Psyllid ID: psy11818

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-
EILAENNVNFGLVLRLENDLFKFYLAKHSGRQLTLQPQMGSADLNAVFFGPRREEVHIFSIYPLRFYLAKHSGRQLTLQPQMGSADLNAVFFGPRREEGEGKDGASSSTSPPAPRKHIIQVSTYQMCVLLLFNNREKLTYEEIQSETDIPERDLIRALQSLAMGKASQRILIRYPKTKEIEPNHVFFVNDSFTSKLHRVKIQTVAAKGESEPERRETRSKVDEDRKHEIEAAVVRIMKARKRMQHNTLITEVTEQLKSRFLPSPVIIKKRIESLIEREYLARTPEDRFLQEKDVFERYYKQHLAKRLLLDKSVSDDSEKNMISKLKVRNLP
cccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHcccccccccccccEEEEcccccEEEEEEEEcccccccccccccccccccccccccEEEEEcHHHHHHHHcccccccccHHHHHHHccccHHHHHHHHHHHHccccccEEEEccccccccccccEEEEcccccccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccc
cHHHHHHHcHHHHHHHHHHHHHcccccccccccEEccccccccccccccccccHHHHHHHHHHHHHHHHcccccEEEEEcccccEEEEEEEcccccccccccccccccccccccccEEEEEHHHHHHHHHHHcccccccHHHHHHHccccHHHHHHHHHHHHHccccEEEEEEcccccccccccEEEEEccccccEEEEEEcEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccHccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccc
eilaennvNFGLVLRLENDLFKFYLAkhsgrqltlqpqmgsadlnavffgprreevhifsiyPLRFYLAkhsgrqltlqpqmgsadlnavffgprreegegkdgassstsppaprkhiiQVSTYQMCVLLLFNnrekltyeeiqsetdipERDLIRALQSLAMGKASQRILIrypktkeiepnhvffvndsftskLHRVKIQTVaakgeseperretrskvDEDRKHEIEAAVVRIMKARKRMQHNTLITEVTEQLksrflpspVIIKKRIESLIEREylartpedrflqEKDVFERYYKQHLAKRLLldksvsddsekNMISKLKVRNLP
eilaennvnfgLVLRLENDLFKFYLAKHSGRQLTLQPQMGSADLNAVFFGPRREEVHIFSIYPLRFYLAKHSGRQLTLQPQMGSADLNAVFFGPRREEGEgkdgassstsppaprkhiIQVSTYQMCVLLLFNNREKLTYeeiqsetdiperDLIRALQSLAMGKASQRILIRYpktkeiepnHVFFVNDSFTSKLHRVKIQtvaakgeseperretrskvdedrkheIEAAVVRIMKARKRMQHNTLitevteqlksrflpspvIIKKRIESLiereylartpedrflqekDVFERYYKQHLAKrllldksvsddseknmisklkvrnlp
EILAENNVNFGLVLRLENDLFKFYLAKHSGRQLTLQPQMGSADLNAVFFGPRREEVHIFSIYPLRFYLAKHSGRQLTLQPQMGSADLNAVFFGPRREEGEGKDGASSSTSPPAPRKHIIQVSTYQMCVLLLFNNREKLTYEEIQSETDIPERDLIRALQSLAMGKASQRILIRYPKTKEIEPNHVFFVNDSFTSKLHRVKIQTVAAKGESEPERRETRSKVDEDRKHEIEAAVVRIMKARKRMQHNTLITEVTEQLKSRFLPSPVIIKKRIESLIEREYLARTPEDRFLQEKDVFERYYKQHLAKRLLLDKSVSDDSEKNMISKLKVRNLP
*****NNVNFGLVLRLENDLFKFYLAKHSGRQLTLQPQMGSADLNAVFFGPRREEVHIFSIYPLRFYLAKHSGRQLTL********LNAVFF************************HIIQVSTYQMCVLLLFNNREKLTYEEIQSETDIPERDLIRALQSLAMGKASQRILIRYPKTKEIEPNHVFFVNDSFTSKLHRVKIQT***************************AAVVRIMKARKRMQHNTLITEVTEQLKSRFLPSPVIIKKRIESLIEREYLARTPEDRFLQEKDVFERYYKQHLAKRLLL**********************
*ILAENNVNFGLVLRLENDLFKFYLAKHSGRQLTLQPQMGSADLNAVFFGPRREEVHIFSIYPLRFYLAKHSGRQLTLQPQMGSADLNAVFFGPRREEGEGKDGASSSTSPPAPRKHIIQVSTYQMCVLLLFNNREKLTYEEIQSETDIPERDLIRALQSLAMGKASQRILIRYPKTKEIEPNHVFFVNDSFTSKLHRVKIQ******************VDEDRKHEIEAAVVRIMKARKRMQHNTLITEVTEQLKSRFLPSPVIIKKRIESLIEREYLARTPEDRFLQEKDVFERYYKQHLAKRLLLDKSVSDDSEKNMISKLKVRNL*
EILAENNVNFGLVLRLENDLFKFYLAKHSGRQLTLQPQMGSADLNAVFFGPRREEVHIFSIYPLRFYLAKHSGRQLTLQPQMGSADLNAVFFGPRR*****************PRKHIIQVSTYQMCVLLLFNNREKLTYEEIQSETDIPERDLIRALQSLAMGKASQRILIRYPKTKEIEPNHVFFVNDSFTSKLHRVKIQT*********************RKHEIEAAVVRIMKARKRMQHNTLITEVTEQLKSRFLPSPVIIKKRIESLIEREYLARTPEDRFLQEKDVFERYYKQHLAKRLLLDKSVSDDSEKNMISKLKVRNLP
EILAENNVNFGLVLRLENDLFKFYLAKHSGRQLTLQPQMGSADLNAVFFGPRREEVHIFSIYPLRFYLAKHSGRQLTLQPQMGSADLNAVFFGP*******************PRKHIIQVSTYQMCVLLLFNNREKLTYEEIQSETDIPERDLIRALQSLAMGKASQRILIRYPKTKEIEPNHVFFVNDSFTSKLHRVKIQTVAAKGESEPERRETRSKVDEDRKHEIEAAVVRIMKARKRMQHNTLITEVTEQLKSRFLPSPVIIKKRIESLIEREYLARTPEDRFLQEKDVFERYYKQHLAKRLLLDKSVSDDSEKNMISKLK*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
EILAENNVNFGLVLRLENDLFKFYLAKHSGRQLTLQPQMGSADLNAVFFGPRREEVHIFSIYPLRFYLAKHSGRQLTLQPQMGSADLNAVFFGPRREEGEGKDGASSSTSPPAPRKHIIQVSTYQMCVLLLFNNREKLTYEEIQSETDIPERDLIRALQSLAMGKASQRILIRYPKTKEIEPNHVFFVNDSFTSKLHRVKIQTVAAKGESEPERRETRSKVDEDRKHEIEAAVVRIMKARKRMQHNTLITEVTEQLKSRFLPSPVIIKKRIESLIEREYLARTPEDRFLQEKDVFERYYKQHLAKRLLLDKSVSDDSEKNMISKLKVRNLP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query331 2.2.26 [Sep-21-2011]
B5DF89768 Cullin-3 OS=Rattus norveg yes N/A 0.694 0.299 0.716 3e-94
Q9JLV5768 Cullin-3 OS=Mus musculus yes N/A 0.694 0.299 0.716 3e-94
Q13618768 Cullin-3 OS=Homo sapiens yes N/A 0.694 0.299 0.716 4e-94
A4IHP4768 Cullin-3 OS=Xenopus tropi yes N/A 0.694 0.299 0.716 5e-94
Q6DE95768 Cullin-3-A OS=Xenopus lae N/A N/A 0.694 0.299 0.712 1e-93
Q6GPF3768 Cullin-3-B OS=Xenopus lae N/A N/A 0.694 0.299 0.712 3e-93
Q17391777 Cullin-3 OS=Caenorhabditi yes N/A 0.670 0.285 0.528 4e-62
Q9ZVH4732 Cullin-3A OS=Arabidopsis yes N/A 0.613 0.277 0.504 2e-56
Q9C9L0732 Cullin-3B OS=Arabidopsis no N/A 0.613 0.277 0.504 7e-56
Q54NZ5769 Cullin-3 OS=Dictyostelium yes N/A 0.598 0.257 0.425 3e-45
>sp|B5DF89|CUL3_RAT Cullin-3 OS=Rattus norvegicus GN=Cul3 PE=1 SV=2 Back     alignment and function desciption
 Score =  345 bits (884), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 167/233 (71%), Positives = 196/233 (84%), Gaps = 3/233 (1%)

Query: 57  HIFSIYPLRFYLAKHSGRQLTLQPQMGSADLNAVFFGP-RREEGEGKDGASSSTSPPAPR 115
           H F I+  RFYLAKHSGRQLTLQ  MGSADLNA F+GP ++E+G       +  +    R
Sbjct: 530 HAFEIFR-RFYLAKHSGRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTR 588

Query: 116 KHIIQVSTYQMCVLLLFNNREKLTYEEIQSETDIPERDLIRALQSLAMGKASQRILIRYP 175
           KHI+QVST+QM +L+LFNNREK T+EEIQ ETDIPER+L+RALQSLA GK +QR+L + P
Sbjct: 589 KHILQVSTFQMTILMLFNNREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEP 648

Query: 176 KTKEIEPNHVFFVNDSFTSKLHRVKIQTVAAK-GESEPERRETRSKVDEDRKHEIEAAVV 234
           K+KEIE  H+F VND FTSKLHRVKIQTVAAK GES+PER+ETR KVD+DRKHEIEAA+V
Sbjct: 649 KSKEIESGHIFTVNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIV 708

Query: 235 RIMKARKRMQHNTLITEVTEQLKSRFLPSPVIIKKRIESLIEREYLARTPEDR 287
           RIMK+RK+MQHN L+ EVT+QLK+RFLPSPV+IKKRIE LIEREYLARTPEDR
Sbjct: 709 RIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDR 761
Core component of multiple cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. As a scaffold protein may contribute to catalysis through positioning of the substrate and the ubiquitin-conjugating enzyme. The E3 ubiquitin-protein ligase activity of the complex is dependent on the neddylation of the cullin subunit and is inhibited by the association of the deneddylated cullin subunit with TIP120A/CAND1 (By similarity). The functional specificity of the BCR complex depends on the BTB domain-containing protein as the susbstrate recognition component. BCR(SPOP) is involved in ubiquitination of BMI1/PCGF4, H2AFY and DAXX, and probably GLI2 or GLI3. BCR(KLHL9-KLHL13) controls the dynamic behavior of AURKB on mitotic chromosomes and thereby coordinates faithful mitotic progression and completion of cytokinesis. BCR(KLHL12) is involved in ER-Golgi transport by regulating the size of COPII coats, thereby playing a key role in collagen export, which is required for embryonic stem (ES) cells division: BCR(KLHL12) acts by mediating monoubiquitination of SEC31 (SEC31A or SEC31B). BCR(KLHL3) acts as a regulator of ion transport in the distal nephron; possibly by mediating ubiquitination of SLC12A3/NCC. Involved in ubiquitination of cyclin E and of cyclin D1 (in vitro) thus involved in regulation of G1/S transition.
Rattus norvegicus (taxid: 10116)
>sp|Q9JLV5|CUL3_MOUSE Cullin-3 OS=Mus musculus GN=Cul3 PE=1 SV=1 Back     alignment and function description
>sp|Q13618|CUL3_HUMAN Cullin-3 OS=Homo sapiens GN=CUL3 PE=1 SV=2 Back     alignment and function description
>sp|A4IHP4|CUL3_XENTR Cullin-3 OS=Xenopus tropicalis GN=cul3 PE=2 SV=1 Back     alignment and function description
>sp|Q6DE95|CUL3A_XENLA Cullin-3-A OS=Xenopus laevis GN=cul3a PE=1 SV=1 Back     alignment and function description
>sp|Q6GPF3|CUL3B_XENLA Cullin-3-B OS=Xenopus laevis GN=cul3b PE=1 SV=1 Back     alignment and function description
>sp|Q17391|CUL3_CAEEL Cullin-3 OS=Caenorhabditis elegans GN=cul-3 PE=1 SV=2 Back     alignment and function description
>sp|Q9ZVH4|CUL3A_ARATH Cullin-3A OS=Arabidopsis thaliana GN=CUL3A PE=1 SV=1 Back     alignment and function description
>sp|Q9C9L0|CUL3B_ARATH Cullin-3B OS=Arabidopsis thaliana GN=CUL3B PE=1 SV=1 Back     alignment and function description
>sp|Q54NZ5|CUL3_DICDI Cullin-3 OS=Dictyostelium discoideum GN=culC PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query331
91081955 771 PREDICTED: similar to cullin [Tribolium 0.670 0.287 0.837 1e-105
345495759 797 PREDICTED: cullin-3-like isoform 3 [Naso 0.673 0.279 0.786 1e-104
156543826 774 PREDICTED: cullin-3-like isoform 1 [Naso 0.673 0.288 0.786 1e-104
307188105 785 Cullin-3 [Camponotus floridanus] 0.673 0.284 0.773 1e-103
307200709 762 Cullin-3 [Harpegnathos saltator] 0.673 0.292 0.772 1e-102
332029851 799 Cullin-3 [Acromyrmex echinatior] 0.673 0.279 0.781 1e-101
322789963 798 hypothetical protein SINV_10433 [Solenop 0.673 0.279 0.752 1e-101
383849910 786 PREDICTED: cullin-3-A-like [Megachile ro 0.673 0.283 0.75 1e-101
350406796 793 PREDICTED: cullin-3-like [Bombus impatie 0.673 0.281 0.749 1e-101
340721258 793 PREDICTED: cullin-3-like [Bombus terrest 0.673 0.281 0.745 1e-101
>gi|91081955|ref|XP_967420.1| PREDICTED: similar to cullin [Tribolium castaneum] gi|270007361|gb|EFA03809.1| hypothetical protein TcasGA2_TC013922 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  388 bits (997), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 190/227 (83%), Positives = 208/227 (91%), Gaps = 5/227 (2%)

Query: 65  RFYLAKHSGRQLTLQPQMGSADLNAVFFGPRREEGEGKDGASSSTSP----PAPRKHIIQ 120
           RFYLAKHSGRQLTLQPQ+G+ADLNA+FFGP++E+ + KDGA SSTS       PRKHIIQ
Sbjct: 539 RFYLAKHSGRQLTLQPQLGNADLNAIFFGPKKEDPD-KDGACSSTSSISPRTGPRKHIIQ 597

Query: 121 VSTYQMCVLLLFNNREKLTYEEIQSETDIPERDLIRALQSLAMGKASQRILIRYPKTKEI 180
           VSTYQM VL+LFNN EKLTYEEI +E+DIPERDLIRALQSLAMGKA+QRILI+ P+TKEI
Sbjct: 598 VSTYQMVVLMLFNNHEKLTYEEILNESDIPERDLIRALQSLAMGKATQRILIKNPRTKEI 657

Query: 181 EPNHVFFVNDSFTSKLHRVKIQTVAAKGESEPERRETRSKVDEDRKHEIEAAVVRIMKAR 240
           E NH F+VNDSFTSKLHRVKIQTVAAKGESEPERRETR+KVDEDRKHEIEAA+VRIMK+R
Sbjct: 658 ESNHEFYVNDSFTSKLHRVKIQTVAAKGESEPERRETRNKVDEDRKHEIEAAIVRIMKSR 717

Query: 241 KRMQHNTLITEVTEQLKSRFLPSPVIIKKRIESLIEREYLARTPEDR 287
           KRM HN L+TEVTEQLKSRFLPSPVIIKKRIE LIEREYLARTPEDR
Sbjct: 718 KRMPHNILVTEVTEQLKSRFLPSPVIIKKRIEGLIEREYLARTPEDR 764

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|345495759|ref|XP_003427569.1| PREDICTED: cullin-3-like isoform 3 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|156543826|ref|XP_001606614.1| PREDICTED: cullin-3-like isoform 1 [Nasonia vitripennis] gi|345495757|ref|XP_003427568.1| PREDICTED: cullin-3-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307188105|gb|EFN72937.1| Cullin-3 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307200709|gb|EFN80806.1| Cullin-3 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332029851|gb|EGI69720.1| Cullin-3 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322789963|gb|EFZ15057.1| hypothetical protein SINV_10433 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|383849910|ref|XP_003700577.1| PREDICTED: cullin-3-A-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350406796|ref|XP_003487885.1| PREDICTED: cullin-3-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340721258|ref|XP_003399041.1| PREDICTED: cullin-3-like [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query331
MGI|MGI:1347360768 Cul3 "cullin 3" [Mus musculus 0.688 0.296 0.727 2.4e-87
RGD|1308190768 Cul3 "cullin 3" [Rattus norveg 0.688 0.296 0.727 2.4e-87
UNIPROTKB|E1BYQ3746 CUL3 "Uncharacterized protein" 0.688 0.305 0.727 3.1e-87
UNIPROTKB|E1BIN5768 CUL3 "Uncharacterized protein" 0.688 0.296 0.727 3.1e-87
UNIPROTKB|F1PU58750 CUL3 "Uncharacterized protein" 0.688 0.304 0.727 3.1e-87
UNIPROTKB|Q13618768 CUL3 "Cullin-3" [Homo sapiens 0.688 0.296 0.727 3.1e-87
UNIPROTKB|A4IHP4768 cul3 "Cullin-3" [Xenopus (Silu 0.688 0.296 0.727 3.9e-87
ZFIN|ZDB-GENE-030131-3376766 cul3a "cullin 3a" [Danio rerio 0.688 0.297 0.723 6.4e-87
ZFIN|ZDB-GENE-081007-1766 cul3b "cullin 3b" [Danio rerio 0.691 0.298 0.716 6.4e-87
UNIPROTKB|Q6DE95768 cul3a "Cullin-3-A" [Xenopus la 0.688 0.296 0.723 8.1e-87
MGI|MGI:1347360 Cul3 "cullin 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 854 (305.7 bits), Expect = 2.4e-87, Sum P(2) = 2.4e-87
 Identities = 171/235 (72%), Positives = 199/235 (84%)

Query:    57 HIFSIYPLRFYLAKHSGRQLTLQPQMGSADLNAVFFGP-RREEGE--GKDGASSSTSPPA 113
             H F I+  RFYLAKHSGRQLTLQ  MGSADLNA F+GP ++E+G   G  GA  + S   
Sbjct:   530 HAFEIFR-RFYLAKHSGRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNT- 587

Query:   114 PRKHIIQVSTYQMCVLLLFNNREKLTYEEIQSETDIPERDLIRALQSLAMGKASQRILIR 173
              RKHI+QVST+QM +L+LFNNREK T+EEIQ ETDIPER+L+RALQSLA GK +QR+L +
Sbjct:   588 -RKHILQVSTFQMTILMLFNNREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTK 646

Query:   174 YPKTKEIEPNHVFFVNDSFTSKLHRVKIQTVAAK-GESEPERRETRSKVDEDRKHEIEAA 232
              PK+KEIE  H+F VND FTSKLHRVKIQTVAAK GES+PER+ETR KVD+DRKHEIEAA
Sbjct:   647 EPKSKEIESGHIFTVNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAA 706

Query:   233 VVRIMKARKRMQHNTLITEVTEQLKSRFLPSPVIIKKRIESLIEREYLARTPEDR 287
             +VRIMK+RK+MQHN L+ EVT+QLK+RFLPSPV+IKKRIE LIEREYLARTPEDR
Sbjct:   707 IVRIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDR 761
GO:0000090 "mitotic anaphase" evidence=ISO
GO:0000209 "protein polyubiquitination" evidence=ISO
GO:0000902 "cell morphogenesis" evidence=IMP
GO:0000910 "cytokinesis" evidence=ISO
GO:0001701 "in utero embryonic development" evidence=IMP
GO:0001831 "trophectodermal cellular morphogenesis" evidence=IMP
GO:0005634 "nucleus" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0005827 "polar microtubule" evidence=ISO
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=IEA
GO:0006513 "protein monoubiquitination" evidence=ISO
GO:0006810 "transport" evidence=IEA
GO:0006888 "ER to Golgi vesicle-mediated transport" evidence=ISO
GO:0007229 "integrin-mediated signaling pathway" evidence=IMP
GO:0007369 "gastrulation" evidence=IMP
GO:0008054 "cyclin catabolic process" evidence=ISS
GO:0016055 "Wnt receptor signaling pathway" evidence=IDA
GO:0016192 "vesicle-mediated transport" evidence=IEA
GO:0016477 "cell migration" evidence=ISO
GO:0016567 "protein ubiquitination" evidence=ISO
GO:0017145 "stem cell division" evidence=IMP
GO:0030332 "cyclin binding" evidence=IPI
GO:0031208 "POZ domain binding" evidence=ISO
GO:0031461 "cullin-RING ubiquitin ligase complex" evidence=IEA
GO:0031463 "Cul3-RING ubiquitin ligase complex" evidence=ISO
GO:0031625 "ubiquitin protein ligase binding" evidence=IEA
GO:0032467 "positive regulation of cytokinesis" evidence=ISO
GO:0035024 "negative regulation of Rho protein signal transduction" evidence=ISO
GO:0040016 "embryonic cleavage" evidence=IMP
GO:0043149 "stress fiber assembly" evidence=ISO
GO:0043161 "proteasomal ubiquitin-dependent protein catabolic process" evidence=ISO
GO:0048208 "COPII vesicle coating" evidence=ISO
GO:0051322 "anaphase" evidence=ISO
RGD|1308190 Cul3 "cullin 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BYQ3 CUL3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BIN5 CUL3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PU58 CUL3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q13618 CUL3 "Cullin-3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A4IHP4 cul3 "Cullin-3" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-3376 cul3a "cullin 3a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-081007-1 cul3b "cullin 3b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q6DE95 cul3a "Cullin-3-A" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B5DF89CUL3_RATNo assigned EC number0.71670.69480.2994yesN/A
Q9ZVH4CUL3A_ARATHNo assigned EC number0.50440.61320.2773yesN/A
A4IHP4CUL3_XENTRNo assigned EC number0.71670.69480.2994yesN/A
Q17391CUL3_CAEELNo assigned EC number0.52830.67060.2857yesN/A
Q13618CUL3_HUMANNo assigned EC number0.71670.69480.2994yesN/A
Q9JLV5CUL3_MOUSENo assigned EC number0.71670.69480.2994yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query331
COG5647773 COG5647, COG5647, Cullin, a subunit of E3 ubiquiti 4e-47
pfam1055768 pfam10557, Cullin_Nedd8, Cullin protein neddylatio 1e-31
smart0088468 smart00884, Cullin_Nedd8, Cullin protein neddylati 5e-30
pfam00888603 pfam00888, Cullin, Cullin family 4e-27
smart00182143 smart00182, CULLIN, Cullin 5e-17
pfam00888 603 pfam00888, Cullin, Cullin family 4e-14
COG5647 773 COG5647, COG5647, Cullin, a subunit of E3 ubiquiti 6e-10
smart00182143 smart00182, CULLIN, Cullin 0.002
pfam00888603 pfam00888, Cullin, Cullin family 0.003
smart00182143 smart00182, CULLIN, Cullin 0.003
>gnl|CDD|227934 COG5647, COG5647, Cullin, a subunit of E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score =  169 bits (429), Expect = 4e-47
 Identities = 86/222 (38%), Positives = 128/222 (57%), Gaps = 23/222 (10%)

Query: 66  FYLAKHSGRQLTLQPQMGSADLNAVFFGPRREEGEGKDGASSSTSPPAPRKHIIQVSTYQ 125
           FY +KH+GR+L     +GS ++ A F   ++                     I   S YQ
Sbjct: 569 FYSSKHNGRKLKWYWHLGSGEVKARFNEGQKY------------------LEISTFSVYQ 610

Query: 126 MCVLLLFNNREKLTYEEIQSETDIPERDLIRALQSLAMGKASQRILIRYPKTKEIEPNHV 185
           + V LLFN+ E+LT+EEI   T +   DL R LQSL+  K    +++     K + PN  
Sbjct: 611 LLVFLLFNDHEELTFEEILELTKLSTDDLKRVLQSLSCAK----LVVLLKDDKLVSPNTK 666

Query: 186 FFVNDSFTSKLHRVKIQTVAAKGESEPERRETRSKVDEDRKHEIEAAVVRIMKARKRMQH 245
           F+VN++F+SKL R+KI  +A + E   +  +T   V+EDR+ E++A +VRIMKARK+++H
Sbjct: 667 FYVNENFSSKLERIKINYIA-ESECMQDNLDTHETVEEDRQAELQACIVRIMKARKKLKH 725

Query: 246 NTLITEVTEQLKSRFLPSPVIIKKRIESLIEREYLARTPEDR 287
             L+ EV  Q KSRF P   ++K+ IE+LIE+EYL R  +D 
Sbjct: 726 GDLVKEVIAQHKSRFEPKVSMVKRAIETLIEKEYLERQADDE 767

Length = 773
>gnl|CDD|204512 pfam10557, Cullin_Nedd8, Cullin protein neddylation domain Back     alignment and domain information
>gnl|CDD|214883 smart00884, Cullin_Nedd8, Cullin protein neddylation domain Back     alignment and domain information
>gnl|CDD|216175 pfam00888, Cullin, Cullin family Back     alignment and domain information
>gnl|CDD|214545 smart00182, CULLIN, Cullin Back     alignment and domain information
>gnl|CDD|216175 pfam00888, Cullin, Cullin family Back     alignment and domain information
>gnl|CDD|227934 COG5647, COG5647, Cullin, a subunit of E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214545 smart00182, CULLIN, Cullin Back     alignment and domain information
>gnl|CDD|216175 pfam00888, Cullin, Cullin family Back     alignment and domain information
>gnl|CDD|214545 smart00182, CULLIN, Cullin Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 331
KOG2166|consensus725 100.0
KOG2167|consensus661 100.0
COG5647773 Cullin, a subunit of E3 ubiquitin ligase [Posttran 100.0
KOG2284|consensus728 100.0
KOG2285|consensus777 99.97
PF00888588 Cullin: Cullin family; InterPro: IPR001373 Cullins 99.91
PF1055768 Cullin_Nedd8: Cullin protein neddylation domain; I 99.84
KOG2165|consensus765 99.6
smart00182142 CULLIN Cullin. 99.33
KOG2284|consensus 728 98.02
COG5647 773 Cullin, a subunit of E3 ubiquitin ligase [Posttran 97.89
KOG2166|consensus 725 97.71
KOG2167|consensus 661 97.44
PF00888 588 Cullin: Cullin family; InterPro: IPR001373 Cullins 95.83
PF0933952 HTH_IclR: IclR helix-turn-helix domain; InterPro: 95.54
TIGR0161095 phage_O_Nterm phage replication protein O, N-termi 95.33
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 95.06
KOG2285|consensus 777 94.76
PF0208283 Rrf2: Transcriptional regulator; InterPro: IPR0009 94.75
PF1280262 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP 94.6
PF0822057 HTH_DeoR: DeoR-like helix-turn-helix domain; Inter 94.19
PF1346368 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL 94.14
PF0104759 MarR: MarR family; InterPro: IPR000835 The MarR-ty 93.4
TIGR02337118 HpaR homoprotocatechuate degradation operon regula 92.83
smart0034691 HTH_ICLR helix_turn_helix isocitrate lyase regulat 92.54
PF1284061 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ 92.17
smart0055068 Zalpha Z-DNA-binding domain in adenosine deaminase 91.65
PRK15090257 DNA-binding transcriptional regulator KdgR; Provis 91.61
PRK11512144 DNA-binding transcriptional repressor MarR; Provis 91.53
PF1360180 HTH_34: Winged helix DNA-binding domain; PDB: 1UB9 91.5
PF0102247 HTH_5: Bacterial regulatory protein, arsR family; 91.07
smart00347101 HTH_MARR helix_turn_helix multiple antibiotic resi 90.5
smart0042053 HTH_DEOR helix_turn_helix, Deoxyribose operon repr 90.35
PF0827955 HTH_11: HTH domain; InterPro: IPR013196 Winged hel 90.13
PF0197868 TrmB: Sugar-specific transcriptional regulator Trm 90.02
PF04492100 Phage_rep_O: Bacteriophage replication protein O ; 90.01
TIGR01889109 Staph_reg_Sar staphylococcal accessory regulator f 89.4
PF05732165 RepL: Firmicute plasmid replication protein (RepL) 88.33
cd0009078 HTH_ARSR Arsenical Resistance Operon Repressor and 88.13
PRK10163271 DNA-binding transcriptional repressor AllR; Provis 87.83
PRK11569274 transcriptional repressor IclR; Provisional 87.32
COG3355126 Predicted transcriptional regulator [Transcription 87.28
COG1414246 IclR Transcriptional regulator [Transcription] 86.88
PRK10857164 DNA-binding transcriptional regulator IscR; Provis 86.63
PRK13777185 transcriptional regulator Hpr; Provisional 86.52
smart0041948 HTH_CRP helix_turn_helix, cAMP Regulatory protein. 86.26
TIGR02431248 pcaR_pcaU beta-ketoadipate pathway transcriptional 86.18
PRK09834263 DNA-binding transcriptional activator MhpR; Provis 86.08
PRK03573144 transcriptional regulator SlyA; Provisional 85.94
PHA00738108 putative HTH transcription regulator 85.28
PF0901269 FeoC: FeoC like transcriptional regulator; InterPr 85.2
PRK11920153 rirA iron-responsive transcriptional regulator; Re 85.19
TIGR02010135 IscR iron-sulfur cluster assembly transcription fa 84.61
PF1373055 HTH_36: Helix-turn-helix domain 84.21
smart0034560 HTH_GNTR helix_turn_helix gluconate operon transcr 84.16
PF08784102 RPA_C: Replication protein A C terminal; InterPro: 84.08
smart00344108 HTH_ASNC helix_turn_helix ASNC type. AsnC: an auto 83.86
TIGR01884203 cas_HTH CRISPR locus-related DNA-binding protein. 83.85
cd0009267 HTH_CRP helix_turn_helix, cAMP Regulatory protein 83.27
PF0828059 HTH_Mga: M protein trans-acting positive regulator 82.98
TIGR02698130 CopY_TcrY copper transport repressor, CopY/TcrY fa 82.79
PRK10870176 transcriptional repressor MprA; Provisional 82.61
TIGR00738132 rrf2_super rrf2 family protein (putative transcrip 82.42
smart0041866 HTH_ARSR helix_turn_helix, Arsenical Resistance Op 80.88
PF0558472 Sulfolobus_pRN: Sulfolobus plasmid regulatory prot 80.79
PRK04172 489 pheS phenylalanyl-tRNA synthetase subunit alpha; P 80.71
TIGR02944130 suf_reg_Xantho FeS assembly SUF system regulator, 80.25
>KOG2166|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.9e-49  Score=413.00  Aligned_cols=243  Identities=43%  Similarity=0.604  Sum_probs=217.7

Q ss_pred             HHhhHHHHHHHhhcCCCCcccc---cccCCCCCC-CCCCCCCHHHHHHHHhhhHhhhcccCCCCeEEeecCCceEEEEEE
Q psy11818         15 RLENDLFKFYLAKHSGRQLTLQ---PQMGSADLN-AVFFGPRREEVHIFSIYPLRFYLAKHSGRQLTLQPQMGSADLNAV   90 (331)
Q Consensus        15 ~~~~~~f~~~~~~~~~~~~~~~---~~~~swp~~-~~~~~lP~~L~~~~~~F~~~fY~~k~~~RkL~W~~~Lg~~~l~~~   90 (331)
                      +..+..|+++...+....++|.   +|.|+||.+ ..+|.+|++|..+++.| ..||..+|+||+|+|+|+||.|+|.++
T Consensus       476 ~~l~~~F~~~~~~~~~~~~df~v~VLt~g~WP~~~~~~~~LP~el~~~~e~F-~~~Y~~kh~gR~L~w~~~l~~~ei~~~  554 (725)
T KOG2166|consen  476 RELQTAFADYANYSANLGIDFTVTVLTTGFWPSYKSTDINLPSEMSDCVEMF-KGFYATKHNGRRLTWIYSLGTGEINGK  554 (725)
T ss_pred             HHHHHHHHhhhchhccCCCceeEEEeecCCcCCccCCCCCCChhHHHHHHHH-HHHHhhccCCCeeeeeeccCceEEEEE
Confidence            3456778877222233357775   589999986 46899999999999999 999999999999999999999999999


Q ss_pred             EcCCCcCCCCCCCCCCCCCCCCCCCcEEEEEchHHHHHHHHhcCCCCCCHHHHHHhcCCCHHHHHHHHHHHHcccCcccc
Q psy11818         91 FFGPRREEGEGKDGASSSTSPPAPRKHIIQVSTYQMCVLLLFNNREKLTYEEIQSETDIPERDLIRALQSLAMGKASQRI  170 (331)
Q Consensus        91 f~~~~k~~~~~~~~~~~~~~~~~~~~~~l~vs~~Qa~ILllFN~~~~lt~~eL~~~tgi~~~~l~~~L~sL~~~k~~~~I  170 (331)
                      |.                     +++|+|+|||+|||||++||+.+.+|+++|.++|+|+.+++.++|+||...|  +.+
T Consensus       555 ~~---------------------~~~~~l~vst~Qm~VLlLFN~~d~lt~~eI~~~t~i~~~~l~~~L~Sl~~~K--~~v  611 (725)
T KOG2166|consen  555 FD---------------------KKTVELQVSTYQMAVLLLFNNTEKLTYEEILEQTNLGHEDLARLLQSLSCLK--YKI  611 (725)
T ss_pred             ec---------------------CceEEEEEEhHHHHHHHHccchhhccHHHHHHHhCCCHHHHHHHHHHHHHHh--Hhh
Confidence            97                     3589999999999999999999999999999999999999999999997666  456


Q ss_pred             eeecCCCCCCCCCCeEEEecCCCCCceeEEEeccccCCCChhHHHHhhhhhHHhhhhhHHHHHHHhhhcccCCChHHHHH
Q psy11818        171 LIRYPKTKEIEPNHVFFVNDSFTSKLHRVKIQTVAAKGESEPERRETRSKVDEDRKHEIEAAVVRIMKARKRMQHNTLIT  250 (331)
Q Consensus       171 L~~~~~~~~i~~~~~f~lN~~F~~k~~ki~i~~~~~k~e~~~e~~~~~~~v~edR~~~IqAaIVRIMK~~K~l~~~~Li~  250 (331)
                      +.. |.+.. ++++.|.+|.+|+++..|++++.++++     |.+.+++.+++||++.|+||||||||+||.|.|.+|+.
T Consensus       612 ~~~-~~s~~-~~~~~~~~N~~f~sk~~Rv~i~~~~~~-----e~~~~~~~ve~dRk~~i~AaIVRIMK~rK~l~h~~Lv~  684 (725)
T KOG2166|consen  612 LLK-PMSRT-SPNDEFAFNSKFTSKMRRVKIPLPPMD-----ERKKVVEDVDKDRKYAIDAAIVRIMKSRKVLGHQQLVS  684 (725)
T ss_pred             ccC-ccccC-CCCcEEEeeccccCcceeeccCCCCch-----hHHHHHhhhhhHHHHHHHHHHHHHHHhhccccHHHHHH
Confidence            666 66666 889999999999999999999977554     67789999999999999999999999999999999999


Q ss_pred             HHHHHhccCCCCCHHHHHHHHHHHHHHHHHHhCCccccc
Q psy11818        251 EVTEQLKSRFLPSPVIIKKRIESLIEREYLARTPEDRFL  289 (331)
Q Consensus       251 ~V~~~l~~~F~ps~~~IKk~IE~LIereyI~Rd~~d~~i  289 (331)
                      +|.+|+++||.|++.+||+|||.||+||||+|| +|+++
T Consensus       685 Ev~~ql~~RF~p~v~~IKk~Ie~LIEkeYleR~-~~~~~  722 (725)
T KOG2166|consen  685 EVVEQLSERFKPDIKMIKKRIEDLIEREYLERD-ENPNI  722 (725)
T ss_pred             HHHHHHhhhcCCCHHHHHHHHHHHHHHHHHhcc-CCCCc
Confidence            999999999999999999999999999999999 87765

>KOG2167|consensus Back     alignment and domain information
>COG5647 Cullin, a subunit of E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2284|consensus Back     alignment and domain information
>KOG2285|consensus Back     alignment and domain information
>PF00888 Cullin: Cullin family; InterPro: IPR001373 Cullins are a family of hydrophobic proteins that act as scaffolds for ubiquitin ligases (E3) Back     alignment and domain information
>PF10557 Cullin_Nedd8: Cullin protein neddylation domain; InterPro: IPR019559 This is the neddylation site of cullin proteins, which are a family of structurally related proteins containing an evolutionarily conserved cullin domain Back     alignment and domain information
>KOG2165|consensus Back     alignment and domain information
>smart00182 CULLIN Cullin Back     alignment and domain information
>KOG2284|consensus Back     alignment and domain information
>COG5647 Cullin, a subunit of E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2166|consensus Back     alignment and domain information
>KOG2167|consensus Back     alignment and domain information
>PF00888 Cullin: Cullin family; InterPro: IPR001373 Cullins are a family of hydrophobic proteins that act as scaffolds for ubiquitin ligases (E3) Back     alignment and domain information
>PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>TIGR01610 phage_O_Nterm phage replication protein O, N-terminal domain Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>KOG2285|consensus Back     alignment and domain information
>PF02082 Rrf2: Transcriptional regulator; InterPro: IPR000944 The following uncharacterised bacterial proteins have been shown to be evolutionary related, Desulfovibrio vulgaris protein Rrf2; Escherichia coli hypothetical proteins yfhP and yjeB; Bacillus subtilis hypothetical proteins yhdE, yrzC and ywgB; Mycobacterium tuberculosis hypothetical protein Rv1287; and Synechocystis sp Back     alignment and domain information
>PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B Back     alignment and domain information
>PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism Back     alignment and domain information
>PF13463 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL_A 2YR2_B 3GFM_A 3GFJ_A 3GF2_A 3GEZ_A 2GXG_A 3GFI_A 2EB7_A Back     alignment and domain information
>PF01047 MarR: MarR family; InterPro: IPR000835 The MarR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 135 amino acids present in transcription regulators of the MarR/SlyA family, involved in the development of antibiotic resistance Back     alignment and domain information
>TIGR02337 HpaR homoprotocatechuate degradation operon regulator, HpaR Back     alignment and domain information
>smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation Back     alignment and domain information
>PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B Back     alignment and domain information
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases Back     alignment and domain information
>PRK15090 DNA-binding transcriptional regulator KdgR; Provisional Back     alignment and domain information
>PRK11512 DNA-binding transcriptional repressor MarR; Provisional Back     alignment and domain information
>PF13601 HTH_34: Winged helix DNA-binding domain; PDB: 1UB9_A Back     alignment and domain information
>PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities Back     alignment and domain information
>smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein Back     alignment and domain information
>smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor Back     alignment and domain information
>PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets Back     alignment and domain information
>PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis Back     alignment and domain information
>PF04492 Phage_rep_O: Bacteriophage replication protein O ; InterPro: IPR006497 This entry is represented by the N-terminal domain of Bacteriophage lambda, GpO Back     alignment and domain information
>TIGR01889 Staph_reg_Sar staphylococcal accessory regulator family Back     alignment and domain information
>PF05732 RepL: Firmicute plasmid replication protein (RepL); InterPro: IPR008813 This entry consists of proteins thought to be involved in plasmid replication Back     alignment and domain information
>cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors Back     alignment and domain information
>PRK10163 DNA-binding transcriptional repressor AllR; Provisional Back     alignment and domain information
>PRK11569 transcriptional repressor IclR; Provisional Back     alignment and domain information
>COG3355 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>COG1414 IclR Transcriptional regulator [Transcription] Back     alignment and domain information
>PRK10857 DNA-binding transcriptional regulator IscR; Provisional Back     alignment and domain information
>PRK13777 transcriptional regulator Hpr; Provisional Back     alignment and domain information
>smart00419 HTH_CRP helix_turn_helix, cAMP Regulatory protein Back     alignment and domain information
>TIGR02431 pcaR_pcaU beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family Back     alignment and domain information
>PRK09834 DNA-binding transcriptional activator MhpR; Provisional Back     alignment and domain information
>PRK03573 transcriptional regulator SlyA; Provisional Back     alignment and domain information
>PHA00738 putative HTH transcription regulator Back     alignment and domain information
>PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif Back     alignment and domain information
>PRK11920 rirA iron-responsive transcriptional regulator; Reviewed Back     alignment and domain information
>TIGR02010 IscR iron-sulfur cluster assembly transcription factor IscR Back     alignment and domain information
>PF13730 HTH_36: Helix-turn-helix domain Back     alignment and domain information
>smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor Back     alignment and domain information
>PF08784 RPA_C: Replication protein A C terminal; InterPro: IPR014892 This protein corresponds to the C-terminal of the single stranded DNA binding protein RPA (replication protein A) Back     alignment and domain information
>smart00344 HTH_ASNC helix_turn_helix ASNC type Back     alignment and domain information
>TIGR01884 cas_HTH CRISPR locus-related DNA-binding protein Back     alignment and domain information
>cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family Back     alignment and domain information
>PF08280 HTH_Mga: M protein trans-acting positive regulator (MGA) HTH domain; InterPro: IPR013199 Mga is a DNA-binding protein that activates the expression of several important virulence genes in group A streptococcus in response to changing environmental conditions [] Back     alignment and domain information
>TIGR02698 CopY_TcrY copper transport repressor, CopY/TcrY family Back     alignment and domain information
>PRK10870 transcriptional repressor MprA; Provisional Back     alignment and domain information
>TIGR00738 rrf2_super rrf2 family protein (putative transcriptional regulator) Back     alignment and domain information
>smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor Back     alignment and domain information
>PF05584 Sulfolobus_pRN: Sulfolobus plasmid regulatory protein; InterPro: IPR008848 This family consists of several plasmid regulatory proteins from the extreme thermophilic and acidophilic archaea Sulfolobus Back     alignment and domain information
>PRK04172 pheS phenylalanyl-tRNA synthetase subunit alpha; Provisional Back     alignment and domain information
>TIGR02944 suf_reg_Xantho FeS assembly SUF system regulator, gammaproteobacterial Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query331
4a0c_C741 Structure Of The Cand1-Cul4b-Rbx1 Complex Length = 5e-39
4a0c_C 741 Structure Of The Cand1-Cul4b-Rbx1 Complex Length = 2e-07
4a0l_E726 Structure Of Ddb1-Ddb2-Cul4b-Rbx1 Bound To A 12 Bp 5e-39
4a0l_E 726 Structure Of Ddb1-Ddb2-Cul4b-Rbx1 Bound To A 12 Bp 2e-07
4a0k_A742 Structure Of Ddb1-Ddb2-Cul4a-Rbx1 Bound To A 12 Bp 1e-37
4a0k_A 742 Structure Of Ddb1-Ddb2-Cul4a-Rbx1 Bound To A 12 Bp 1e-07
2hye_C759 Crystal Structure Of The Ddb1-cul4a-rbx1-sv5v Compl 2e-37
2hye_C 759 Crystal Structure Of The Ddb1-cul4a-rbx1-sv5v Compl 1e-07
1iuy_A92 Solution Structure Of The Cullin-3 Homologue Length 8e-35
1u6g_A776 Crystal Structure Of The Cand1-Cul1-Roc1 Complex Le 3e-23
1u6g_A 776 Crystal Structure Of The Cand1-Cul1-Roc1 Complex Le 2e-07
1ldk_B366 Structure Of The Cul1-Rbx1-Skp1-F Boxskp2 Scf Ubiqu 4e-23
1ldk_B 366 Structure Of The Cul1-Rbx1-Skp1-F Boxskp2 Scf Ubiqu 1e-06
1ldj_A760 Structure Of The Cul1-rbx1-skp1-f Boxskp2 Scf Ubiqu 4e-23
1ldj_A 760 Structure Of The Cul1-rbx1-skp1-f Boxskp2 Scf Ubiqu 2e-07
3rtr_A368 A Ring E3-Substrate Complex Poised For Ubiquitin-Li 4e-23
3rtr_A 368 A Ring E3-Substrate Complex Poised For Ubiquitin-Li 1e-05
3dpl_C382 Structural Insights Into Nedd8 Activation Of Cullin 3e-16
3dpl_C 382 Structural Insights Into Nedd8 Activation Of Cullin 2e-05
2do7_A101 Solution Structure Of The Winged Helix-Turn-Helix M 3e-13
3dqv_C382 Structural Insights Into Nedd8 Activation Of Cullin 6e-13
3dqv_C 382 Structural Insights Into Nedd8 Activation Of Cullin 3e-04
3tdu_C77 N-Terminal Acetylation Acts As An Avidity Enhancer 4e-12
3o6b_B76 A Dual E3 Mechanism For Rub1 Ligation To Cdc53: Dcn 2e-07
3o2p_E88 A Dual E3 Mechanism For Rub1 Ligation To Cdc53: Dcn 4e-07
4f52_A 282 Structure Of A Glomulin-Rbx1-Cul1 Complex Length = 1e-05
>pdb|4A0C|C Chain C, Structure Of The Cand1-Cul4b-Rbx1 Complex Length = 741 Back     alignment and structure 
Iteration: 1

 Score =  158 bits (399), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 95/221 (42%), Positives = 129/221 (58%), Gaps = 26/221 (11%)
Query: 66  FYLAKHSGRQLTLQPQMGSADLNAVFFGPRREEGEGKDGASSSTSPPAPRKHIIQVSTYQ 125
           FYL KHSGR+L  Q  +G   L A F   ++E                     +QVS +Q
Sbjct: 539 FYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKE---------------------LQVSLFQ 577
Query: 126 MCVLLLFNNREKLTYEEIQSETDIPERDLIRALQSLAMGKASQRILIRYPKTKEIEPNHV 185
             VLL+FN  E+ + EEI+  T I + +L R LQSLA GKA  R+L + PK K+IE    
Sbjct: 578 TLVLLMFNEGEEFSLEEIKQATGIEDGELRRTLQSLACGKA--RVLAKNPKGKDIEDGDK 635
Query: 186 FFVNDSFTSKLHRVKIQTVAAKGESEPERRETRSKVDEDRKHEIEAAVVRIMKARKRMQH 245
           F  ND F  KL R+KI  +  K E+  E+  T  +V +DR+++I+AA+VRIMK RK + H
Sbjct: 636 FICNDDFKHKLFRIKINQIQMK-ETVEEQASTTERVFQDRQYQIDAAIVRIMKMRKTLSH 694
Query: 246 NTLITEVTEQLKSRFLPSPVIIKKRIESLIEREYLARTPED 286
           N L++EV  QLK  F   P  +KKRIESLI+R+Y+ R  E+
Sbjct: 695 NLLVSEVYNQLK--FPVKPADLKKRIESLIDRDYMERDKEN 733
>pdb|4A0C|C Chain C, Structure Of The Cand1-Cul4b-Rbx1 Complex Length = 741 Back     alignment and structure
>pdb|4A0L|E Chain E, Structure Of Ddb1-Ddb2-Cul4b-Rbx1 Bound To A 12 Bp Abasic Site Containing Dna-Duplex Length = 726 Back     alignment and structure
>pdb|4A0L|E Chain E, Structure Of Ddb1-Ddb2-Cul4b-Rbx1 Bound To A 12 Bp Abasic Site Containing Dna-Duplex Length = 726 Back     alignment and structure
>pdb|4A0K|A Chain A, Structure Of Ddb1-Ddb2-Cul4a-Rbx1 Bound To A 12 Bp Abasic Site Containing Dna-Duplex Length = 742 Back     alignment and structure
>pdb|4A0K|A Chain A, Structure Of Ddb1-Ddb2-Cul4a-Rbx1 Bound To A 12 Bp Abasic Site Containing Dna-Duplex Length = 742 Back     alignment and structure
>pdb|2HYE|C Chain C, Crystal Structure Of The Ddb1-cul4a-rbx1-sv5v Complex Length = 759 Back     alignment and structure
>pdb|2HYE|C Chain C, Crystal Structure Of The Ddb1-cul4a-rbx1-sv5v Complex Length = 759 Back     alignment and structure
>pdb|1IUY|A Chain A, Solution Structure Of The Cullin-3 Homologue Length = 92 Back     alignment and structure
>pdb|1U6G|A Chain A, Crystal Structure Of The Cand1-Cul1-Roc1 Complex Length = 776 Back     alignment and structure
>pdb|1U6G|A Chain A, Crystal Structure Of The Cand1-Cul1-Roc1 Complex Length = 776 Back     alignment and structure
>pdb|1LDK|B Chain B, Structure Of The Cul1-Rbx1-Skp1-F Boxskp2 Scf Ubiquitin Ligase Complex Length = 366 Back     alignment and structure
>pdb|1LDK|B Chain B, Structure Of The Cul1-Rbx1-Skp1-F Boxskp2 Scf Ubiquitin Ligase Complex Length = 366 Back     alignment and structure
>pdb|1LDJ|A Chain A, Structure Of The Cul1-rbx1-skp1-f Boxskp2 Scf Ubiquitin Ligase Complex Length = 760 Back     alignment and structure
>pdb|1LDJ|A Chain A, Structure Of The Cul1-rbx1-skp1-f Boxskp2 Scf Ubiquitin Ligase Complex Length = 760 Back     alignment and structure
>pdb|3RTR|A Chain A, A Ring E3-Substrate Complex Poised For Ubiquitin-Like Protein Transfer: Structural Insights Into Cullin-Ring Ligases Length = 368 Back     alignment and structure
>pdb|3RTR|A Chain A, A Ring E3-Substrate Complex Poised For Ubiquitin-Like Protein Transfer: Structural Insights Into Cullin-Ring Ligases Length = 368 Back     alignment and structure
>pdb|3DPL|C Chain C, Structural Insights Into Nedd8 Activation Of Cullin-Ring Ligases: Conformational Control Of Conjugation Length = 382 Back     alignment and structure
>pdb|3DPL|C Chain C, Structural Insights Into Nedd8 Activation Of Cullin-Ring Ligases: Conformational Control Of Conjugation Length = 382 Back     alignment and structure
>pdb|2DO7|A Chain A, Solution Structure Of The Winged Helix-Turn-Helix Motif Of Human Cul-4b Length = 101 Back     alignment and structure
>pdb|3DQV|C Chain C, Structural Insights Into Nedd8 Activation Of Cullin-Ring Ligases: Conformational Control Of Conjugation Length = 382 Back     alignment and structure
>pdb|3DQV|C Chain C, Structural Insights Into Nedd8 Activation Of Cullin-Ring Ligases: Conformational Control Of Conjugation Length = 382 Back     alignment and structure
>pdb|3TDU|C Chain C, N-Terminal Acetylation Acts As An Avidity Enhancer Within An Interconnected Multiprotein Complex: Structure Of A Human Cul1whb- Dcn1p-Acetylated Ubc12n Complex Length = 77 Back     alignment and structure
>pdb|3O6B|B Chain B, A Dual E3 Mechanism For Rub1 Ligation To Cdc53: Dcn1(P)-Cdc53(Whb) Low Resolution Length = 76 Back     alignment and structure
>pdb|3O2P|E Chain E, A Dual E3 Mechanism For Rub1 Ligation To Cdc53: Dcn1(P)-Cdc53(Whb) Length = 88 Back     alignment and structure
>pdb|4F52|A Chain A, Structure Of A Glomulin-Rbx1-Cul1 Complex Length = 282 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query331
1ldj_A760 Cullin homolog 1, CUL-1; cullin, ROC1, HRT1, zinc 5e-64
1ldj_A 760 Cullin homolog 1, CUL-1; cullin, ROC1, HRT1, zinc 6e-09
2hye_C759 Cullin-4A, CUL-4A; beta propeller, ring finger, zi 2e-60
2hye_C 759 Cullin-4A, CUL-4A; beta propeller, ring finger, zi 4e-10
2hye_C759 Cullin-4A, CUL-4A; beta propeller, ring finger, zi 5e-04
3dpl_C382 Cullin-5; ubiquitin, NEDD8, cullin, HOST-virus int 4e-57
3dpl_C 382 Cullin-5; ubiquitin, NEDD8, cullin, HOST-virus int 2e-09
1iuy_A92 Cullin-3 homologue; winged helix, structural genom 7e-32
3tdu_C77 Cullin-1, CUL-1; E2:E3, ligase-protein binding com 2e-28
3o2p_E88 Cell division control protein 53; ligase, cell cyc 7e-28
2do7_A101 Cullin-4B, CUL-4B; helix-turn-helix motif, structu 6e-27
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
>1ldj_A Cullin homolog 1, CUL-1; cullin, ROC1, HRT1, zinc ring finger, ligase, ubiquitin, ubiquitination, SCF; 3.00A {Homo sapiens} SCOP: a.4.5.34 a.118.17.1 e.40.1.1 PDB: 1u6g_A 1ldk_A 1ldk_B 3rtr_A Length = 760 Back     alignment and structure
 Score =  215 bits (547), Expect = 5e-64
 Identities = 73/226 (32%), Positives = 112/226 (49%), Gaps = 27/226 (11%)

Query: 65  RFYLAKHSGRQLTLQPQMGSADLNAVFFGPRREEGEGKDGASSSTSPPAPRKHIIQVSTY 124
            FY ++HSGR+LT   Q+   +L    F                       ++ +Q ST+
Sbjct: 552 AFYASRHSGRKLTWLYQLSKGELVTNCFK---------------------NRYTLQASTF 590

Query: 125 QMCVLLLFNNREKLTYEEIQSETDIPERDLIRALQSLAMGKASQRILIRYPKTKE---IE 181
           QM +LL +N  +  T +++   T I    L + LQ L   K    +L       +   ++
Sbjct: 591 QMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSK--LLVLEDENANVDEVELK 648

Query: 182 PNHVFFVNDSFTSKLHRVKIQTVAAKGESEPERRETRSKVDEDRKHEIEAAVVRIMKARK 241
           P+ +  +   + +K  RV I  V  K E + E+  T   ++EDRK  I+AA+VRIMK RK
Sbjct: 649 PDTLIKLYLGYKNKKLRVNI-NVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRK 707

Query: 242 RMQHNTLITEVTEQLKSRFLPSPVIIKKRIESLIEREYLARTPEDR 287
            ++H  L+ EV  QL SRF P   +IKK I+ LIE+EYL R   ++
Sbjct: 708 VLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEK 753
>1ldj_A Cullin homolog 1, CUL-1; cullin, ROC1, HRT1, zinc ring finger, ligase, ubiquitin, ubiquitination, SCF; 3.00A {Homo sapiens} SCOP: a.4.5.34 a.118.17.1 e.40.1.1 PDB: 1u6g_A 1ldk_A 1ldk_B 3rtr_A Length = 760 Back     alignment and structure
>2hye_C Cullin-4A, CUL-4A; beta propeller, ring finger, zinc finger, propeller cluster, helical repeats, cullin repeats, protein binding; HET: DNA; 3.10A {Homo sapiens} SCOP: a.4.5.34 a.118.17.1 e.40.1.1 PDB: 4a0k_A* 4a0c_C 4a0l_E* Length = 759 Back     alignment and structure
>2hye_C Cullin-4A, CUL-4A; beta propeller, ring finger, zinc finger, propeller cluster, helical repeats, cullin repeats, protein binding; HET: DNA; 3.10A {Homo sapiens} SCOP: a.4.5.34 a.118.17.1 e.40.1.1 PDB: 4a0k_A* 4a0c_C 4a0l_E* Length = 759 Back     alignment and structure
>2hye_C Cullin-4A, CUL-4A; beta propeller, ring finger, zinc finger, propeller cluster, helical repeats, cullin repeats, protein binding; HET: DNA; 3.10A {Homo sapiens} SCOP: a.4.5.34 a.118.17.1 e.40.1.1 PDB: 4a0k_A* 4a0c_C 4a0l_E* Length = 759 Back     alignment and structure
>3dpl_C Cullin-5; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} PDB: 3dqv_C Length = 382 Back     alignment and structure
>3dpl_C Cullin-5; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} PDB: 3dqv_C Length = 382 Back     alignment and structure
>1iuy_A Cullin-3 homologue; winged helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.4.5.34 Length = 92 Back     alignment and structure
>3tdu_C Cullin-1, CUL-1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_C Length = 77 Back     alignment and structure
>3o2p_E Cell division control protein 53; ligase, cell cycle; 2.23A {Saccharomyces cerevisiae} PDB: 3o6b_B Length = 88 Back     alignment and structure
>2do7_A Cullin-4B, CUL-4B; helix-turn-helix motif, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query331
3dpl_C382 Cullin-5; ubiquitin, NEDD8, cullin, HOST-virus int 100.0
1ldj_A760 Cullin homolog 1, CUL-1; cullin, ROC1, HRT1, zinc 100.0
2hye_C759 Cullin-4A, CUL-4A; beta propeller, ring finger, zi 100.0
1iuy_A92 Cullin-3 homologue; winged helix, structural genom 99.91
3o2p_E88 Cell division control protein 53; ligase, cell cyc 99.91
2do7_A101 Cullin-4B, CUL-4B; helix-turn-helix motif, structu 99.9
3tdu_C77 Cullin-1, CUL-1; E2:E3, ligase-protein binding com 99.9
3dpl_C 382 Cullin-5; ubiquitin, NEDD8, cullin, HOST-virus int 97.89
2hye_C 759 Cullin-4A, CUL-4A; beta propeller, ring finger, zi 97.44
1ldj_A 760 Cullin homolog 1, CUL-1; cullin, ROC1, HRT1, zinc 97.39
2dk5_A91 DNA-directed RNA polymerase III 39 kDa polypeptide 94.94
3lmm_A583 Uncharacterized protein; multi-domained alpha-beta 93.37
3cuo_A99 Uncharacterized HTH-type transcriptional regulato; 93.19
1sfx_A109 Conserved hypothetical protein AF2008; structural 92.3
3tgn_A146 ADC operon repressor ADCR; helix-turn-helix, trans 92.11
2jt1_A77 PEFI protein; solution structure, winged helix-tur 92.1
1y0u_A96 Arsenical resistance operon repressor, putative; s 92.1
3jth_A98 Transcription activator HLYU; transcription factor 91.79
2htj_A81 P fimbrial regulatory protein KS71A; winged helix- 91.77
3g3z_A145 NMB1585, transcriptional regulator, MARR family; t 91.65
3hsr_A140 HTH-type transcriptional regulator SARZ; helix-tur 91.58
2d1h_A109 ST1889, 109AA long hypothetical transcriptional re 91.38
3cdh_A155 Transcriptional regulator, MARR family; helix-turn 91.37
2gxg_A146 146AA long hypothetical transcriptional regulator; 91.06
2fbh_A146 Transcriptional regulator PA3341; MARR, transcript 91.03
2fu4_A83 Ferric uptake regulation protein; DNA binding doma 90.9
3ech_A142 MEXR, multidrug resistance operon repressor; winge 90.63
3bpv_A138 Transcriptional regulator; MARR, DNA binding, tran 90.4
3nrv_A148 Putative transcriptional regulator (MARR/EMRR FAM; 90.37
2xub_A 534 DNA-directed RNA polymerase III subunit RPC3; tran 90.17
3oop_A143 LIN2960 protein; protein structure initiative, PSI 90.05
3bro_A141 Transcriptional regulator; helix_TURN_helix, multi 89.88
1xn7_A78 Hypothetical protein YHGG; alpha+beta, GFT structu 89.86
1qgp_A77 Protein (double stranded RNA adenosine deaminase); 89.86
3bj6_A152 Transcriptional regulator, MARR family; helix-turn 89.81
2qww_A154 Transcriptional regulator, MARR family; YP_013417. 89.78
3k0l_A162 Repressor protein; helix-turn-helix, structural ge 89.71
3r0a_A123 Putative transcriptional regulator; structural gen 89.65
3eco_A139 MEPR; mutlidrug efflux pump regulator winged helix 89.59
1jgs_A138 Multiple antibiotic resistance protein MARR; trans 89.58
2nnn_A140 Probable transcriptional regulator; structural gen 89.57
1tbx_A99 ORF F-93, hypothetical 11.0 kDa protein; sulfolobu 89.53
3bdd_A142 Regulatory protein MARR; putative multiple antibio 89.4
2fa5_A162 Transcriptional regulator MARR/EMRR family; multip 89.35
4hbl_A149 Transcriptional regulator, MARR family; HTH, trans 89.33
2hr3_A147 Probable transcriptional regulator; MCSG, structur 89.1
2v79_A135 DNA replication protein DNAD; primosome, DNA-bindi 88.99
2pex_A153 Transcriptional regulator OHRR; transcription regu 88.92
3pqk_A102 Biofilm growth-associated repressor; helix-turn-he 88.91
2frh_A127 SARA, staphylococcal accessory regulator A; winged 88.79
1lj9_A144 Transcriptional regulator SLYA; HTH DNA binding pr 88.74
3bja_A139 Transcriptional regulator, MARR family, putative; 88.73
2rdp_A150 Putative transcriptional regulator MARR; PFAM PF01 88.73
2a61_A145 Transcriptional regulator TM0710; APC4350, MCSG, m 88.7
3cjn_A162 Transcriptional regulator, MARR family; silicibact 88.65
3e6m_A161 MARR family transcriptional regulator; APC88769, s 88.64
2k02_A87 Ferrous iron transport protein C; FEOC, iron-sulfu 88.47
2eth_A154 Transcriptional regulator, putative, MAR family; M 88.45
1u2w_A122 CADC repressor, cadmium efflux system accessory pr 88.39
2nyx_A168 Probable transcriptional regulatory protein, RV14; 88.34
3deu_A166 Transcriptional regulator SLYA; MARR, WING-helix, 88.1
1ku9_A152 Hypothetical protein MJ223; putative transcription 88.09
2bv6_A142 MGRA, HTH-type transcriptional regulator MGRA; mul 88.07
2fbi_A142 Probable transcriptional regulator; MARR, APC5816, 88.04
3s2w_A159 Transcriptional regulator, MARR family; structural 88.01
1qbj_A81 Protein (double-stranded RNA specific adenosine D 87.79
1s3j_A155 YUSO protein; structural genomics, MARR transcript 87.58
2heo_A67 Z-DNA binding protein 1; protein DLM1-Z-DNA comple 87.27
1p6r_A82 Penicillinase repressor; transcription regulation, 87.06
1z91_A147 Organic hydroperoxide resistance transcriptional; 87.05
3r4k_A260 Transcriptional regulator, ICLR family; DNA/RNA-bi 86.94
3fm5_A150 Transcriptional regulator; MCSG, PF04017, PSI, MAR 86.93
2oqg_A114 Possible transcriptional regulator, ARSR family P; 86.82
3f3x_A144 Transcriptional regulator, MARR family, putative; 86.34
2xrn_A241 HTH-type transcriptional regulator TTGV; DNA-bindi 86.34
3jw4_A148 Transcriptional regulator, MARR/EMRR family; DNA-b 86.29
1bja_A95 Transcription regulatory protein MOTA; activation 86.21
2w25_A150 Probable transcriptional regulatory protein; trans 86.11
1ub9_A100 Hypothetical protein PH1061; helix-turn-helix moti 86.02
3nqo_A189 MARR-family transcriptional regulator; structural 86.0
4b8x_A147 SCO5413, possible MARR-transcriptional regulator; 85.98
4aik_A151 Transcriptional regulator SLYA; transcription, tra 85.78
2pn6_A150 ST1022, 150AA long hypothetical transcriptional re 85.65
1oyi_A82 Double-stranded RNA-binding protein; (alpha+beta) 85.61
3boq_A160 Transcriptional regulator, MARR family; MARR famil 85.61
2vn2_A128 DNAD, chromosome replication initiation protein; D 85.4
1xmk_A79 Double-stranded RNA-specific adenosine deaminase; 85.31
1r1u_A106 CZRA, repressor protein; zinc, DNA binding, transc 85.22
2e1c_A171 Putative HTH-type transcriptional regulator PH151; 85.07
2fxa_A207 Protease production regulatory protein HPR; protea 84.37
2cfx_A144 HTH-type transcriptional regulator LRPC; transcrip 84.1
3kp7_A151 Transcriptional regulator TCAR; multiple drug resi 84.02
1i1g_A141 Transcriptional regulator LRPA; helix-turn-helix, 83.59
2dbb_A151 Putative HTH-type transcriptional regulator PH006; 83.51
2cg4_A152 Regulatory protein ASNC; DNA binding, FFRP, LRP fa 83.44
2kko_A108 Possible transcriptional regulatory protein (possi 83.18
3mq0_A275 Transcriptional repressor of the blcabc operon; he 83.07
2jsc_A118 Transcriptional regulator RV1994C/MT2050; cadmium, 82.97
2wte_A244 CSA3; antiviral protein, viral resistance, winged 82.8
3lwf_A159 LIN1550 protein, putative transcriptional regulato 82.8
3f6o_A118 Probable transcriptional regulator, ARSR family pr 82.24
3t8r_A143 Staphylococcus aureus CYMR; transcriptional regula 82.18
2y75_A129 HTH-type transcriptional regulator CYMR; DNA bindi 82.11
1mkm_A249 ICLR transcriptional regulator; structural genomic 82.0
2ia0_A171 Putative HTH-type transcriptional regulator PF086; 81.81
3u2r_A168 Regulatory protein MARR; structural genomics, PSI- 81.77
2p5v_A162 Transcriptional regulator, LRP/ASNC family; NMB057 81.71
2o0y_A260 Transcriptional regulator; ICLR-family, structural 81.71
2cyy_A151 Putative HTH-type transcriptional regulator PH151; 80.88
>3dpl_C Cullin-5; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} PDB: 3dqv_C Back     alignment and structure
Probab=100.00  E-value=2.5e-54  Score=423.79  Aligned_cols=252  Identities=29%  Similarity=0.394  Sum_probs=217.5

Q ss_pred             hhHHHHHHHhhcCC--CCcccc---cccCCCCCC--CCCCCCCHHHHHHHHhhhHhhhcccCCCCeEEeecCCceEEEEE
Q psy11818         17 ENDLFKFYLAKHSG--RQLTLQ---PQMGSADLN--AVFFGPRREEVHIFSIYPLRFYLAKHSGRQLTLQPQMGSADLNA   89 (331)
Q Consensus        17 ~~~~f~~~~~~~~~--~~~~~~---~~~~swp~~--~~~~~lP~~L~~~~~~F~~~fY~~k~~~RkL~W~~~Lg~~~l~~   89 (331)
                      .+..|++++.+.+.  ..++|+   ++.++||..  ..++.+|++|..+++.| +.||..+|+||+|+|+|+||+|+|++
T Consensus       108 l~~~f~~~~~~~~~~~~~~~~~v~VLs~~~WP~~~~~~~~~lP~~l~~~~~~F-~~fY~~~~~gRkL~W~~~lg~~~l~~  186 (382)
T 3dpl_C          108 LNQAFKEMHKNNKLALPADSVNIKILNAGAWSRSSEKVFVSLPTELEDLIPEV-EEFYKKNHSGRKLHWHHLMSNGIITF  186 (382)
T ss_dssp             HHHHHHHHTCCC--CCCGGGEEEEEEEHHHHCCCSCCCCCCCCHHHHTTHHHH-HHHHHTTSSSEEEEECGGGCEEEEEE
T ss_pred             HHHHHHHHHhhcCCCCCCCceEEEEccCCcCCCCCCCCCccCCHHHHHHHHHH-HHHHHhcCCCCEEEEecCcccEEEEE
Confidence            35678877654432  235565   689999986  36999999999999999 99999999999999999999999999


Q ss_pred             EEcCCCcCCCCCCCCCCCCCCCCCCCcEEEEEchHHHHHHHHhcCC--CCCCHHHHHHhcCCCHHHHHHHHHHHHcc-cC
Q psy11818         90 VFFGPRREEGEGKDGASSSTSPPAPRKHIIQVSTYQMCVLLLFNNR--EKLTYEEIQSETDIPERDLIRALQSLAMG-KA  166 (331)
Q Consensus        90 ~f~~~~k~~~~~~~~~~~~~~~~~~~~~~l~vs~~Qa~ILllFN~~--~~lt~~eL~~~tgi~~~~l~~~L~sL~~~-k~  166 (331)
                      .|.                     ++.++|+||++||+||++||+.  +.||++||++.|||+.++|+++|.+|+.. |.
T Consensus       187 ~~~---------------------~~~~~l~vs~~Qa~ILllFn~~~~~~lt~~ei~~~t~i~~~~L~r~L~sL~~~~k~  245 (382)
T 3dpl_C          187 KNE---------------------VGQYDLEVTTFQLAVLFAWNQRPREKISFENLKLATELPDAELRRTLWSLVAFPKL  245 (382)
T ss_dssp             ECS---------------------SCEEEEEEEHHHHHHHGGGTTCTTCCEEHHHHHHHHCCCHHHHHHHHHHHHCCTTC
T ss_pred             EeC---------------------CceEEEEEcHHHHHHHHHhccCCCCcCcHHHHHHHHCcCHHHHHHHHHHHhcccch
Confidence            886                     3589999999999999999986  89999999999999999999999999863 22


Q ss_pred             cccceeecCC---CCCCCCCCeEEEecCCCCC-----ceeEEEecccc-CCCChhHHHHhhhhhHHhhhhhHHHHHHHhh
Q psy11818        167 SQRILIRYPK---TKEIEPNHVFFVNDSFTSK-----LHRVKIQTVAA-KGESEPERRETRSKVDEDRKHEIEAAVVRIM  237 (331)
Q Consensus       167 ~~~IL~~~~~---~~~i~~~~~f~lN~~F~~k-----~~ki~i~~~~~-k~e~~~e~~~~~~~v~edR~~~IqAaIVRIM  237 (331)
                      .++||.++|.   +.++.+++.|.||.+|++.     .+|++|+.+.. +.++..+.+++++.+++||++.|||||||||
T Consensus       246 k~~iL~~~~~~~~~~~~~~~d~f~~N~~F~~~k~~k~~~r~ki~~~~~~q~~~~~e~~~~~~~v~edR~~~i~AaIVRIM  325 (382)
T 3dpl_C          246 KRQVLLYEPQVNSPKDFTEGTLFSVNQEFSLIKNAKVQKRGKINLIGRLQLTTERMREEENEGIVQLRILRTQEAIIQIM  325 (382)
T ss_dssp             SSCSEEESSCCSSGGGCCTTCEEEECTTCCEESSSSEESEEEEECCTTTTSCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hcceeeecCCccccCcCCCCCEEEEcCCCcCCcccccceeEEEecccccccccchhhhhhHHHHHHHhhheeeEEEehhh
Confidence            2469998875   3678899999999999862     25677776531 2345666778899999999999999999999


Q ss_pred             hcccCCChHHHHHHHHHHhccCCCCCHHHHHHHHHHHHHHHHHHhCCcccccc
Q psy11818        238 KARKRMQHNTLITEVTEQLKSRFLPSPVIIKKRIESLIEREYLARTPEDRFLQ  290 (331)
Q Consensus       238 K~~K~l~~~~Li~~V~~~l~~~F~ps~~~IKk~IE~LIereyI~Rd~~d~~i~  290 (331)
                      |+||+|+|++|+.+|+++++++|.|++.+||+|||+||+||||+|+++|+++.
T Consensus       326 K~rK~l~h~~Lv~ev~~ql~~rF~p~~~~IKk~Ie~LIereYleR~~~d~~~y  378 (382)
T 3dpl_C          326 KMRKKISNAQLQTELVEILKNMFLPQKKMIKEQIEWLIEHKYIRRDESDINTF  378 (382)
T ss_dssp             TTSSEECHHHHHHHHHHHTTTTCCCCHHHHHHHHHHHHHTTSEEEETTEEEEE
T ss_pred             hccCcccHHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHhhhhhccCCCCCCeE
Confidence            99999999999999999999999999999999999999999999999988653
>1ldj_A Cullin homolog 1, CUL-1; cullin, ROC1, HRT1, zinc ring finger, ligase, ubiquitin, ubiquitination, SCF; 3.00A {Homo sapiens} SCOP: a.4.5.34 a.118.17.1 e.40.1.1 PDB: 1u6g_A 1ldk_A 1ldk_B 3rtr_A Back     alignment and structure
>2hye_C Cullin-4A, CUL-4A; beta propeller, ring finger, zinc finger, propeller cluster, helical repeats, cullin repeats, protein binding; HET: DNA; 3.10A {Homo sapiens} SCOP: a.4.5.34 a.118.17.1 e.40.1.1 PDB: 4a0k_A* 4a0c_C 4a0l_E* Back     alignment and structure
>1iuy_A Cullin-3 homologue; winged helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.4.5.34 Back     alignment and structure
>3o2p_E Cell division control protein 53; ligase, cell cycle; 2.23A {Saccharomyces cerevisiae} PDB: 3o6b_B Back     alignment and structure
>2do7_A Cullin-4B, CUL-4B; helix-turn-helix motif, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3tdu_C Cullin-1, CUL-1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_C Back     alignment and structure
>3dpl_C Cullin-5; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} PDB: 3dqv_C Back     alignment and structure
>2hye_C Cullin-4A, CUL-4A; beta propeller, ring finger, zinc finger, propeller cluster, helical repeats, cullin repeats, protein binding; HET: DNA; 3.10A {Homo sapiens} SCOP: a.4.5.34 a.118.17.1 e.40.1.1 PDB: 4a0k_A* 4a0c_C 4a0l_E* Back     alignment and structure
>1ldj_A Cullin homolog 1, CUL-1; cullin, ROC1, HRT1, zinc ring finger, ligase, ubiquitin, ubiquitination, SCF; 3.00A {Homo sapiens} SCOP: a.4.5.34 a.118.17.1 e.40.1.1 PDB: 1u6g_A 1ldk_A 1ldk_B 3rtr_A Back     alignment and structure
>2dk5_A DNA-directed RNA polymerase III 39 kDa polypeptide; structural genomics, winged helix domain, NPPSFA; NMR {Homo sapiens} SCOP: a.4.5.85 Back     alignment and structure
>3lmm_A Uncharacterized protein; multi-domained alpha-beta protein, structural genomics, PSI- 2, protein structure initiative; 3.00A {Corynebacterium diphtheriae} Back     alignment and structure
>3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} Back     alignment and structure
>1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 Back     alignment and structure
>3tgn_A ADC operon repressor ADCR; helix-turn-helix, transcriptional regulator, transcription; 2.00A {Streptococcus pneumoniae} Back     alignment and structure
>2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 Back     alignment and structure
>3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} Back     alignment and structure
>2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 Back     alignment and structure
>3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structur genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3hsr_A HTH-type transcriptional regulator SARZ; helix-turn-helix, cysteine disulfide, MARR-family transcript regulator, DNA-binding; 1.90A {Staphylococcus aureus subsp} PDB: 3hse_A 3hrm_A 4gxo_A Back     alignment and structure
>2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 Back     alignment and structure
>3cdh_A Transcriptional regulator, MARR family; helix-turn-hleix, structura genomics, PSI-2, protein structure initiative; 2.69A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A Back     alignment and structure
>2fbh_A Transcriptional regulator PA3341; MARR, transcription regulator, APC5857, structural genomics, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>2fu4_A Ferric uptake regulation protein; DNA binding domain, helix-turn-helix, DNA binding protein; 1.80A {Escherichia coli} Back     alignment and structure
>3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 PDB: 1lnw_A 3mex_A Back     alignment and structure
>3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* Back     alignment and structure
>3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} Back     alignment and structure
>2xub_A DNA-directed RNA polymerase III subunit RPC3; transcription, winged helix; 2.80A {Homo sapiens} PDB: 2xv4_S Back     alignment and structure
>3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua} Back     alignment and structure
>3bro_A Transcriptional regulator; helix_TURN_helix, multiple antibiotic resistance protein (MA structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.04A {Oenococcus oeni} SCOP: a.4.5.28 Back     alignment and structure
>1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 Back     alignment and structure
>1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>3bj6_A Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, STR genomics, PSI-2, protein structure initiative; 2.01A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2qww_A Transcriptional regulator, MARR family; YP_013417.1, multiple antibiotic-resistance repressor (MARR) structural genomics; HET: MSE; 2.07A {Listeria monocytogenes str} Back     alignment and structure
>3k0l_A Repressor protein; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.35A {Acinetobacter SP} Back     alignment and structure
>3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} Back     alignment and structure
>3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} SCOP: a.4.5.0 Back     alignment and structure
>1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor, transcription; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28 Back     alignment and structure
>2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>1tbx_A ORF F-93, hypothetical 11.0 kDa protein; sulfolobus spindle virus, winged helix, fusellovirus; 2.70A {Sulfolobus virus 1} SCOP: a.4.5.48 Back     alignment and structure
>3bdd_A Regulatory protein MARR; putative multiple antibiotic-resistance repressor, structura genomics, joint center for structural genomics, JCSG; 2.20A {Streptococcus suis} Back     alignment and structure
>2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris} Back     alignment and structure
>4hbl_A Transcriptional regulator, MARR family; HTH, transcription factor, DNA binding; 2.50A {Staphylococcus epidermidis} Back     alignment and structure
>2hr3_A Probable transcriptional regulator; MCSG, structural genomics, PSI-2, protein structure initiati midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>2v79_A DNA replication protein DNAD; primosome, DNA-binding protein; HET: DNA; 2.00A {Bacillus subtilis} Back     alignment and structure
>2pex_A Transcriptional regulator OHRR; transcription regulator; 1.90A {Xanthomonas campestris} PDB: 2pfb_A Back     alignment and structure
>3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A Back     alignment and structure
>2frh_A SARA, staphylococcal accessory regulator A; winged-helix protein, divalent metal binding, transcription; 2.50A {Staphylococcus aureus} SCOP: a.4.5.28 PDB: 2fnp_A 1fzp_D Back     alignment and structure
>1lj9_A Transcriptional regulator SLYA; HTH DNA binding protein, structural genomics, PSI, protein structure initiative; 1.60A {Enterococcus faecalis} SCOP: a.4.5.28 Back     alignment and structure
>3bja_A Transcriptional regulator, MARR family, putative; NP_978771.1, putative MARR-like transcription regulator, MAR structural genomics; 2.38A {Bacillus cereus} Back     alignment and structure
>2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus} Back     alignment and structure
>2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>3cjn_A Transcriptional regulator, MARR family; silicibacter pomeroy structural genomics, PSI-2, protein structure initiative; 1.95A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3e6m_A MARR family transcriptional regulator; APC88769, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; 2.20A {Silicibacter pomeroyi} Back     alignment and structure
>2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} Back     alignment and structure
>2eth_A Transcriptional regulator, putative, MAR family; MARR family, structural genomics, joint center for structura genomics, JCSG; 2.30A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>1u2w_A CADC repressor, cadmium efflux system accessory protein; LEAD, SOFT metal ION resistance, ARSR/SM family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A Back     alignment and structure
>2nyx_A Probable transcriptional regulatory protein, RV14; alpha/beta, structural genomics, PSI-2; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3deu_A Transcriptional regulator SLYA; MARR, WING-helix, transcription regulator, activator, DNA-binding, repressor; HET: SAL; 2.30A {Salmonella typhimurium} SCOP: a.4.5.28 Back     alignment and structure
>1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36 Back     alignment and structure
>2bv6_A MGRA, HTH-type transcriptional regulator MGRA; multidrug resistance regulator, virulence determinant, transcriptional factors; 2.8A {Staphylococcus aureus} SCOP: a.4.5.28 Back     alignment and structure
>2fbi_A Probable transcriptional regulator; MARR, APC5816, structural genomic protein structure initiative; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>3s2w_A Transcriptional regulator, MARR family; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 2.45A {Methanosarcina mazei} Back     alignment and structure
>1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A Back     alignment and structure
>1s3j_A YUSO protein; structural genomics, MARR transcriptional regulator family, PSI, protein structure initiative; HET: MSE; 2.25A {Bacillus subtilis} SCOP: a.4.5.28 Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>1p6r_A Penicillinase repressor; transcription regulation, DNA-binding, winged helix protein, bacterial resistance to antibiotics; NMR {Bacillus licheniformis} SCOP: a.4.5.39 PDB: 2p7c_B Back     alignment and structure
>1z91_A Organic hydroperoxide resistance transcriptional; OHRR, MARR family, bacterial transcription factor, DNA bindi protein; 2.50A {Bacillus subtilis} SCOP: a.4.5.28 PDB: 1z9c_A* Back     alignment and structure
>3r4k_A Transcriptional regulator, ICLR family; DNA/RNA-binding 3-helical bundle, profilin-like, structural joint center for structural genomics, JCSG; 2.46A {Ruegeria SP} Back     alignment and structure
>3fm5_A Transcriptional regulator; MCSG, PF04017, PSI, MARR, structu genomics, protein structure initiative, midwest center for structural genomics; HET: GOL; 2.00A {Rhodococcus jostii} Back     alignment and structure
>2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} Back     alignment and structure
>3f3x_A Transcriptional regulator, MARR family, putative; DNA binding protein, DNA-binding, transcription regulation; 1.90A {Sulfolobus solfataricus} Back     alignment and structure
>2xrn_A HTH-type transcriptional regulator TTGV; DNA-binding protein, tetramer gene regulator, cooperative DN binding, multidrug binding protein; 2.90A {Pseudomonas putida} PDB: 2xro_A Back     alignment and structure
>3jw4_A Transcriptional regulator, MARR/EMRR family; DNA-binding protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Clostridium acetobutylicum} SCOP: a.4.5.0 Back     alignment and structure
>1bja_A Transcription regulatory protein MOTA; activation domain, middle mode transcription, alpha helical structure, transcription regulation; 2.19A {Enterobacteria phage T4} SCOP: a.4.5.9 PDB: 1i1s_A Back     alignment and structure
>2w25_A Probable transcriptional regulatory protein; transcription regulation, mutant, RV3291C, Glu104Ala, DNA-binding; 2.15A {Mycobacterium tuberculosis} PDB: 2vbw_A* 2vbx_A* 2vby_A* 2vbz_A* 2vc0_A 2vc1_A 2w24_A 2ivm_A 2w29_A 2qz8_A Back     alignment and structure
>1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 Back     alignment and structure
>3nqo_A MARR-family transcriptional regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE PG4; 2.20A {Clostridium difficile} Back     alignment and structure
>4b8x_A SCO5413, possible MARR-transcriptional regulator; winged helix motif; HET: CME; 1.25A {Streptomyces coelicolor} Back     alignment and structure
>4aik_A Transcriptional regulator SLYA; transcription, transcription factor; 1.85A {Yersinia pseudotuberculosis} PDB: 4aih_A 4aij_A 3qpt_A* 3q5f_A* Back     alignment and structure
>2pn6_A ST1022, 150AA long hypothetical transcriptional regulator; LRP/ASNC family Gln binding, structural genomics, NPPSFA; HET: GLN; 1.44A {Sulfolobus tokodaii} PDB: 2efn_A* 2e7x_A* 2e7w_A* 2yx4_A* 2efq_A* 2pmh_A* 2yx7_A* 2efp_A* 2efo_A* Back     alignment and structure
>1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 Back     alignment and structure
>3boq_A Transcriptional regulator, MARR family; MARR famil structural genomics, PSI-2, protein structure initiative; 2.39A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2vn2_A DNAD, chromosome replication initiation protein; DNA replication, primosome; 2.3A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1xmk_A Double-stranded RNA-specific adenosine deaminase; winged helix-turn-helix, RNA editing, interferon, ADAR1, hydrolase; 0.97A {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A Back     alignment and structure
>2fxa_A Protease production regulatory protein HPR; protease porduction, regulation, STR genomics, PSI, protein structure initiative; HET: PGE P6G 1PE; 2.40A {Bacillus subtilis} SCOP: a.4.5.28 Back     alignment and structure
>2cfx_A HTH-type transcriptional regulator LRPC; transcriptional regulation, DNA binding, FFRP; 2.4A {Bacillus subtilis} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>3kp7_A Transcriptional regulator TCAR; multiple drug resistance, biofilm, transcription regulation, binding, transcription regulator; 2.30A {Staphylococcus epidermidis RP62A} PDB: 3kp3_A* 3kp4_A* 3kp5_A* 3kp2_A* 3kp6_A Back     alignment and structure
>1i1g_A Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2dbb_A Putative HTH-type transcriptional regulator PH006; ASNC family, helix-turn-helix (HTH) domain, structural genom NPPSFA; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2cg4_A Regulatory protein ASNC; DNA binding, FFRP, LRP family, transcription, DNA- binding, transcription regulation; 2.4A {Escherichia coli} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A Back     alignment and structure
>3mq0_A Transcriptional repressor of the blcabc operon; helix-turn-helix, GAF fold, transcription repressor; 1.79A {Agrobacterium tumefaciens} Back     alignment and structure
>2wte_A CSA3; antiviral protein, viral resistance, winged helix-turn-helix prnai nucleotide-binding domain; HET: MSE; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>3lwf_A LIN1550 protein, putative transcriptional regulator; structural genomics, JOI for structural genomics, JCSG; HET: SO4; 2.06A {Listeria innocua} Back     alignment and structure
>3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} Back     alignment and structure
>3t8r_A Staphylococcus aureus CYMR; transcriptional regulator protein, dimer, sulfenic acid, UNK function; 1.70A {Staphylococcus aureus} PDB: 3t8t_A Back     alignment and structure
>2y75_A HTH-type transcriptional regulator CYMR; DNA binding protein; 2.00A {Bacillus subtilis} Back     alignment and structure
>1mkm_A ICLR transcriptional regulator; structural genomics, winged helix-turn-helix, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: a.4.5.33 d.110.2.2 Back     alignment and structure
>2ia0_A Putative HTH-type transcriptional regulator PF086; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} Back     alignment and structure
>3u2r_A Regulatory protein MARR; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, helix-turn-helix; 2.20A {Planctomyces limnophilus} Back     alignment and structure
>2p5v_A Transcriptional regulator, LRP/ASNC family; NMB0573, structu genomics; 1.99A {Neisseria meningitidis} PDB: 2p6s_A 2p6t_A Back     alignment and structure
>2o0y_A Transcriptional regulator; ICLR-family, structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.00A {Rhodococcus SP} Back     alignment and structure
>2cyy_A Putative HTH-type transcriptional regulator PH151; structural genomics, pyrococcus horikosii OT3, NPPSFA; HET: MSE GLN; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 331
d2hyec3273 e.40.1.1 (C:403-675) Cullin-4A {Human (Homo sapien 3e-35
d2hyec3 273 e.40.1.1 (C:403-675) Cullin-4A {Human (Homo sapien 3e-11
d2hyec3273 e.40.1.1 (C:403-675) Cullin-4A {Human (Homo sapien 0.003
d1iuya_92 a.4.5.34 (A:) Cullin-3 homologue {Mouse (Mus muscu 3e-34
d1ldja190 a.4.5.34 (A:687-776) Anaphase promoting complex (A 5e-32
d2hyec184 a.4.5.34 (C:676-759) Cullin-4A {Human (Homo sapien 6e-29
d1ldja3276 e.40.1.1 (A:411-686) Cullin homolog 1, cul-1 {Huma 5e-28
d1ldja3 276 e.40.1.1 (A:411-686) Cullin homolog 1, cul-1 {Huma 4e-13
d1ldja3276 e.40.1.1 (A:411-686) Cullin homolog 1, cul-1 {Huma 0.002
>d2hyec3 e.40.1.1 (C:403-675) Cullin-4A {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: Cullin homology domain
superfamily: Cullin homology domain
family: Cullin homology domain
domain: Cullin-4A
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  127 bits (319), Expect = 3e-35
 Identities = 57/143 (39%), Positives = 72/143 (50%), Gaps = 23/143 (16%)

Query: 65  RFYLAKHSGRQLTLQPQMGSADLNAVFFGPRREEGEGKDGASSSTSPPAPRKHIIQVSTY 124
            FYL KHSGR+L  Q  +G A L A F                        K   QVS +
Sbjct: 154 AFYLGKHSGRKLQWQTTLGHAVLKAEFKE---------------------GKKEFQVSLF 192

Query: 125 QMCVLLLFNNREKLTYEEIQSETDIPERDLIRALQSLAMGKASQRILIRYPKTKEIEPNH 184
           Q  VLL+FN  +  ++EEI+  T I + +L R LQSLA GKA  R+LI+ PK KE+E   
Sbjct: 193 QTLVLLMFNEGDGFSFEEIKMATGIEDSELRRTLQSLACGKA--RVLIKSPKGKEVEDGD 250

Query: 185 VFFVNDSFTSKLHRVKIQTVAAK 207
            F  N  F  KL R+KI  +  K
Sbjct: 251 KFIFNGEFKHKLFRIKINQIQMK 273
>d2hyec3 e.40.1.1 (C:403-675) Cullin-4A {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d2hyec3 e.40.1.1 (C:403-675) Cullin-4A {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1iuya_ a.4.5.34 (A:) Cullin-3 homologue {Mouse (Mus musculus) [TaxId: 10090]} Length = 92 Back     information, alignment and structure
>d1ldja1 a.4.5.34 (A:687-776) Anaphase promoting complex (APC) {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2hyec1 a.4.5.34 (C:676-759) Cullin-4A {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1ldja3 e.40.1.1 (A:411-686) Cullin homolog 1, cul-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1ldja3 e.40.1.1 (A:411-686) Cullin homolog 1, cul-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1ldja3 e.40.1.1 (A:411-686) Cullin homolog 1, cul-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query331
d2hyec3273 Cullin-4A {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1ldja3276 Cullin homolog 1, cul-1 {Human (Homo sapiens) [Tax 99.96
d1ldja190 Anaphase promoting complex (APC) {Human (Homo sapi 99.9
d2hyec184 Cullin-4A {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1iuya_92 Cullin-3 homologue {Mouse (Mus musculus) [TaxId: 1 99.88
d1ldja3 276 Cullin homolog 1, cul-1 {Human (Homo sapiens) [Tax 97.1
d2hyec3 273 Cullin-4A {Human (Homo sapiens) [TaxId: 9606]} 96.94
d1mkma175 Transcriptional regulator IclR, N-terminal domain 93.2
d1lnwa_141 MexR repressor {Pseudomonas aeruginosa [TaxId: 287 93.16
d2etha1140 Putative transcriptional regulator TM0816 {Thermot 92.28
d2a61a1139 Transcriptional regulator TM0710 {Thermotoga marit 92.18
d1lj9a_144 Transcriptional regulator SlyA {Enterococcus faeca 92.11
d1sfxa_109 Hypothetical protein AF2008 {Archaeoglobus fulgidu 91.88
d1z05a171 Transcriptional regulator VC2007 N-terminal domain 91.19
d1ylfa1138 Hypothetical protein BC1842 {Bacillus cereus [TaxI 90.49
d2d1ha1109 Hypothetical transcriptional regulator ST1889 {Sul 90.45
d2cg4a163 Regulatory protein AsnC {Escherichia coli [TaxId: 90.08
d2cfxa163 Transcriptional regulator LrpC {Bacillus subtilis 90.02
d2frha1115 Pleiotropic regulator of virulence genes, SarA {St 89.99
d1z91a1137 Organic hydroperoxide resistance transcriptional r 89.78
d1i1ga160 LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} 89.75
d1jgsa_138 Multiple antibiotic resistance repressor, MarR {Es 89.67
d2fbia1136 Probable transcriptional regulator PA4135 {Pseudom 89.46
d1s3ja_143 Putative transcriptional regulator YusO {Bacillus 89.46
d1hsja1115 Staphylococcal accessory regulator A homolog, SarR 89.07
d3broa1135 Transcriptional regulator OEOE1854 {Oenococcus oen 89.05
d1p4xa2125 Staphylococcal accessory regulator A homolog, SarS 89.02
d1ub9a_100 Hypothetical protein PH1061 {Archaeon Pyrococcus h 88.72
d1ku9a_151 DNA-binding protein Mj223 {Archaeon Methanococcus 88.59
d1biaa163 Biotin repressor, N-terminal domain {Escherichia c 88.46
d2cyya160 Putative transcriptional regulator PH1519 {Archaeo 88.44
d1p4xa1125 Staphylococcal accessory regulator A homolog, SarS 88.35
d2hr3a1145 Probable transcriptional regulator PA3067 {Pseudom 88.33
d2fxaa1162 Protease production regulatory protein Hpr {Bacill 88.04
d2bv6a1136 Transcriptional regulator MgrA {Staphylococcus aur 87.99
d2fbha1137 Transcriptional regulator PA3341 {Pseudomonas aeru 87.83
d1dpua_69 C-terminal domain of RPA32 {Human (Homo sapiens) [ 87.35
d1tw3a185 Carminomycin 4-O-methyltransferase {Streptomyces p 87.21
d3deua1140 Transcriptional regulator SlyA {Salmonella typhimu 86.93
d1u2wa1108 Cadmium efflux system accessory protein CadC {Stap 86.57
d1j5ya165 Putative transcriptional regulator TM1602, N-termi 86.21
d1r1ta_98 SmtB repressor {Cyanobacteria (Synechococcus), pcc 83.89
d1z6ra170 Mlc protein N-terminal domain {Escherichia coli [T 82.99
d1r1ua_94 Metal-sensing transcriptional repressor CzrA {Stap 80.41
>d2hyec3 e.40.1.1 (C:403-675) Cullin-4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Cullin homology domain
superfamily: Cullin homology domain
family: Cullin homology domain
domain: Cullin-4A
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.96  E-value=6.2e-30  Score=237.20  Aligned_cols=168  Identities=38%  Similarity=0.523  Sum_probs=149.1

Q ss_pred             HhhHHHHHHHhhcCC-CCcccc---cccCCCCCC-CCCCCCCHHHHHHHHhhhHhhhcccCCCCeEEeecCCceEEEEEE
Q psy11818         16 LENDLFKFYLAKHSG-RQLTLQ---PQMGSADLN-AVFFGPRREEVHIFSIYPLRFYLAKHSGRQLTLQPQMGSADLNAV   90 (331)
Q Consensus        16 ~~~~~f~~~~~~~~~-~~~~~~---~~~~swp~~-~~~~~lP~~L~~~~~~F~~~fY~~k~~~RkL~W~~~Lg~~~l~~~   90 (331)
                      -.+.+|+++++.... ..++|.   ++.++||.. ..++.+|++|..+++.| +.||..+|++|+|.|++++|+|+|+++
T Consensus       101 ~l~~~f~~~~~~~~~~~~~~~~v~vLs~~~WP~~~~~~~~lP~~l~~~~~~F-~~~Y~~~~~~RkL~w~~~ls~~~l~~~  179 (273)
T d2hyec3         101 DIMVHFKQHMQNQSDSGPIDLTVNILTMGYWPTYTPMEVHLTPEMIKLQEVF-KAFYLGKHSGRKLQWQTTLGHAVLKAE  179 (273)
T ss_dssp             HHHHHHHHHHHTTCCCCCCEEEEEEEETTTSCCCCCCCCCCCHHHHHHHHHH-HHHHHTTSCSEECCBCGGGCEEEEECC
T ss_pred             HHHHHHHHHHhccccCCCCceEEEEeeCCCCCCCCCCCCcCCHHHHHHHHHH-HHHHHHhCCCCEEEEecCCccEEEEEE
Confidence            345678888765533 245554   689999976 46899999999999999 999999999999999999999999999


Q ss_pred             EcCCCcCCCCCCCCCCCCCCCCCCCcEEEEEchHHHHHHHHhcCCCCCCHHHHHHhcCCCHHHHHHHHHHHHcccCcccc
Q psy11818         91 FFGPRREEGEGKDGASSSTSPPAPRKHIIQVSTYQMCVLLLFNNREKLTYEEIQSETDIPERDLIRALQSLAMGKASQRI  170 (331)
Q Consensus        91 f~~~~k~~~~~~~~~~~~~~~~~~~~~~l~vs~~Qa~ILllFN~~~~lt~~eL~~~tgi~~~~l~~~L~sL~~~k~~~~I  170 (331)
                      |.                     ++.++|+||++||+||++||+.+.+|+++|++.||++.+.+.++|.+|+..|  .+|
T Consensus       180 ~~---------------------~~~~~l~~s~~Qa~ILl~fn~~~~~t~~~i~~~~~i~~~~l~~~L~~L~~~k--~~i  236 (273)
T d2hyec3         180 FK---------------------EGKKEFQVSLFQTLVLLMFNEGDGFSFEEIKMATGIEDSELRRTLQSLACGK--ARV  236 (273)
T ss_dssp             CS---------------------SCCCEEEEEHHHHHHHHHTTSCCCEEHHHHHHHTCCCHHHHHHHHHTTTTTT--TCS
T ss_pred             EC---------------------CCcEEEEEcHHHHHHHHHhcCCCCCcHHHHHHHHCcCHHHHHHHHHHHHhcc--cce
Confidence            86                     3578999999999999999999999999999999999999999999999776  468


Q ss_pred             eeecCCCCCCCCCCeEEEecCCCCCceeEEEeccccC
Q psy11818        171 LIRYPKTKEIEPNHVFFVNDSFTSKLHRVKIQTVAAK  207 (331)
Q Consensus       171 L~~~~~~~~i~~~~~f~lN~~F~~k~~ki~i~~~~~k  207 (331)
                      |.+.+.+.++.+++.|.+|.+|+++++|++|+.+++|
T Consensus       237 L~~~~~~~~~~~~~~~~~N~~F~~k~~kiki~~~~~~  273 (273)
T d2hyec3         237 LIKSPKGKEVEDGDKFIFNGEFKHKLFRIKINQIQMK  273 (273)
T ss_dssp             EEETTCSSSCCSSCEEEECCCCCCSCSSEECGGGGGC
T ss_pred             eeecCCCCcCCCCCEEEEeccCCCCCeEEeecccccC
Confidence            9998888889999999999999999999999987543
>d1ldja3 e.40.1.1 (A:411-686) Cullin homolog 1, cul-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ldja1 a.4.5.34 (A:687-776) Anaphase promoting complex (APC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyec1 a.4.5.34 (C:676-759) Cullin-4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iuya_ a.4.5.34 (A:) Cullin-3 homologue {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ldja3 e.40.1.1 (A:411-686) Cullin homolog 1, cul-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyec3 e.40.1.1 (C:403-675) Cullin-4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lnwa_ a.4.5.28 (A:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2etha1 a.4.5.28 (A:1-140) Putative transcriptional regulator TM0816 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2a61a1 a.4.5.28 (A:5-143) Transcriptional regulator TM0710 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lj9a_ a.4.5.28 (A:) Transcriptional regulator SlyA {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ylfa1 a.4.5.55 (A:5-142) Hypothetical protein BC1842 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2frha1 a.4.5.28 (A:102-216) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1z91a1 a.4.5.28 (A:8-144) Organic hydroperoxide resistance transcriptional regulator OhrR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jgsa_ a.4.5.28 (A:) Multiple antibiotic resistance repressor, MarR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fbia1 a.4.5.28 (A:5-140) Probable transcriptional regulator PA4135 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1s3ja_ a.4.5.28 (A:) Putative transcriptional regulator YusO {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1hsja1 a.4.5.28 (A:373-487) Staphylococcal accessory regulator A homolog, SarR {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d3broa1 a.4.5.28 (A:3-137) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]} Back     information, alignment and structure
>d1p4xa2 a.4.5.28 (A:126-250) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1p4xa1 a.4.5.28 (A:1-125) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2hr3a1 a.4.5.28 (A:2-146) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fxaa1 a.4.5.28 (A:6-167) Protease production regulatory protein Hpr {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bv6a1 a.4.5.28 (A:5-140) Transcriptional regulator MgrA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2fbha1 a.4.5.28 (A:8-144) Transcriptional regulator PA3341 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dpua_ a.4.5.16 (A:) C-terminal domain of RPA32 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tw3a1 a.4.5.29 (A:14-98) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d3deua1 a.4.5.28 (A:2-141) Transcriptional regulator SlyA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1u2wa1 a.4.5.5 (A:12-119) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]} Back     information, alignment and structure
>d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r1ua_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure