRPNKCLCKKGYLGPQCE 475
>pdb|2YGQ|A Chain A, Wif Domain-Epidermal Growth Factor (Egf)-Like Domains 1-3 Of Human Wnt Inhibitory Factor 1 In Complex With 1,2-Dipalmitoylphosphatidylcholine Length = 324 Back     alignment and structure
>pdb|2WG3|C Chain C, Crystal Structure Of The Complex Between Human Hedgehog- Interacting Protein Hip And Desert Hedgehog Without Calcium Length = 463 Back     alignment and structure
>pdb|2WFT|A Chain A, Crystal Structure Of The Human Hip Ectodomain Length = 458 Back     alignment and structure
>pdb|3HO3|A Chain A, Crystal Structure Of Hedgehog-interacting Protein (hhip) Length = 481 Back     alignment and structure
>pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query73
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 4e-12
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 6e-12
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 7e-12
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 3e-11
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 8e-11
2ygq_A 324 WIF-1, WNT inhibitory factor 1; signaling protein, 9e-10
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 4e-07
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 7e-07
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 6e-06
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 1e-05
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 8e-07
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 8e-07
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 9e-07
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 8e-06
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 1e-04
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 7e-05
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 1e-04
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 3e-04
3fcs_B 690 Integrin beta-3; beta propeller, rossmann fold, EG 6e-04
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 7e-04
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Length = 463 Back     alignment and structure
 Score = 58.4 bits (141), Expect = 4e-12
 Identities = 23/53 (43%), Positives = 32/53 (60%)

Query: 8   GSCLGGTRCVCRAGYKGDNCGEAECKEPCLNGGRCIGPDKCACLYGYAGRRCE 60
           G C    +C C  G++GD C  A+C+  C +GG C+ P+KC C  GY G +CE
Sbjct: 402 GYCTPTGKCCCSPGWEGDFCRTAKCEPACRHGGVCVRPNKCLCKKGYLGPQCE 454
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Length = 188 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query73
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.43
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.34
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.33
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.3
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.11
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.03
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 98.95
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 98.94
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 98.82
2bou_A143 EGF-like module containing mucin-like hormone rece 98.82
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 98.82
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 98.8
1aut_L114 Activated protein C; serine proteinase, plasma cal 98.77
2gy5_A 423 Angiopoietin-1 receptor; ligand-binding domain, tr 98.77
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 98.74
3fcs_B 690 Integrin beta-3; beta propeller, rossmann fold, EG 98.69
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 98.68
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 98.68
2vh0_B134 Activated factor XA light chain; serine protease, 98.66
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 98.65
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 98.51
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 98.46
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 98.45
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.45
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 98.44
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 98.43
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 98.39
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 98.36
3k6s_B 687 Integrin beta-2; cell receptor, adhesion molecule, 98.36
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 98.36
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.32
1a3p_A45 Epidermal growth factor; disulfide connectivities, 98.29
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.29
2bou_A143 EGF-like module containing mucin-like hormone rece 98.28
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 98.28
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 98.21
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 98.18
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 98.16
4fbr_A 267 Lectin, myxobacterial hemagglutinin; beta-barrel, 98.16
1nql_B53 Epidermal growth factor; cell surface receptor, ty 98.15
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 98.12
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 98.08
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 98.08
1a3p_A45 Epidermal growth factor; disulfide connectivities, 98.07
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 97.99
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 97.95
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 97.92
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 97.88
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 97.86
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 97.84
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 97.81
2k2s_B61 Micronemal protein 6; microneme protein complex, c 97.8
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 97.7
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 97.68
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 97.68
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 97.66
1nql_B53 Epidermal growth factor; cell surface receptor, ty 97.63
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 97.61
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 97.44
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 97.25
2k2s_B61 Micronemal protein 6; microneme protein complex, c 97.18
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 97.07
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 96.96
1aut_L114 Activated protein C; serine proteinase, plasma cal 96.89
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 96.89
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 96.88
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 96.87
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 96.77
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 96.7
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 96.69
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 96.67
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 96.59
2e26_A 725 Reelin, reeler protein; signaling protein; HET: NA 96.58
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 96.53
2i9a_A145 Urokinase-type plasminogen activator; growth facto 96.29
3v65_B 386 Low-density lipoprotein receptor-related protein; 96.23
1nfu_B 195 Coagulation factor XA, light chain; hydrolase; HET 96.18
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 96.08
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 96.04
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 96.02
2i9a_A145 Urokinase-type plasminogen activator; growth facto 96.0
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 95.95
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 95.83
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 95.81
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 95.8
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 95.75
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 95.75
2vh0_B134 Activated factor XA light chain; serine protease, 95.56
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 95.46
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 95.45
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 95.39
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 95.27
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 95.16
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 95.02
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 94.87
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 94.14
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 93.98
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 93.34
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 93.33
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 93.01
2e26_A 725 Reelin, reeler protein; signaling protein; HET: NA 92.95
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 92.04
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 91.26
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 88.42
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 86.21
2ddu_A 387 Reelin; beta-jelly-roll, signaling protein; 2.05A 86.02
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 84.31
3t3p_B472 Integrin beta-3; integrin, cell adhesion, blood cl 82.74
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
Probab=99.43  E-value=8e-13  Score=75.53  Aligned_cols=71  Identities=34%  Similarity=0.863  Sum_probs=54.1

Q ss_pred             CCCCCCCEecCCCeEEcCCCCcCCCCCccccCCCCCCCcEEeCCCeeeeCCCCccCCCCcCCCCCCCCCCC
Q psy11801          2 SEFRNGGSCLGGTRCVCRAGYKGDNCGEAECKEPCLNGGRCIGPDKCACLYGYAGRRCEADYRTGPCYTKM   72 (73)
Q Consensus         2 ~~c~~~~~c~~~~~c~c~~~~~g~~c~~~~c~~~c~~~g~c~~~~~c~c~~g~~g~~c~~~~~~~~C~~g~   72 (73)
                      ++|.++|+|...+.|.|+++|+|..|+...|..+|.++++|...+.|.|.+||.|..|+.+....+|.+++
T Consensus       153 ~~C~~~G~C~~~~~C~C~~G~~G~~C~~~~C~~~C~~~G~C~~~~~C~C~~G~~G~~C~~~~C~~~C~~~G  223 (324)
T 2ygq_A          153 GGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGG  223 (324)
T ss_dssp             SCCCSSCEECTTSCEECCTTEESSSSCEESSSSCCCTTCEECSSCCEECCTTCBTTTTCBCCCSSCCCSSC
T ss_pred             CCCCCCCEECCCCeEECCCCCcCCCCCCCCCCCCCCCCCEEcCCCEEeCCCCccCCCcccCcCCCCCCCCC
Confidence            46788888877678888888888888776676678778888755678888888888887766666676543
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2ddu_A Reelin; beta-jelly-roll, signaling protein; 2.05A {Mus musculus} Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>3t3p_B Integrin beta-3; integrin, cell adhesion, blood clotting, fibrinogen, platele; HET: NAG BMA MAN; 2.20A {Homo sapiens} PDB: 3t3m_B* 3nig_B* 3nif_B* 3nid_B* 2vdr_B* 2vc2_B* 2vdk_B* 2vdm_B* 2vdn_B* 2vdl_B* 2vdp_B* 2vdq_B* 2vdo_B* 3fcu_B* 1txv_B* 1ty3_B* 1ty5_B* 1ty6_B* 1ty7_B* 1tye_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query73
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.77
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 98.76
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.75
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.74
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.73
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.68
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.62
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.57
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 98.57
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.51
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 98.43
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.38
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.38
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 98.34
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 98.32
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.31
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.26
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.25
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.23
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.18
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 98.17
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 98.1
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.03
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 98.01
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 97.98
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 97.77
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 97.77
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 97.76
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 97.6
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 97.58
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 97.47
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 97.1
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 96.78
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 96.67
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 96.61
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 96.58
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 96.54
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 96.39
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 96.25
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 96.1
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 95.05
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 93.53
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 91.45
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 90.23
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 90.2
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 89.65
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 84.31
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 83.9
d1i0ua241 Low density lipoprotein (LDL) receptor, different 82.75
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 80.82
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Factor X, N-terminal module
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.77  E-value=3e-09  Score=42.42  Aligned_cols=29  Identities=34%  Similarity=0.809  Sum_probs=21.0

Q ss_pred             CCCCCCCCEecC---CCeEEcCCCCcCCCCCc
Q psy11801          1 MSEFRNGGSCLG---GTRCVCRAGYKGDNCGE   29 (73)
Q Consensus         1 ~~~c~~~~~c~~---~~~c~c~~~~~g~~c~~   29 (73)
                      ++||.++++|++   .|.|.|+++|+|..|+.
T Consensus         5 ~~PC~ngg~C~~~~~~y~C~C~~G~~G~~Cei   36 (39)
T d1xkba1           5 TSPCQNQGKCKDGLGEYTCTCLEGFEGKNCEL   36 (39)
T ss_dssp             TCCCCSSCEECCCSSSCCEECCTTEETTTTCE
T ss_pred             CCCCCCCcEEECCCCCEEEECCCCCCcCcCeE
Confidence            467778888776   37777777777777763
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure