Psyllid ID: psy11866

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-----

MSFRFQAYFNNDSWVRYFLHSGHLTIAGCKMSKSLKNFITIQDALNKHTARQLRLAFLLHAWHQTLDYSDNTMEMAVTYEKLLNEFFLNVKDHIRNLKFPATTVSSFEKWTQADLELSTRFIQTKNNVHAALCDNMDTRSALDSIRDCISQVNIYLRGTPNQLLLRDIGAYVTKILTVFGCIGDVKNIGFPLGGTGVESTNLEELVLPYLTILSEFRDNIRTEARLIKSTEILNQCDRLRDEVLPNVGVRLEDIE

cccccccccccccEEcccccccccccccccccccccccccHHHHHHcccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccEEcccc

cccHHHHHcccccEEEEEEEccEEEEcccccccccccEEEHHHHHHHccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccEEcccc

msfrfqayfnndsWVRYFLHSGHLTIAGCKMSKSLKNFITIQDALNKHTARQLRLAFLLHAWHQTLDYSDNTMEMAVTYEKLLNEFFLNVKDHirnlkfpattvssfekWTQADLELSTRFIQTKNNVHAALCDNMDTRSALDSIRDCISQVNIylrgtpnqllLRDIGAYVTKILTVFGcigdvknigfplggtgvestnleelvlpYLTILSEFRDNIRTEARLIKSTEILNQCDRlrdevlpnvgvrledie

MSFRFQAYFNNDSWVRYFLHSGHLTIAGCKMSKSLKNFITIQDALNKHTARQLRLAFLLHAWHQTLDYSDNTMEMAVTYEKLLNEFFLNVKDHIRNLKFPATTVSSFEKWTQADLELSTRFIQTKNNVHAALCDNMDTRSALDSIRDCISQVNIYlrgtpnqllLRDIGAYVTKILTVFGCIGDVKNIGFPLGGTGVESTNLEELVLPYLTILSEFRDNIRTEARLIKsteilnqcdrlrdevlpnvgvrledie

***RFQAYFNNDSWVRYFLHSGHLTIAGCKMSKSLKNFITIQDALNKHTARQLRLAFLLHAWHQTLDYSDNTMEMAVTYEKLLNEFFLNVKDHIRNLKFPATTVSSFEKWTQADLELSTRFIQTKNNVHAALCDNMDTRSALDSIRDCISQVNIYLRGTPNQLLLRDIGAYVTKILTVFGCIGDVKNIGFPLGGTGVESTNLEELVLPYLTILSEFRDNIRTEARLIKSTEILNQCDRLRDEVLPNVGV******

MSFRFQAYFNNDSWVRYFLHSGHLTIAGCKMSKSLKNFITIQDALNKHTARQLRLAFLLHAWHQTLDYSDNTMEMAVTYEKLLNEFFLNVKDHIRNLKF**********WTQADLELSTRFIQTKNNVHAALCDNMDTRSALDSIRDCISQVNIYLRGTPNQLLLRDIGAYVTKILTVFGCIGDVKNI***************ELVLPYLTILSEFRDNIRTEARLIKSTEILNQCDRLRDEVLPNVGVRLEDI*

*S**FQAYFNNDSWVRYFLHSGHLTIAGCKMSKSLKNFITIQDALNKHTARQLRLAFLLHAWHQTLDYSDNTMEMAVTYEKLLNEFFLNVKDHIRNLKFPATTVSSFEKWTQADLELSTRFIQTKNNVHAALCDNMDTRSALDSIRDCISQVNIYLRGTPNQLLLRDIGAYVTKILTVFGCIGDVKNIGFPLGGT**ESTNLEELVLPYLTILSEFRDNIRTEARLIKSTEILNQCDRLRDEVLPNVGVRLE***

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		255	2.2.26 [Sep-21-2011]
Q5M7N8		747	Cysteine--tRNA ligase, cy	yes	N/A	0.964	0.329	0.582	3e-81
Q4R550		748	Cysteine--tRNA ligase, cy	N/A	N/A	0.964	0.328	0.558	7e-81
Q5F408		748	Cysteine--tRNA ligase, cy	yes	N/A	0.964	0.328	0.566	7e-81
P49589		748	Cysteine--tRNA ligase, cy	yes	N/A	0.964	0.328	0.562	1e-80
Q9ER72		831	Cysteine--tRNA ligase, cy	yes	N/A	0.964	0.296	0.558	3e-80
Q7ZWR2		747	Cysteine--tRNA ligase, cy	N/A	N/A	0.964	0.329	0.566	3e-79
Q291L4		741	Cysteine--tRNA ligase, cy	yes	N/A	0.968	0.333	0.556	8e-76
Q7KN90		741	Cysteine--tRNA ligase, cy	yes	N/A	0.968	0.333	0.556	9e-75
Q54KR1		660	Cysteine--tRNA ligase, cy	yes	N/A	0.937	0.362	0.392	2e-47
P53852		767	Cysteine--tRNA ligase OS=	yes	N/A	0.956	0.318	0.376	1e-40

>sp\|Q5M7N8\|SYCC_XENTR Cysteine--tRNA ligase, cytoplasmic OS=Xenopus tropicalis GN=cars PE=2 SV=1	Back alignment and function desciption

 Score =  301 bits (771), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 149/256 (58%), Positives = 184/256 (71%), Gaps = 10/256 (3%)

Query: 6   QAYFNNDSWVRYFLHSGHLTIAGCKMSKSLKNFITIQDALNKHTARQLRLAFLLHAWHQT 65
           +AYF+ND WVRYFLH+GHLTIAGCKMSKSLKNFITI+DAL K+TARQLRLAFL+HAW  T
Sbjct: 381 EAYFDNDHWVRYFLHTGHLTIAGCKMSKSLKNFITIKDALQKNTARQLRLAFLMHAWKDT 440

Query: 66  LDYSDNTMEMAVTYEKLLNEFFLNVKDHIRNLKFPATTVSSFEKWTQADLELSTRFIQTK 125
           LDYS NTME AV YEK +NEFFLNVKD +R    P      F KW   +LEL++ F   K
Sbjct: 441 LDYSSNTMESAVQYEKFMNEFFLNVKDLLRA---PTDVTGQFVKWEVPELELNSCFYSKK 497

Query: 126 NNVHAALCDNMDTRSALDSIRDCISQVNIYL------RGTPNQLLLRDIGAYVTKILTVF 179
             VH ALCDN+DTR+ ++ +R  +SQ N Y+      +  PN+LLLR + +Y+T +L VF
Sbjct: 498 AAVHEALCDNIDTRTVMEEMRSLVSQCNSYIASRKAAKQPPNRLLLRSVSSYLTAMLKVF 557

Query: 180 GCIGDVKNIGFPLGGTGVESTNLEELVLPYLTILSEFRDNIRTEARLIKSTEILNQCDRL 239
           G I   + IGFP+GG+   S NLE  V+PYL +LS+FR+ +R  AR  K TE+L   D L
Sbjct: 558 GAIEGEEVIGFPIGGSD-NSMNLESTVMPYLQVLSQFREGVRQIARQHKVTEVLQLSDLL 616

Query: 240 RDEVLPNVGVRLEDIE 255
           RD+VLP +GVRLED E
Sbjct: 617 RDDVLPELGVRLEDHE 632

Xenopus tropicalis (taxid: 8364)
EC: 6EC: .EC: 1EC: .EC: 1EC: .EC: 1EC: 6

>sp\|Q4R550\|SYCC_MACFA Cysteine--tRNA ligase, cytoplasmic OS=Macaca fascicularis GN=CARS PE=2 SV=1	Back alignment and function description

>sp\|Q5F408\|SYCC_CHICK Cysteine--tRNA ligase, cytoplasmic OS=Gallus gallus GN=CARS PE=2 SV=1	Back alignment and function description

>sp\|P49589\|SYCC_HUMAN Cysteine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=CARS PE=1 SV=3	Back alignment and function description

>sp\|Q9ER72\|SYCC_MOUSE Cysteine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Cars PE=1 SV=2	Back alignment and function description

>sp\|Q7ZWR2\|SYCC_XENLA Cysteine--tRNA ligase, cytoplasmic OS=Xenopus laevis GN=cars PE=2 SV=1	Back alignment and function description

>sp\|Q291L4\|SYCC_DROPS Cysteine--tRNA ligase, cytoplasmic OS=Drosophila pseudoobscura pseudoobscura GN=Aats-cys PE=3 SV=1	Back alignment and function description

>sp\|Q7KN90\|SYCC_DROME Cysteine--tRNA ligase, cytoplasmic OS=Drosophila melanogaster GN=Aats-cys PE=1 SV=1	Back alignment and function description

>sp\|Q54KR1\|SYCC_DICDI Cysteine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=cysS PE=3 SV=1	Back alignment and function description

>sp\|P53852\|SYC_YEAST Cysteine--tRNA ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL247W PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		255
156547291		735	PREDICTED: cysteinyl-tRNA synthetase, cy	0.976	0.338	0.630	4e-90
270000778		730	hypothetical protein TcasGA2_TC011023 [T	0.972	0.339	0.607	2e-86
340715109		727	PREDICTED: cysteinyl-tRNA synthetase, cy	0.964	0.338	0.596	5e-86
383855614		727	PREDICTED: cysteine--tRNA ligase, cytopl	0.956	0.335	0.604	6e-86
383855612		733	PREDICTED: cysteine--tRNA ligase, cytopl	0.956	0.332	0.604	6e-86
350414712		727	PREDICTED: cysteinyl-tRNA synthetase, cy	0.964	0.338	0.592	8e-86
350414715		721	PREDICTED: cysteinyl-tRNA synthetase, cy	0.964	0.341	0.592	9e-86
189241753		734	PREDICTED: similar to cysteinyl-tRNA syn	0.980	0.340	0.602	1e-85
380019999		728	PREDICTED: cysteine--tRNA ligase, cytopl	0.960	0.336	0.609	2e-84
307210717		729	Cysteinyl-tRNA synthetase, cytoplasmic [	0.964	0.337	0.605	2e-84

>gi\|156547291\|ref\|XP_001606432.1\| PREDICTED: cysteinyl-tRNA synthetase, cytoplasmic-like [Nasonia vitripennis]	Back alignment and taxonomy information

 Score =  337 bits (863), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 159/252 (63%), Positives = 199/252 (78%), Gaps = 3/252 (1%)

Query: 6   QAYFNNDSWVRYFLHSGHLTIAGCKMSKSLKNFITIQDALNKHTARQLRLAFLLHAWHQT 65
           +AYF+N  WVRYFLHSGHLTI+GCKMSKSLKNFITI++AL KH+ARQLRLAFLLH+W  T
Sbjct: 372 EAYFDNSHWVRYFLHSGHLTISGCKMSKSLKNFITIKEALKKHSARQLRLAFLLHSWKDT 431

Query: 66  LDYSDNTMEMAVTYEKLLNEFFLNVKDHIRNLKFPATTVSSFEKWTQADLELSTRFIQTK 125
           LDY D TM+MAV YEK LNEFFLNVK  IR +    TT+++F+KW Q ++EL+ +F   K
Sbjct: 432 LDYGDATMDMAVQYEKFLNEFFLNVKCRIRKIGSAGTTINTFDKWGQQEVELNNKFCAAK 491

Query: 126 NNVHAALCDNMDTRSALDSIRDCISQVNIYLRG--TPNQLLLRDIGAYVTKILTVFGCIG 183
           ++VH ALCDN+DTR+ALD IR+ ++  NIY++    PN LLLRDI  Y+TKI TVFG I 
Sbjct: 492 DDVHNALCDNIDTRTALDIIRELVTTSNIYIKDCQKPNTLLLRDIAVYITKIFTVFGAIA 551

Query: 184 DVKNIGFPLGGTGVESTNLEELVLPYLTILSEFRDNIRTEARLIKSTEILNQCDRLRDEV 243
              +IGFPL     ++ NLEE ++PYL ILSEFR+ +R  ARL+K+T+IL +CDRLRD++
Sbjct: 552 THDSIGFPLEDES-KNVNLEETIMPYLEILSEFREKVRGHARLLKATDILQECDRLRDDI 610

Query: 244 LPNVGVRLEDIE 255
           LPNVGVRLED E
Sbjct: 611 LPNVGVRLEDQE 622

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|270000778\|gb\|EEZ97225.1\| hypothetical protein TcasGA2_TC011023 [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|340715109\|ref\|XP_003396062.1\| PREDICTED: cysteinyl-tRNA synthetase, cytoplasmic-like [Bombus terrestris]	Back alignment and taxonomy information

>gi\|383855614\|ref\|XP_003703305.1\| PREDICTED: cysteine--tRNA ligase, cytoplasmic-like isoform 2 [Megachile rotundata]	Back alignment and taxonomy information

>gi\|383855612\|ref\|XP_003703304.1\| PREDICTED: cysteine--tRNA ligase, cytoplasmic-like isoform 1 [Megachile rotundata]	Back alignment and taxonomy information

>gi\|350414712\|ref\|XP_003490395.1\| PREDICTED: cysteinyl-tRNA synthetase, cytoplasmic-like isoform 1 [Bombus impatiens]	Back alignment and taxonomy information

>gi\|350414715\|ref\|XP_003490396.1\| PREDICTED: cysteinyl-tRNA synthetase, cytoplasmic-like isoform 2 [Bombus impatiens]	Back alignment and taxonomy information

>gi\|189241753\|ref\|XP_968189.2\| PREDICTED: similar to cysteinyl-tRNA synthetase [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|380019999\|ref\|XP_003693886.1\| PREDICTED: cysteine--tRNA ligase, cytoplasmic-like [Apis florea]	Back alignment and taxonomy information

>gi\|307210717\|gb\|EFN87140.1\| Cysteinyl-tRNA synthetase, cytoplasmic [Harpegnathos saltator]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		255
ZFIN\|ZDB-GENE-030328-29		832	cars "cysteinyl-tRNA synthetas	0.956	0.293	0.570	1.2e-74
UNIPROTKB\|F1P1D9		739	CARS "Cysteine--tRNA ligase, c	0.964	0.332	0.566	6.5e-74
UNIPROTKB\|F1P1E0		740	CARS "Cysteine--tRNA ligase, c	0.964	0.332	0.566	6.5e-74
UNIPROTKB\|Q5F408		748	CARS "Cysteine--tRNA ligase, c	0.964	0.328	0.566	6.5e-74
UNIPROTKB\|Q5M7N8		747	cars "Cysteine--tRNA ligase, c	0.964	0.329	0.582	1.1e-73
UNIPROTKB\|Q4R550		748	CARS "Cysteine--tRNA ligase, c	0.964	0.328	0.558	2.8e-73
UNIPROTKB\|A8MVQ3		738	CARS "Cysteinyl-tRNA synthetas	0.964	0.333	0.562	5.9e-73
UNIPROTKB\|B4DKY1		739	CARS "Cysteine--tRNA ligase, c	0.964	0.332	0.562	5.9e-73
UNIPROTKB\|P49589		748	CARS "Cysteine--tRNA ligase, c	0.964	0.328	0.562	5.9e-73
UNIPROTKB\|A4FUC8		832	CARS "CARS protein" [Bos tauru	0.964	0.295	0.566	7.5e-73

ZFIN\|ZDB-GENE-030328-29 cars "cysteinyl-tRNA synthetase" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

 Score = 753 (270.1 bits), Expect = 1.2e-74, P = 1.2e-74
 Identities = 145/254 (57%), Positives = 185/254 (72%)

Query:     6 QAYFNNDSWVRYFLHSGHLTIAGCKMSKSLKNFITIQDALNKHTARQLRLAFLLHAWHQT 65
             +AYF ND WVRYFLH+GHLTIAGCKMSKSLKNFITI+DAL KHTARQLRLAFL+H+W  T
Sbjct:   468 EAYFENDYWVRYFLHTGHLTIAGCKMSKSLKNFITIKDALAKHTARQLRLAFLMHSWKDT 527

Query:    66 LDYSDNTMEMAVTYEKLLNEFFLNVKDHIRNLKFPATTVSSFEKWTQADLELSTRFIQTK 125
             LDYS+NTME A+ YE+ +NEFFLNVKD +R+   P      +EKW   ++EL+  F   K
Sbjct:   528 LDYSNNTMESAIQYERFINEFFLNVKDILRS---PTDITGQYEKWEAEEIELNKCFYDKK 584

Query:   126 NNVHAALCDNMDTRSALDSIRDCISQVNIYLRGT------PNQLLLRDIGAYVTKILTVF 179
              +VH ALCDN+DTRSAL+ +R  + Q N Y+         PN++LL+ I  Y+T +L  F
Sbjct:   585 TSVHGALCDNIDTRSALEEMRALVGQSNTYMAARRSAKLPPNRMLLQSIALYLTDMLKTF 644

Query:   180 GCIGDVKNIGFPLGGTGVESTNLEELVLPYLTILSEFRDNIRTEARLIKSTEILNQCDRL 239
             G I     IGFP+GG G +S +LE  V+PYL++LS+FR+++R  AR  K TE+L  CD+L
Sbjct:   645 GAIEGTDPIGFPVGGNG-QSADLESTVMPYLSVLSDFREDVRKIAREKKVTELLQLCDQL 703

Query:   240 RDEVLPNVGVRLED 253
             RD+ LP +GVRLED
Sbjct:   704 RDDTLPELGVRLED 717

GO:0000166 "nucleotide binding" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0006418 "tRNA aminoacylation for protein translation" evidence=IEA

GO:0004812 "aminoacyl-tRNA ligase activity" evidence=IEA

GO:0006423 "cysteinyl-tRNA aminoacylation" evidence=IEA;IBA

GO:0004817 "cysteine-tRNA ligase activity" evidence=IEA;IBA

GO:0005737 "cytoplasm" evidence=IEA

GO:0005829 "cytosol" evidence=IBA

UNIPROTKB\|F1P1D9 CARS "Cysteine--tRNA ligase, cytoplasmic" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|F1P1E0 CARS "Cysteine--tRNA ligase, cytoplasmic" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5F408 CARS "Cysteine--tRNA ligase, cytoplasmic" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5M7N8 cars "Cysteine--tRNA ligase, cytoplasmic" [Xenopus (Silurana) tropicalis (taxid:8364)]	Back alignment and assigned GO terms

UNIPROTKB\|Q4R550 CARS "Cysteine--tRNA ligase, cytoplasmic" [Macaca fascicularis (taxid:9541)]	Back alignment and assigned GO terms

UNIPROTKB\|A8MVQ3 CARS "Cysteinyl-tRNA synthetase, isoform CRA_b" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|B4DKY1 CARS "Cysteine--tRNA ligase, cytoplasmic" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|P49589 CARS "Cysteine--tRNA ligase, cytoplasmic" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|A4FUC8 CARS "CARS protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q5F408	SYCC_CHICK	6, ., 1, ., 1, ., 1, 6	0.5664	0.9647	0.3288	yes	N/A
Q291L4	SYCC_DROPS	6, ., 1, ., 1, ., 1, 6	0.5568	0.9686	0.3333	yes	N/A
Q9ER72	SYCC_MOUSE	6, ., 1, ., 1, ., 1, 6	0.5585	0.9647	0.2960	yes	N/A
Q7KN90	SYCC_DROME	6, ., 1, ., 1, ., 1, 6	0.5568	0.9686	0.3333	yes	N/A
P49589	SYCC_HUMAN	6, ., 1, ., 1, ., 1, 6	0.5625	0.9647	0.3288	yes	N/A
Q5M7N8	SYCC_XENTR	6, ., 1, ., 1, ., 1, 6	0.5820	0.9647	0.3293	yes	N/A

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	6.1.1	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		255
PTZ00399		651	PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro	3e-90
COG0215		464	COG0215, CysS, Cysteinyl-tRNA synthetase [Translat	1e-34
PRK00260		463	PRK00260, cysS, cysteinyl-tRNA synthetase; Validat	2e-28
cd00672		213	cd00672, CysRS_core, catalytic core domain of cyst	5e-27
TIGR00435		464	TIGR00435, cysS, cysteinyl-tRNA synthetase	5e-22
pfam01406		301	pfam01406, tRNA-synt_1e, tRNA synthetases class I	2e-21
COG0143		558	COG0143, MetG, Methionyl-tRNA synthetase [Translat	1e-09
PRK12300		897	PRK12300, leuS, leucyl-tRNA synthetase; Reviewed	3e-09
PRK14535		699	PRK14535, cysS, cysteinyl-tRNA synthetase; Provisi	2e-07
PLN02946		557	PLN02946, PLN02946, cysteine-tRNA ligase	3e-07
TIGR00395		938	TIGR00395, leuS_arch, leucyl-tRNA synthetase, arch	8e-07
COG0495		814	COG0495, LeuS, Leucyl-tRNA synthetase [Translation	4e-06
PRK14536		490	PRK14536, cysS, cysteinyl-tRNA synthetase; Provisi	6e-06
cd00812		314	cd00812, LeuRS_core, catalytic core domain of leuc	2e-05
TIGR00398		530	TIGR00398, metG, methionyl-tRNA synthetase	4e-05
PLN02959		1084	PLN02959, PLN02959, aminoacyl-tRNA ligase	6e-05
cd00814		319	cd00814, MetRS_core, catalytic core domain of meth	4e-04
PRK12268		556	PRK12268, PRK12268, methionyl-tRNA synthetase; Rev	4e-04
COG0060		933	COG0060, IleS, Isoleucyl-tRNA synthetase [Translat	5e-04
pfam09334		388	pfam09334, tRNA-synt_1g, tRNA synthetases class I	0.001

>gnl\|CDD\|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional	Back alignment and domain information

 Score =  279 bits (716), Expect = 3e-90
 Identities = 118/260 (45%), Positives = 157/260 (60%), Gaps = 21/260 (8%)

Query: 6   QAYFNNDSWVRYFLHSGHLTIAGCKMSKSLKNFITIQDALNKHTARQLRLAFLLHAWHQT 65
           +AYF+   WV YFLHSGHL I G KMSKSLKNFITI+ AL+K+TARQ+RL FLLH W + 
Sbjct: 291 EAYFDKHQWVNYFLHSGHLHIKGLKMSKSLKNFITIRQALSKYTARQIRLLFLLHKWDKP 350

Query: 66  LDYSDNTMEMAVTYEKLLNEFFLNVKDHIRNLKFPATTVSSFEKWTQADLELSTRFIQTK 125
           ++YSD +M+ A+  +K+   FF NVK  +R        ++S +KWTQ D EL+  F +TK
Sbjct: 351 MNYSDESMDEAIEKDKVFFNFFANVKIKLRES-----ELTSPQKWTQHDFELNELFEETK 405

Query: 126 NNVHAALCDNMDTRSALDSIRDCISQVNIYLRG--TPNQLLLRDIGAYVTKILTVFGCIG 183
           + VHAAL DN DT  AL +++  IS  N YL     P+  LLR +  YVTKIL++FG + 
Sbjct: 406 SAVHAALLDNFDTPEALQALQKLISATNTYLNSGEQPSAPLLRSVAQYVTKILSIFGLVE 465

Query: 184 DVKNIGFPLGGTGVESTNLEELVLPYLTILSEFRDNIRTEAR-------LIKSTE-ILNQ 235
               +G           +  E   P L  L  FRD +R  A+       L K  + +L  
Sbjct: 466 GSDGLGSQ------GQNSTSENFKPLLEALLRFRDEVRDAAKAEMKLISLDKKKKQLLQL 519

Query: 236 CDRLRDEVLPNVGVRLEDIE 255
           CD+LRDE LPN+G+R+ED  
Sbjct: 520 CDKLRDEWLPNLGIRIEDKP 539

Length = 651

>gnl\|CDD\|223293 COG0215, CysS, Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|234705 PRK00260, cysS, cysteinyl-tRNA synthetase; Validated	Back alignment and domain information

>gnl\|CDD\|173899 cd00672, CysRS_core, catalytic core domain of cysteinyl tRNA synthetase	Back alignment and domain information

>gnl\|CDD\|232974 TIGR00435, cysS, cysteinyl-tRNA synthetase	Back alignment and domain information

>gnl\|CDD\|216482 pfam01406, tRNA-synt_1e, tRNA synthetases class I (C) catalytic domain	Back alignment and domain information

>gnl\|CDD\|223221 COG0143, MetG, Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|237049 PRK12300, leuS, leucyl-tRNA synthetase; Reviewed	Back alignment and domain information

>gnl\|CDD\|173001 PRK14535, cysS, cysteinyl-tRNA synthetase; Provisional	Back alignment and domain information

>gnl\|CDD\|178532 PLN02946, PLN02946, cysteine-tRNA ligase	Back alignment and domain information

>gnl\|CDD\|232955 TIGR00395, leuS_arch, leucyl-tRNA synthetase, archaeal and cytosolic family	Back alignment and domain information

>gnl\|CDD\|223569 COG0495, LeuS, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|184731 PRK14536, cysS, cysteinyl-tRNA synthetase; Provisional	Back alignment and domain information

>gnl\|CDD\|173906 cd00812, LeuRS_core, catalytic core domain of leucyl-tRNA synthetases	Back alignment and domain information

>gnl\|CDD\|232957 TIGR00398, metG, methionyl-tRNA synthetase	Back alignment and domain information

>gnl\|CDD\|215518 PLN02959, PLN02959, aminoacyl-tRNA ligase	Back alignment and domain information

>gnl\|CDD\|173907 cd00814, MetRS_core, catalytic core domain of methioninyl-tRNA synthetases	Back alignment and domain information

>gnl\|CDD\|237029 PRK12268, PRK12268, methionyl-tRNA synthetase; Reviewed	Back alignment and domain information

>gnl\|CDD\|223138 COG0060, IleS, Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|220185 pfam09334, tRNA-synt_1g, tRNA synthetases class I (M)	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		255
COG0215		464	CysS Cysteinyl-tRNA synthetase [Translation, ribos	100.0
PTZ00399		651	cysteinyl-tRNA-synthetase; Provisional	100.0
KOG2007\|consensus		586		100.0
PRK00260		463	cysS cysteinyl-tRNA synthetase; Validated	100.0
PLN02946		557	cysteine-tRNA ligase	100.0
PRK14535		699	cysS cysteinyl-tRNA synthetase; Provisional	100.0
TIGR00435		465	cysS cysteinyl-tRNA synthetase. This model finds t	100.0
PRK14536		490	cysS cysteinyl-tRNA synthetase; Provisional	100.0
PRK14534		481	cysS cysteinyl-tRNA synthetase; Provisional	100.0
PRK12418		384	cysteinyl-tRNA synthetase; Provisional	99.97
TIGR03447		411	mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino-	99.97
PF01406		300	tRNA-synt_1e: tRNA synthetases class I (C) catalyt	99.94
PRK11893		511	methionyl-tRNA synthetase; Reviewed	99.94
TIGR00395		938	leuS_arch leucyl-tRNA synthetase, archaeal and cyt	99.94
KOG0436\|consensus		578		99.94
PRK12300		897	leuS leucyl-tRNA synthetase; Reviewed	99.93
COG0143		558	MetG Methionyl-tRNA synthetase [Translation, ribos	99.93
PRK12267		648	methionyl-tRNA synthetase; Reviewed	99.93
PLN02610		801	probable methionyl-tRNA synthetase	99.92
PLN02224		616	methionine-tRNA ligase	99.92
PRK13208		800	valS valyl-tRNA synthetase; Reviewed	99.92
PLN02843		974	isoleucyl-tRNA synthetase	99.92
PRK13804		961	ileS isoleucyl-tRNA synthetase; Provisional	99.92
PLN02943		958	aminoacyl-tRNA ligase	99.91
PLN02882		1159	aminoacyl-tRNA ligase	99.91
PRK05743		912	ileS isoleucyl-tRNA synthetase; Reviewed	99.91
TIGR00398		530	metG methionyl-tRNA synthetase. The methionyl-tRNA	99.91
PRK12268		556	methionyl-tRNA synthetase; Reviewed	99.91
PRK14900		1052	valS valyl-tRNA synthetase; Provisional	99.9
PRK05729		874	valS valyl-tRNA synthetase; Reviewed	99.9
COG0060		933	IleS Isoleucyl-tRNA synthetase [Translation, ribos	99.9
PRK00133		673	metG methionyl-tRNA synthetase; Reviewed	99.9
TIGR00422		861	valS valyl-tRNA synthetase. The valyl-tRNA synthet	99.9
PTZ00427		1205	isoleucine-tRNA ligase, putative; Provisional	99.9
COG0525		877	ValS Valyl-tRNA synthetase [Translation, ribosomal	99.9
TIGR00392		861	ileS isoleucyl-tRNA synthetase. The isoleucyl tRNA	99.89
PRK06039		975	ileS isoleucyl-tRNA synthetase; Reviewed	99.89
PLN02959		1084	aminoacyl-tRNA ligase	99.86
PRK00390		805	leuS leucyl-tRNA synthetase; Validated	99.86
PLN02381		1066	valyl-tRNA synthetase	99.85
PTZ00419		995	valyl-tRNA synthetase-like protein; Provisional	99.85
cd00672		213	CysRS_core catalytic core domain of cysteinyl tRNA	99.84
TIGR00396		842	leuS_bact leucyl-tRNA synthetase, eubacterial and	99.83
COG0495		814	LeuS Leucyl-tRNA synthetase [Translation, ribosoma	99.8
PLN02563		963	aminoacyl-tRNA ligase	99.78
TIGR00456		566	argS arginyl-tRNA synthetase. This model recognize	99.77
KOG0433\|consensus		937		99.76
cd07963		156	Anticodon_Ia_Cys Anticodon-binding domain of cyste	99.74
KOG0432\|consensus		995		99.72
PRK01611		507	argS arginyl-tRNA synthetase; Reviewed	99.71
PF09334		391	tRNA-synt_1g: tRNA synthetases class I (M); InterP	99.67
cd00668		312	Ile_Leu_Val_MetRS_core catalytic core domain of is	99.67
cd00818		338	IleRS_core catalytic core domain of isoleucyl-tRNA	99.59
KOG0434\|consensus		1070		99.58
PF00133		601	tRNA-synt_1: tRNA synthetases class I (I, L, M and	99.56
cd00817		382	ValRS_core catalytic core domain of valyl-tRNA syn	99.55
cd00814		319	MetRS_core catalytic core domain of methioninyl-tR	99.55
PRK12451		562	arginyl-tRNA synthetase; Reviewed	99.53
cd00812		314	LeuRS_core catalytic core domain of leucyl-tRNA sy	99.52
TIGR00467		515	lysS_arch lysyl-tRNA synthetase, archaeal and spir	99.5
KOG0435\|consensus		876		99.46
KOG1247\|consensus		567		99.4
PRK00750		510	lysK lysyl-tRNA synthetase; Reviewed	99.37
cd00674		353	LysRS_core_class_I catalytic core domain of class	99.37
KOG0437\|consensus		1080		99.36
PLN02286		576	arginine-tRNA ligase	99.35
COG0018		577	ArgS Arginyl-tRNA synthetase [Translation, ribosom	99.33
PF09190		63	DALR_2: DALR domain; InterPro: IPR015273 The amino	98.95
PF01921		360	tRNA-synt_1f: tRNA synthetases class I (K); InterP	98.86
smart00840		56	DALR_2 This DALR domain is found in cysteinyl-tRNA	98.71
COG1384		521	LysS Lysyl-tRNA synthetase (class I) [Translation,	98.69
cd07956		156	Anticodon_Ia_Arg Anticodon-binding domain of argin	98.54
cd07958		117	Anticodon_Ia_Leu_BEm Anticodon-binding domain of b	98.25
cd07957		129	Anticodon_Ia_Met Anticodon-binding domain of methi	98.1
cd07959		117	Anticodon_Ia_Leu_AEc Anticodon-binding domain of a	98.02
PRK04156		567	gltX glutamyl-tRNA synthetase; Provisional	97.96
cd07962		135	Anticodon_Ia_Val Anticodon-binding domain of valyl	97.9
cd07955		81	Anticodon_Ia_Cys_like Anticodon-binding domain of	97.84
PF00750		354	tRNA-synt_1d: tRNA synthetases class I (R); InterP	97.77
cd07375		117	Anticodon_Ia_like Anticodon-binding domain of clas	97.7
cd07960		180	Anticodon_Ia_Ile_BEm Anticodon-binding domain of b	97.57
cd07961		183	Anticodon_Ia_Ile_ABEc Anticodon-binding domain of	97.18
PF05746		119	DALR_1: DALR anticodon binding domain; InterPro: I	96.86
KOG1195\|consensus		567		96.66
PF08264		153	Anticodon_1: Anticodon-binding domain of tRNA; Int	96.53
cd00418		230	GlxRS_core catalytic core domain of glutamyl-tRNA	96.51
cd00808		239	GluRS_core catalytic core domain of discriminating	96.48
TIGR00464		470	gltX_bact glutamyl-tRNA synthetase, bacterial fami	95.37
cd09287		240	GluRS_non_core catalytic core domain of non-discri	95.29
cd00805		269	TyrRS_core catalytic core domain of tyrosinyl-tRNA	95.13
KOG4426\|consensus		656		95.04
smart00836		122	DALR_1 DALR anticodon binding domain. This all alp	94.87
cd00395		273	Tyr_Trp_RS_core catalytic core domain of tyrosinyl	94.73
PRK01406		476	gltX glutamyl-tRNA synthetase; Reviewed	94.7
cd00807		238	GlnRS_core catalytic core domain of glutaminyl-tRN	94.48
PLN03233		523	putative glutamate-tRNA ligase; Provisional	94.41
PRK12556		332	tryptophanyl-tRNA synthetase; Provisional	94.35
TIGR00440		522	glnS glutaminyl-tRNA synthetase. This protein is a	94.13
PRK12283		398	tryptophanyl-tRNA synthetase; Reviewed	93.8
PRK12282		333	tryptophanyl-tRNA synthetase II; Reviewed	93.69
TIGR00233		328	trpS tryptophanyl-tRNA synthetase. This model repr	93.43
PRK12284		431	tryptophanyl-tRNA synthetase; Reviewed	93.03
PRK05347		554	glutaminyl-tRNA synthetase; Provisional	92.56
PRK13354		410	tyrosyl-tRNA synthetase; Provisional	92.53
PF00579		292	tRNA-synt_1b: tRNA synthetases class I (W and Y);	92.06
COG0180		314	TrpS Tryptophanyl-tRNA synthetase [Translation, ri	92.03
PRK05912		408	tyrosyl-tRNA synthetase; Validated	91.93
PLN02859		788	glutamine-tRNA ligase	91.91
PTZ00402		601	glutamyl-tRNA synthetase; Provisional	91.7
PRK14895		513	gltX glutamyl-tRNA synthetase; Provisional	91.47
PRK12410		433	glutamylglutaminyl-tRNA synthetase; Provisional	91.39
cd00806		280	TrpRS_core catalytic core domain of tryptophanyl-t	91.35
PRK12285		368	tryptophanyl-tRNA synthetase; Reviewed	91.05
PRK14703		771	glutaminyl-tRNA synthetase/YqeY domain fusion prot	90.67
PRK12558		445	glutamyl-tRNA synthetase; Provisional	90.51
PLN02907		722	glutamate-tRNA ligase	90.38
PRK00927		333	tryptophanyl-tRNA synthetase; Reviewed	86.66
PTZ00437		574	glutaminyl-tRNA synthetase; Provisional	86.32
PTZ00126		383	tyrosyl-tRNA synthetase; Provisional	86.19
PLN02627		535	glutamyl-tRNA synthetase	85.8
PLN02486		383	aminoacyl-tRNA ligase	84.67
PRK08560		329	tyrosyl-tRNA synthetase; Validated	84.4
COG0162		401	TyrS Tyrosyl-tRNA synthetase [Translation, ribosom	83.97
COG0008		472	GlnS Glutamyl- and glutaminyl-tRNA synthetases [Tr	81.31
TIGR00234		377	tyrS tyrosyl-tRNA synthetase. This tyrosyl-tRNA sy	80.3

>COG0215 CysS Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

Probab=100.00  E-value=7.2e-50  Score=356.27  Aligned_cols=215  Identities=28%  Similarity=0.362  Sum_probs=163.9

Q ss_pred             ccccccccCCCcccceeeeeeEeeecCccccccCCCccCHHHHHhhcChhHHHHHHhccCCCCCcccChhHHHHHHHHHH
Q psy11866          2 SFRFQAYFNNDSWVRYFLHSGHLTIAGCKMSKSLKNFITIQDALNKHTARQLRLAFLLHAWHQTLDYSDNTMEMAVTYEK   81 (255)
Q Consensus         2 ~AQs~a~~~~~~~~~~~~h~g~l~~~g~KMSKSlGN~i~~~d~l~~~~~d~lR~~ll~~~y~~~~~fs~~~l~~a~~~~~   81 (255)
                      ||||+|++|..||+|||||+|||+++|+|||||||||+|++|++++|+|+++|||||++|||+|++||++.|++|.+..+
T Consensus       240 iAQsea~~g~~~~a~yWmH~G~l~i~geKMSKSLGNfiti~d~l~~~~p~~lR~~lls~HYR~pl~fsee~L~~A~~~l~  319 (464)
T COG0215         240 IAQSEAATGVKPFAKYWMHNGFLNIDGEKMSKSLGNFITVRDLLKKYDPEVLRLFLLSSHYRSPLDFSEELLEEAKKALE  319 (464)
T ss_pred             HHHHHhhhCCCcceeEeEEcceeeecCcCcccccCCeeEHHHHHhhcCHHHHHHHHHHHHhCCccccCHHHHHHHHHHHH
Confidence            79999999988999999999999999999999999999999999999999999999999999999999999999987555


Q ss_pred             HHHHHHHHHHHHHhhccCCCCCccccccCCHHHHHHHHHHHHHHHHHHHHHhccCCHHHHHHHHHHHHHHHhhhhhcCCC
Q psy11866         82 LLNEFFLNVKDHIRNLKFPATTVSSFEKWTQADLELSTRFIQTKNNVHAALCDNMDTRSALDSIRDCISQVNIYLRGTPN  161 (255)
Q Consensus        82 ~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~al~dd~~~~~al~~l~~l~~~~N~~~~~~~~  161 (255)
                      ++.+++.++....   ...        ..  .      ...++...|.++|+||||||.|++.|+++++.+|...+....
T Consensus       320 rl~~~~~~~~~~~---~~~--------~~--~------~~~~~~~~f~~al~DDfnt~~al~~l~~l~~~~~~~~~~~~~  380 (464)
T COG0215         320 RLYNALRRLRDLA---GDA--------EL--A------DLKEFEARFREALDDDFNTPKALAVLFELAKEINRLLEEGKS  380 (464)
T ss_pred             HHHHHHHHHHhhc---ccc--------cc--c------hhHHHHHHHHHHHHhccCcHHHHHHHHHHHHHHhhhhhcccc
Confidence            5555544433111   000        00  0      234556779999999999999999999999999887664211


Q ss_pred             HHHHHHHHHHHHHhhhcccc--ccCCccccccCCCCCCCCCChhHhHHHHHHHHHHHHHHHHHHHHhcCchHHHHHhhHh
Q psy11866        162 QLLLRDIGAYVTKILTVFGC--IGDVKNIGFPLGGTGVESTNLEELVLPYLTILSEFRDNIRTEARLIKSTEILNQCDRL  239 (255)
Q Consensus       162 ~~~l~~~~~~~~~~~~ilGi--~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~l~~~r~~~R~~ar~~k~~~~~~~aD~i  239 (255)
                        ....++..+..++.+||+  +...+..+.       .   .++.....|+.|+    +.|.+||+.|+   |++||+|
T Consensus       381 --~~~~~~~~~~~~~~~lg~~~l~~~~~~~~-------~---~~~~~~~~i~~Li----~~R~~aR~~K~---~~~AD~i  441 (464)
T COG0215         381 --DAKAVLSALKALLAILGLKVLGLFPQSGA-------Q---EDESDDEEIEALI----EERLEARKAKN---WALADEI  441 (464)
T ss_pred             --chHHHHHHHHHHHHHhCchhhcccccccc-------c---cccchHHHHHHHH----HHHHHHHHhhC---HHHHHHH
Confidence              123444455556666663  111111100       0   0111334677777    68999999999   8999999


Q ss_pred             hhcCCCCCCceeccCC
Q psy11866        240 RDEVLPNVGVRLEDIE  255 (255)
Q Consensus       240 R~~~L~~~Gi~l~D~~  255 (255)
                      |++ |.++||.|+|+|
T Consensus       442 Rd~-L~~~Gi~leD~~  456 (464)
T COG0215         442 RDE-LLALGIILEDTP  456 (464)
T ss_pred             HHH-HHHCCcEEEECC
Confidence            999 799999999986

>PTZ00399 cysteinyl-tRNA-synthetase; Provisional	Back alignment and domain information

>KOG2007\|consensus	Back alignment and domain information

>PRK00260 cysS cysteinyl-tRNA synthetase; Validated	Back alignment and domain information

>PLN02946 cysteine-tRNA ligase	Back alignment and domain information

>PRK14535 cysS cysteinyl-tRNA synthetase; Provisional	Back alignment and domain information

>TIGR00435 cysS cysteinyl-tRNA synthetase	Back alignment and domain information

>PRK14536 cysS cysteinyl-tRNA synthetase; Provisional	Back alignment and domain information

>PRK14534 cysS cysteinyl-tRNA synthetase; Provisional	Back alignment and domain information

>PRK12418 cysteinyl-tRNA synthetase; Provisional	Back alignment and domain information

>TIGR03447 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase	Back alignment and domain information

>PF01406 tRNA-synt_1e: tRNA synthetases class I (C) catalytic domain; InterPro: IPR015803 The aminoacyl-tRNA synthetases (6	Back alignment and domain information

>PRK11893 methionyl-tRNA synthetase; Reviewed	Back alignment and domain information

>TIGR00395 leuS_arch leucyl-tRNA synthetase, archaeal and cytosolic family	Back alignment and domain information

>KOG0436\|consensus	Back alignment and domain information

>PRK12300 leuS leucyl-tRNA synthetase; Reviewed	Back alignment and domain information

>COG0143 MetG Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK12267 methionyl-tRNA synthetase; Reviewed	Back alignment and domain information

>PLN02610 probable methionyl-tRNA synthetase	Back alignment and domain information

>PLN02224 methionine-tRNA ligase	Back alignment and domain information

>PRK13208 valS valyl-tRNA synthetase; Reviewed	Back alignment and domain information

>PLN02843 isoleucyl-tRNA synthetase	Back alignment and domain information

>PRK13804 ileS isoleucyl-tRNA synthetase; Provisional	Back alignment and domain information

>PLN02943 aminoacyl-tRNA ligase	Back alignment and domain information

>PLN02882 aminoacyl-tRNA ligase	Back alignment and domain information

>PRK05743 ileS isoleucyl-tRNA synthetase; Reviewed	Back alignment and domain information

>TIGR00398 metG methionyl-tRNA synthetase	Back alignment and domain information

>PRK12268 methionyl-tRNA synthetase; Reviewed	Back alignment and domain information

>PRK14900 valS valyl-tRNA synthetase; Provisional	Back alignment and domain information

>PRK05729 valS valyl-tRNA synthetase; Reviewed	Back alignment and domain information

>COG0060 IleS Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK00133 metG methionyl-tRNA synthetase; Reviewed	Back alignment and domain information

>TIGR00422 valS valyl-tRNA synthetase	Back alignment and domain information

>PTZ00427 isoleucine-tRNA ligase, putative; Provisional	Back alignment and domain information

>COG0525 ValS Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR00392 ileS isoleucyl-tRNA synthetase	Back alignment and domain information

>PRK06039 ileS isoleucyl-tRNA synthetase; Reviewed	Back alignment and domain information

>PLN02959 aminoacyl-tRNA ligase	Back alignment and domain information

>PRK00390 leuS leucyl-tRNA synthetase; Validated	Back alignment and domain information

>PLN02381 valyl-tRNA synthetase	Back alignment and domain information

>PTZ00419 valyl-tRNA synthetase-like protein; Provisional	Back alignment and domain information

>cd00672 CysRS_core catalytic core domain of cysteinyl tRNA synthetase	Back alignment and domain information

>TIGR00396 leuS_bact leucyl-tRNA synthetase, eubacterial and mitochondrial family	Back alignment and domain information

>COG0495 LeuS Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PLN02563 aminoacyl-tRNA ligase	Back alignment and domain information

>TIGR00456 argS arginyl-tRNA synthetase	Back alignment and domain information

>KOG0433\|consensus	Back alignment and domain information

>cd07963 Anticodon_Ia_Cys Anticodon-binding domain of cysteinyl tRNA synthetases	Back alignment and domain information

>KOG0432\|consensus	Back alignment and domain information

>PRK01611 argS arginyl-tRNA synthetase; Reviewed	Back alignment and domain information

>PF09334 tRNA-synt_1g: tRNA synthetases class I (M); InterPro: IPR015413 The aminoacyl-tRNA synthetases (6	Back alignment and domain information

>cd00668 Ile_Leu_Val_MetRS_core catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases	Back alignment and domain information

>cd00818 IleRS_core catalytic core domain of isoleucyl-tRNA synthetases	Back alignment and domain information

>KOG0434\|consensus	Back alignment and domain information

>PF00133 tRNA-synt_1: tRNA synthetases class I (I, L, M and V); InterPro: IPR002300 The aminoacyl-tRNA synthetases (6	Back alignment and domain information

>cd00817 ValRS_core catalytic core domain of valyl-tRNA synthetases	Back alignment and domain information

>cd00814 MetRS_core catalytic core domain of methioninyl-tRNA synthetases	Back alignment and domain information

>PRK12451 arginyl-tRNA synthetase; Reviewed	Back alignment and domain information

>cd00812 LeuRS_core catalytic core domain of leucyl-tRNA synthetases	Back alignment and domain information

>TIGR00467 lysS_arch lysyl-tRNA synthetase, archaeal and spirochete	Back alignment and domain information

>KOG0435\|consensus	Back alignment and domain information

>KOG1247\|consensus	Back alignment and domain information

>PRK00750 lysK lysyl-tRNA synthetase; Reviewed	Back alignment and domain information

>cd00674 LysRS_core_class_I catalytic core domain of class I lysyl tRNA synthetase	Back alignment and domain information

>KOG0437\|consensus	Back alignment and domain information

>PLN02286 arginine-tRNA ligase	Back alignment and domain information

>COG0018 ArgS Arginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF09190 DALR_2: DALR domain; InterPro: IPR015273 The aminoacyl-tRNA synthetases (6	Back alignment and domain information

>PF01921 tRNA-synt_1f: tRNA synthetases class I (K); InterPro: IPR002904 The aminoacyl-tRNA synthetases (6	Back alignment and domain information

>smart00840 DALR_2 This DALR domain is found in cysteinyl-tRNA-synthetases	Back alignment and domain information

>COG1384 LysS Lysyl-tRNA synthetase (class I) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd07956 Anticodon_Ia_Arg Anticodon-binding domain of arginyl tRNA synthetases	Back alignment and domain information

>cd07958 Anticodon_Ia_Leu_BEm Anticodon-binding domain of bacterial and eukaryotic mitochondrial leucyl tRNA synthetases	Back alignment and domain information

>cd07957 Anticodon_Ia_Met Anticodon-binding domain of methionyl tRNA synthetases	Back alignment and domain information

>cd07959 Anticodon_Ia_Leu_AEc Anticodon-binding domain of archaeal and eukaryotic cytoplasmic leucyl tRNA synthetases	Back alignment and domain information

>PRK04156 gltX glutamyl-tRNA synthetase; Provisional	Back alignment and domain information

>cd07962 Anticodon_Ia_Val Anticodon-binding domain of valyl tRNA synthetases	Back alignment and domain information

>cd07955 Anticodon_Ia_Cys_like Anticodon-binding domain of cysteinyl tRNA synthetases and domain found in MshC	Back alignment and domain information

>PF00750 tRNA-synt_1d: tRNA synthetases class I (R); InterPro: IPR015945 The aminoacyl-tRNA synthetases (6	Back alignment and domain information

>cd07375 Anticodon_Ia_like Anticodon-binding domain of class Ia aminoacyl tRNA synthetases and similar domains	Back alignment and domain information

>cd07960 Anticodon_Ia_Ile_BEm Anticodon-binding domain of bacterial and eukaryotic mitochondrial isoleucyl tRNA synthetases	Back alignment and domain information

>cd07961 Anticodon_Ia_Ile_ABEc Anticodon-binding domain of archaeal, bacterial, and eukaryotic cytoplasmic isoleucyl tRNA synthetases	Back alignment and domain information

>PF05746 DALR_1: DALR anticodon binding domain; InterPro: IPR008909 The aminoacyl-tRNA synthetases (6	Back alignment and domain information

>KOG1195\|consensus	Back alignment and domain information

>PF08264 Anticodon_1: Anticodon-binding domain of tRNA; InterPro: IPR013155 The aminoacyl-tRNA synthetases (6	Back alignment and domain information

>cd00418 GlxRS_core catalytic core domain of glutamyl-tRNA and glutaminyl-tRNA synthetase	Back alignment and domain information

>cd00808 GluRS_core catalytic core domain of discriminating glutamyl-tRNA synthetase	Back alignment and domain information

>TIGR00464 gltX_bact glutamyl-tRNA synthetase, bacterial family	Back alignment and domain information

>cd09287 GluRS_non_core catalytic core domain of non-discriminating glutamyl-tRNA synthetase	Back alignment and domain information

>cd00805 TyrRS_core catalytic core domain of tyrosinyl-tRNA synthetase	Back alignment and domain information

>KOG4426\|consensus	Back alignment and domain information

>smart00836 DALR_1 DALR anticodon binding domain	Back alignment and domain information

>cd00395 Tyr_Trp_RS_core catalytic core domain of tyrosinyl-tRNA and tryptophanyl-tRNA synthetase	Back alignment and domain information

>PRK01406 gltX glutamyl-tRNA synthetase; Reviewed	Back alignment and domain information

>cd00807 GlnRS_core catalytic core domain of glutaminyl-tRNA synthetase	Back alignment and domain information

>PLN03233 putative glutamate-tRNA ligase; Provisional	Back alignment and domain information

>PRK12556 tryptophanyl-tRNA synthetase; Provisional	Back alignment and domain information

>TIGR00440 glnS glutaminyl-tRNA synthetase	Back alignment and domain information

>PRK12283 tryptophanyl-tRNA synthetase; Reviewed	Back alignment and domain information

>PRK12282 tryptophanyl-tRNA synthetase II; Reviewed	Back alignment and domain information

>TIGR00233 trpS tryptophanyl-tRNA synthetase	Back alignment and domain information

>PRK12284 tryptophanyl-tRNA synthetase; Reviewed	Back alignment and domain information

>PRK05347 glutaminyl-tRNA synthetase; Provisional	Back alignment and domain information

>PRK13354 tyrosyl-tRNA synthetase; Provisional	Back alignment and domain information

>PF00579 tRNA-synt_1b: tRNA synthetases class I (W and Y); InterPro: IPR002305 The aminoacyl-tRNA synthetases (6	Back alignment and domain information

>COG0180 TrpS Tryptophanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK05912 tyrosyl-tRNA synthetase; Validated	Back alignment and domain information

>PLN02859 glutamine-tRNA ligase	Back alignment and domain information

>PTZ00402 glutamyl-tRNA synthetase; Provisional	Back alignment and domain information

>PRK14895 gltX glutamyl-tRNA synthetase; Provisional	Back alignment and domain information

>PRK12410 glutamylglutaminyl-tRNA synthetase; Provisional	Back alignment and domain information

>cd00806 TrpRS_core catalytic core domain of tryptophanyl-tRNA synthetase	Back alignment and domain information

>PRK12285 tryptophanyl-tRNA synthetase; Reviewed	Back alignment and domain information

>PRK14703 glutaminyl-tRNA synthetase/YqeY domain fusion protein; Provisional	Back alignment and domain information

>PRK12558 glutamyl-tRNA synthetase; Provisional	Back alignment and domain information

>PLN02907 glutamate-tRNA ligase	Back alignment and domain information

>PRK00927 tryptophanyl-tRNA synthetase; Reviewed	Back alignment and domain information

>PTZ00437 glutaminyl-tRNA synthetase; Provisional	Back alignment and domain information

>PTZ00126 tyrosyl-tRNA synthetase; Provisional	Back alignment and domain information

>PLN02627 glutamyl-tRNA synthetase	Back alignment and domain information

>PLN02486 aminoacyl-tRNA ligase	Back alignment and domain information

>PRK08560 tyrosyl-tRNA synthetase; Validated	Back alignment and domain information

>COG0162 TyrS Tyrosyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG0008 GlnS Glutamyl- and glutaminyl-tRNA synthetases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR00234 tyrS tyrosyl-tRNA synthetase	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		255
1li5_A		461	Crystal Structure Of Cysteinyl-Trna Synthetase Leng		1e-05

>pdb|1LI5|A Chain A, Crystal Structure Of Cysteinyl-Trna Synthetase Length = 461

Back alignment and structure

Iteration: 1

Score = 47.0 bits (110), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 22/67 (32%), Positives = 39/67 (58%) Query: 10 NNDSWVRYFLHSGHLTIAGCKMSKSLKNFITIQDALNKHTARQLRLAFLLHAWHQTLDYS 69 ++ +V Y++HSG + + KMSKSL NF T++D L + A +R + + L+YS Sbjct: 246 HDGQYVNYWMHSGMVMVDREKMSKSLGNFFTVRDVLKYYDAETVRYFLMSGHYRSQLNYS 305 Query: 70 DNTMEMA 76 + ++ A Sbjct: 306 EENLKQA 312

PyMOL of 1li5

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		255
3sp1_A		501	Cysteinyl-tRNA synthetase; structural genomics, se	2e-24
3tqo_A		462	Cysteinyl-tRNA synthetase; protein synthesis, liga	5e-24
1li5_A		461	Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys	4e-22
3c8z_A		414	Cysteinyl-tRNA synthetase; cysteine ligase, rossma	3e-15
1wkb_A		810	Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, e	5e-14
1wz2_A		967	Leucyl-tRNA synthetase; ligase, riken structural g	2e-13
3kfl_A		564	Methionyl-tRNA synthetase; parasite, aminoacyl-tRN	2e-09
2x1l_A		524	Methionyl-tRNA synthetase; nucleotide-binding, pro	3e-08
4dlp_A		536	Aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA	5e-08
1rqg_A		722	Methionyl-tRNA synthetase; translation, dimerizati	1e-07
2csx_A		497	Methionyl-tRNA synthetase; ligase, riken structura	2e-07
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	8e-07
3tun_A		542	Methionyl-tRNA synthetase; aminoacyl-tRNA syntheta	1e-06
2d5b_A		500	Methionyl-tRNA synthetase; rossmann fold, class 1A	1e-05
3h99_A		560	Methionyl-tRNA synthetase; rossmann fold, aminoacy	4e-05
1ile_A		821	Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA s	7e-05

>3sp1_A Cysteinyl-tRNA synthetase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, LYME disease; HET: AMP; 2.55A {Borrelia burgdorferi} Length = 501	Back alignment and structure

 Score =  100 bits (251), Expect = 2e-24
 Identities = 42/250 (16%), Positives = 80/250 (32%), Gaps = 43/250 (17%)

Query: 10  NNDSWVRYFLHSGHLTIAGCKMSKSLKNFITIQDALNKH-TARQLRLAFLLHAWH--QTL 66
            N  W   F+H   L +   KMSKS  NFIT++D  +++ +    R    L + H    L
Sbjct: 279 LNKKWCDVFVHGEFLIMDYNKMSKSRGNFITVKDLEDQNFSPLDFRY-LCLTS-HYRNQL 336

Query: 67  DYSDNTMEMAVT-YEKLLNEFFLNVKDHIRNLKFPATTVSSFEKWTQADLELSTRFIQTK 125
            +S + ++ +    E L+N       + +  +                + E    F+   
Sbjct: 337 KFSLDNLQASKIARENLIN-KLSYFYESLDPVDLNTLNKDLKNFGFSVEKEYYDSFV--- 392

Query: 126 NNVHAALCDNMDTRSALDSIRDCISQVNIYLRGTPNQLLLRDIGAYVTKILTVFGCIGDV 185
                 +  +++    L  + + I   N+                   ++  +F  I  +
Sbjct: 393 ----EKISFDLNVAQGLALLWEIIKSDNLSFVSK-------------LRLAFIFDEIMSL 435

Query: 186 KNIGFPLGGTGVESTNLEELVLPYLTILSEFRDNIRTEARLIKSTEILN--QCDRLRDEV 243
                 L         ++E +        +     R  A+  K     N  + D +RD  
Sbjct: 436 NLREEILKNLQNHDVVIDENM--------KALIEERRIAKCEK-----NFKRADEIRDF- 481

Query: 244 LPNVGVRLED 253
               G  L D
Sbjct: 482 FAKKGFVLVD 491

PyMOL of 3sp1

>3tqo_A Cysteinyl-tRNA synthetase; protein synthesis, ligase; 2.30A {Coxiella burnetii} Length = 462	Back alignment and structure

>1li5_A Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys; cysteine, E.coli, ligase; 2.30A {Escherichia coli} SCOP: a.27.1.1 c.26.1.1 PDB: 1li7_A 1u0b_B Length = 461	Back alignment and structure

>3c8z_A Cysteinyl-tRNA synthetase; cysteine ligase, rossmann fold, Cys-SA inhibitor, zinc binding, ATP-binding, aminoacyl-tRNA synthetase; HET: 5CA 1PE EPE; 1.60A {Mycobacterium smegmatis} Length = 414	Back alignment and structure

>1wkb_A Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, editing, amino acid, aminoacylation, trnaLeu, structural genomics; 2.05A {Pyrococcus horikoshii} Length = 810	Back alignment and structure

>1wz2_A Leucyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiativ structural genomics, ligase-RNA complex; 3.21A {Pyrococcus horikoshii} Length = 967	Back alignment and structure

>3kfl_A Methionyl-tRNA synthetase; parasite, aminoacyl-tRNA synthetase, tRNA ligase metrs, methionine, translation, ATP-binding; HET: ME8; 2.00A {Leishmania major} Length = 564	Back alignment and structure

>2x1l_A Methionyl-tRNA synthetase; nucleotide-binding, protein biosynthesis, ligase, aminoacyl- synthetase; HET: ADN CXS; 2.30A {Mycobacterium smegmatis} PDB: 2x1m_A* Length = 524	Back alignment and structure

>4dlp_A Aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA synthetase, class IA:methionyl-tRNA...; structural genomics; 2.65A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} Length = 536	Back alignment and structure

>1rqg_A Methionyl-tRNA synthetase; translation, dimerization, ligase; 2.90A {Pyrococcus abyssi} SCOP: a.27.1.1 c.26.1.1 g.41.1.1 Length = 722	Back alignment and structure

>2csx_A Methionyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase/RNA complex; 2.70A {Aquifex aeolicus} PDB: 2ct8_A* Length = 497	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3tun_A Methionyl-tRNA synthetase; aminoacyl-tRNA synthetase, AARS, metrs, parasite, protein-IN complex, translation, nucleotide binding; HET: C13; 2.55A {Trypanosoma brucei} Length = 542	Back alignment and structure

>2d5b_A Methionyl-tRNA synthetase; rossmann fold, class 1A AARS, isomerase, structural genomics, NPPSFA; 1.80A {Thermus thermophilus} SCOP: a.27.1.1 c.26.1.1 PDB: 1woy_A 1a8h_A 2d54_A Length = 500	Back alignment and structure

>3h99_A Methionyl-tRNA synthetase; rossmann fold, aminoacyl-tRNA synthetase, ATP-binding, ligas binding, nucleotide-binding, protein biosynthesis; HET: CIT; 1.40A {Escherichia coli} PDB: 3h97_A* 3h9b_A* 1f4l_A 3h9c_A* 1pfv_A* 1pfu_A 1p7p_A* 1pfw_A* 1pfy_A* 1pg0_A* 1pg2_A* 1qqt_A 1mea_A 1med_A Length = 560	Back alignment and structure

>1ile_A Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics; 2.50A {Thermus thermophilus} SCOP: a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1jzq_A* 1jzs_A* Length = 821	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		255
3tqo_A		462	Cysteinyl-tRNA synthetase; protein synthesis, liga	100.0
3sp1_A		501	Cysteinyl-tRNA synthetase; structural genomics, se	100.0
1li5_A		461	Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys	100.0
3u1f_A		542	Methionyl-tRNA synthetase; aminoacyl-tRNA syntheta	99.96
3c8z_A		414	Cysteinyl-tRNA synthetase; cysteine ligase, rossma	99.95
1wz2_A		967	Leucyl-tRNA synthetase; ligase, riken structural g	99.95
1rqg_A		722	Methionyl-tRNA synthetase; translation, dimerizati	99.95
1wkb_A		810	Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, e	99.95
2x1l_A		524	Methionyl-tRNA synthetase; nucleotide-binding, pro	99.94
2csx_A		497	Methionyl-tRNA synthetase; ligase, riken structura	99.94
3kfl_A		564	Methionyl-tRNA synthetase; parasite, aminoacyl-tRN	99.93
1ffy_A		917	Isoleucyl-tRNA synthetase; protein-RNA complex, me	99.93
1ile_A		821	Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA s	99.93
1gax_A		862	Valrs, valyl-tRNA synthetase; protein-RNA complex,	99.93
2d5b_A		500	Methionyl-tRNA synthetase; rossmann fold, class 1A	99.92
4dlp_A		536	Aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA	99.92
4arc_A		880	Leucine--tRNA ligase; ligase-RNA complex, nucleoti	99.9
3h99_A		560	Methionyl-tRNA synthetase; rossmann fold, aminoacy	99.89
2v0c_A		878	Aminoacyl-tRNA synthetase; ligase, nucleotide-bind	99.88
1iq0_A		592	Arginyl-tRNA synthetase; riken structural genomics	99.87
3fnr_A		464	Arginyl-tRNA synthetase; transferase, PSI-2, NYSGX	99.84
2zue_A		629	Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase	99.82
1f7u_A		607	Arginyl-tRNA synthetase; RNA-protein complex, amin	99.7
1irx_A		523	Lysyl-tRNA synthetase; beta sandwitch, zinc-bindin	99.58
3aii_A		553	Glutamyl-tRNA synthetase; amino-acyl tRNA syntheta	99.06
1qtq_A		553	GLNRS, protein (glutaminyl-tRNA synthetase); gluta	98.7
2hz7_A		851	Glutaminyl-tRNA synthetase; rossmann fold, GLNRS c	98.38
2cfo_A		492	Glutamyl-tRNA synthetase; ligase, aminoacyl-tRNA s	98.21
2o5r_A		481	Glutamyl-tRNA synthetase 1; TM1351, EC 6.1.1.17, g	97.4
1j09_A		468	Glutamyl-tRNA synthetase; glurs-ATP-Glu complex, r	97.3
2cyb_A		323	Tyrosyl-tRNA synthetase; rossmann-fold, structural	97.09
3afh_A		488	Glutamyl-tRNA synthetase 2; protein-substrate comp	97.01
3al0_C		592	Glutamyl-tRNA(Gln) amidotransferase subunit C, GL	96.86
1nzj_A		298	Hypothetical protein YADB; Zn cluster, glutamyl T-	96.64
2ja2_A		498	Glutamyl-tRNA synthetase; non-discriminating gluta	96.57
1y42_X		392	Tyrosyl-tRNA synthetase, mitochondrial; CYT-18, tR	95.44
2yxn_A		322	Tyrosyl-tRNA synthetase; tRNA synthetases class I,	95.24
1h3f_A		432	Tyrosyl-tRNA synthetase; ligase, aminoacyl-tRNA sy	95.22
2pid_A		356	Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase	95.19
2g36_A		340	Tryptophanyl-tRNA synthetase; TM0492, structural g	95.09
2ts1_A		419	Tyrosyl-tRNA synthetase; ligase (synthetase); 2.30	95.03
3tzl_A		322	Tryptophanyl-tRNA synthetase; structural genomics,	94.95
1jil_A		420	Tyrrs, tyrosyl-tRNA synthetase; truncation, based	94.94
4g6z_A		490	Glutamate-tRNA ligase; aminoacyl-tRNA synthetase,	94.89
2jan_A		432	Tyrosyl-tRNA synthetase; protein biosynthesis, ami	94.79
1n3l_A		372	Tyrosyl-tRNA synthetase; rossmann fold AS catalyti	93.86
2zp1_A		314	Tyrosyl-tRNA synthetase; tRNA synthetases class I,	93.29
1yi8_B		351	Tryptophanyl-tRNA synthetase; ligase; HET: TRP; 2.	93.09
2el7_A		337	Tryptophanyl-tRNA synthetase; aminoacyl-tRNA synth	93.03
2dlc_X		394	Tyrosyl-tRNA synthetase, cytoplasmic; tyrrs, ligas	92.51
3hzr_A		386	Tryptophanyl-tRNA synthetase; APO tRNA-ligase, str	92.0
3i05_A		395	Tryptophanyl-tRNA synthetase; APO tRNA-ligase, ATP	91.89
1i6k_A		328	TRPRS, tryptophanyl-tRNA synthetase; class I tRNA	90.21
3vgj_A		373	Tyrosyl-tRNA synthetase, putative; tyrrs, ligase;	90.11
2yy5_A		348	Tryptophanyl-tRNA synthetase; aminoaccyl tRNA synt	89.58
3hv0_A		393	Tryptophanyl-tRNA synthetase; tRNA-ligase, ATP-bin	89.54
1r6u_A		437	Tryptophanyl-tRNA synthetase; class IC tRNA synthe	88.99
4gri_A		512	Glutamate--tRNA ligase; structural genomics, seatt	87.95
2cya_A		364	Tyrosyl-tRNA synthetase; tyrrs, aminoacylation, st	87.85
3jxe_A		392	Tryptophanyl-tRNA synthetase; adenosine triphospha	87.83
2ip1_A		432	Tryptophanyl-tRNA synthetase; rossmann fold, struc	87.83
1r6t_A		477	Tryptophanyl-tRNA synthetase; class IC tRNA synthe	87.13
3foc_A		451	Tryptophanyl-tRNA synthetase; structural genomics,	84.69
2cyc_A		375	Tyrosyl-tRNA synthetase; tyrosine, tyrrs, aminoacy	84.17
2j5b_A		348	Tyrosyl-tRNA synthetase; ligase, protein biosynthe	84.07
3tze_A		406	Tryptophanyl-tRNA synthetase; structural genomics,	83.75
3sz3_A		341	Tryptophanyl-tRNA synthetase; structural genomics,	83.66
3n9i_A		346	Tryptophanyl-tRNA synthetase; tryptophan-tRNA liga	83.17
3p0j_A		690	Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase	82.72
3prh_A		388	Tryptophanyl-tRNA synthetase; TRPRS, protein biosy	82.53

>3tqo_A Cysteinyl-tRNA synthetase; protein synthesis, ligase; 2.30A {Coxiella burnetii}	Back alignment and structure

Probab=100.00  E-value=1.2e-46  Score=342.00  Aligned_cols=214  Identities=24%  Similarity=0.350  Sum_probs=131.8

Q ss_pred             CccccccccCCCcccceeeeeeEeeecCccccccCCCccCHHHHHhhcChhHHHHHHhccCCCCCcccChhHHHHHHHHH
Q psy11866          1 MSFRFQAYFNNDSWVRYFLHSGHLTIAGCKMSKSLKNFITIQDALNKHTARQLRLAFLLHAWHQTLDYSDNTMEMAVTYE   80 (255)
Q Consensus         1 ~~AQs~a~~~~~~~~~~~~h~g~l~~~g~KMSKSlGN~i~~~d~l~~~~~d~lR~~ll~~~y~~~~~fs~~~l~~a~~~~   80 (255)
                      |+|||+|++|+ ||+++|+|+|+|+++|+|||||+||||+|.|++++||+|++|||++++||++|++||++.+.++.+  
T Consensus       241 eiaqs~a~~g~-p~~~~w~H~g~v~~~G~KMSKSlGN~i~~~dll~~~g~dalR~~lls~~yr~~l~fs~~~l~~a~~--  317 (462)
T 3tqo_A          241 EIAQSEAGEEK-PFVKLWMHAGLLEINKEKMSKSLGNIISIREALKESDVEVLRYFLLSGHYRNPLSYSKENLENGRL--  317 (462)
T ss_dssp             HHHHHHHHHSS-CCEEEEEEECCEEETTEECCTTTTCCCBHHHHHHHSCHHHHHHHHHHSCTTSCEEECHHHHHHHHH--
T ss_pred             HHHHHHHHcCC-CcceEEEEccEEecCCcCccccCCCcccHHHHHhhcChHHhhhhhccCCCCCCcCcCHHHHHHHHH--
Confidence            58999999996 999999999999999999999999999999999999999999999999999999999999999864  


Q ss_pred             HHHHHHHHHHHHHHhhccCCCCCccccccCCHHHHHHHHHHHHHHHHHHHHHhccCCHHHHHHHHHHHHHHHhhhhhcCC
Q psy11866         81 KLLNEFFLNVKDHIRNLKFPATTVSSFEKWTQADLELSTRFIQTKNNVHAALCDNMDTRSALDSIRDCISQVNIYLRGTP  160 (255)
Q Consensus        81 ~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~al~dd~~~~~al~~l~~l~~~~N~~~~~~~  160 (255)
                       .++++++.+..    ....       .    .+     .+..+.+.|.++|+||||||.|++.|+++++.+|.++....
T Consensus       318 -~l~rl~~~~~~----~~~~-------~----~~-----~~~~~~~~~~~a~~dD~nt~~a~~~l~~~~~~~n~~~~~~~  376 (462)
T 3tqo_A          318 -ALERFYLALRG----LPVV-------N----HE-----KTSSYTDRFYEAMDDDFNTPIAFALLFEMVREINRFRDNNQ  376 (462)
T ss_dssp             -HHHHHHHHHTT----CCC----------------------CHHHHHHHHHHTBTCCHHHHHHHHHHHHHHHHHHHHTTC
T ss_pred             -HHHHHHHHHHH----hhhc-------c----ch-----hHHHHHHHHHHHHHhccChHHHHHHHHHHHHHHhhhhcccc
Confidence             45555544321    1100       0    00     12345678999999999999999999999999999876532


Q ss_pred             CHHHHHHHHHHHHHhhhccccccCCccccccCCCCCCCCCChhHhHHHHHHHHHHHHHHHHHHHHhcCchHHHHHhhHhh
Q psy11866        161 NQLLLRDIGAYVTKILTVFGCIGDVKNIGFPLGGTGVESTNLEELVLPYLTILSEFRDNIRTEARLIKSTEILNQCDRLR  240 (255)
Q Consensus       161 ~~~~l~~~~~~~~~~~~ilGi~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~l~~~r~~~R~~ar~~k~~~~~~~aD~iR  240 (255)
                       ...+..+...+..+..+|||....+...+. ..    .   +....+.|+.|+    +.|++||++||   |++||+||
T Consensus       377 -~~~~~~~~~~~~~~~~vlg~~~~~~~~~~~-~~----~---~~~~~~~i~~li----~~R~~ar~~kd---~~~aD~iR  440 (462)
T 3tqo_A          377 -IEKAAVLAAELKCLGNIFGLLQYSPEQFLQ-GA----K---KEADVQEIKKLI----DQRNEARAKKD---WKTADQIR  440 (462)
T ss_dssp             -HHHHHHHHHHHHHHHGGGTCSCSCHHHHC--------------------------------------------------
T ss_pred             -HHHHHHHHHHHHHHHHhcCCCccchhhhhh-cc----c---cccCHHHHHHHH----HHHHHHHHhcC---HHHHHHHH
Confidence             344556667788899999997654321111 00    0   111113466666    68999999999   89999999


Q ss_pred             hcCCCCCCceeccCC
Q psy11866        241 DEVLPNVGVRLEDIE  255 (255)
Q Consensus       241 ~~~L~~~Gi~l~D~~  255 (255)
                      |+ |.++||.|+|+|
T Consensus       441 ~~-L~~~Gi~l~D~~  454 (462)
T 3tqo_A          441 DQ-LTDLGVAIEDSS  454 (462)
T ss_dssp             ---------------
T ss_pred             HH-HHHCCcEEEEcC
Confidence            99 799999999986

PyMOL of 3tqo

>3sp1_A Cysteinyl-tRNA synthetase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, LYME disease; HET: AMP; 2.55A {Borrelia burgdorferi}	Back alignment and structure

>1li5_A Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys; cysteine, E.coli, ligase; 2.30A {Escherichia coli} SCOP: a.27.1.1 c.26.1.1 PDB: 1li7_A 1u0b_B	Back alignment and structure

>3u1f_A Methionyl-tRNA synthetase; aminoacyl-tRNA synthetase, AARS, metrs, parasite, protein-IN complex, rossmann-fold, translation; HET: 392; 2.20A {Trypanosoma brucei} PDB: 3u1e_A* 3u1g_A* 3u20_A* 4eg1_A 4eg3_A* 4eg6_A* 4eg8_A* 4eg5_A* 3tun_A* 3u1z_A* 4eg4_A* 4eg7_A* 4ega_A*	Back alignment and structure

>3c8z_A Cysteinyl-tRNA synthetase; cysteine ligase, rossmann fold, Cys-SA inhibitor, zinc binding, ATP-binding, aminoacyl-tRNA synthetase; HET: 5CA 1PE EPE; 1.60A {Mycobacterium smegmatis}	Back alignment and structure

>1wz2_A Leucyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiativ structural genomics, ligase-RNA complex; 3.21A {Pyrococcus horikoshii}	Back alignment and structure

>1rqg_A Methionyl-tRNA synthetase; translation, dimerization, ligase; 2.90A {Pyrococcus abyssi} SCOP: a.27.1.1 c.26.1.1 g.41.1.1	Back alignment and structure

>1wkb_A Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, editing, amino acid, aminoacylation, trnaLeu, structural genomics; 2.05A {Pyrococcus horikoshii}	Back alignment and structure

>2x1l_A Methionyl-tRNA synthetase; nucleotide-binding, protein biosynthesis, ligase, aminoacyl- synthetase; HET: ADN CXS; 2.30A {Mycobacterium smegmatis} PDB: 2x1m_A*	Back alignment and structure

>2csx_A Methionyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase/RNA complex; 2.70A {Aquifex aeolicus} PDB: 2ct8_A*	Back alignment and structure

>3kfl_A Methionyl-tRNA synthetase; parasite, aminoacyl-tRNA synthetase, tRNA ligase metrs, methionine, translation, ATP-binding; HET: ME8; 2.00A {Leishmania major}	Back alignment and structure

>1ffy_A Isoleucyl-tRNA synthetase; protein-RNA complex, metal IONS, editing tRNA synthetase, double-sieve, ligase/RNA, mupiroci; HET: MRC; 2.20A {Staphylococcus aureus} SCOP: a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1qu2_A* 1qu3_A*	Back alignment and structure

>1ile_A Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics; 2.50A {Thermus thermophilus} SCOP: a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1jzq_A* 1jzs_A*	Back alignment and structure

>1gax_A Valrs, valyl-tRNA synthetase; protein-RNA complex, rossmann fold, coiled coil, riken structural genomics/proteomics initiative, RSGI; HET: VAA; 2.90A {Thermus thermophilus} SCOP: a.2.7.3 a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1ivs_A* 1iyw_A	Back alignment and structure

>2d5b_A Methionyl-tRNA synthetase; rossmann fold, class 1A AARS, isomerase, structural genomics, NPPSFA; 1.80A {Thermus thermophilus} SCOP: a.27.1.1 c.26.1.1 PDB: 1woy_A 1a8h_A 2d54_A	Back alignment and structure

>4dlp_A Aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA synthetase, class IA:methionyl-tRNA...; structural genomics; 2.65A {Brucella melitensis biovar abortus 230ORGANISM_TAXID}	Back alignment and structure

>4arc_A Leucine--tRNA ligase; ligase-RNA complex, nucleotide-binding, protein biosynthesis I aminoacyl-tRNA synthetase, ATP-binding; 2.00A {Escherichia coli} PDB: 4aq7_A 4ari_A* 4as1_A*	Back alignment and structure

>3h99_A Methionyl-tRNA synthetase; rossmann fold, aminoacyl-tRNA synthetase, ATP-binding, ligas binding, nucleotide-binding, protein biosynthesis; HET: CIT; 1.40A {Escherichia coli} PDB: 3h97_A* 3h9b_A* 1f4l_A 3h9c_A* 1pfv_A* 1pfu_A 1p7p_A* 1pfw_A* 1pfy_A* 1pg0_A* 1pg2_A* 1qqt_A 1mea_A 1med_A	Back alignment and structure

>2v0c_A Aminoacyl-tRNA synthetase; ligase, nucleotide-binding, protein biosynthesis; HET: LMS ANZ; 1.85A {Thermus thermophilus} PDB: 1h3n_A* 1obc_A* 1obh_A* 2bte_A* 2byt_A 2v0g_A*	Back alignment and structure

>1iq0_A Arginyl-tRNA synthetase; riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; 2.30A {Thermus thermophilus} SCOP: a.27.1.1 c.26.1.1 d.67.2.1	Back alignment and structure

>3fnr_A Arginyl-tRNA synthetase; transferase, PSI-2, NYSGXRC, struc genomics, protein structure initiative; 2.20A {Campylobacter jejuni}	Back alignment and structure

>2zue_A Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase, nucleotide-binding, protein biosynthesis, ligase/RNA complex; HET: ANP; 2.00A {Pyrococcus horikoshii} PDB: 2zuf_A	Back alignment and structure

>1f7u_A Arginyl-tRNA synthetase; RNA-protein complex, aminoacylation; HET: PSU 1MG 2MG H2U M2G 5MC 5MU 1MA ARG; 2.20A {Saccharomyces cerevisiae} SCOP: a.27.1.1 c.26.1.1 d.67.2.1 PDB: 1bs2_A* 1f7v_A*	Back alignment and structure

>1irx_A Lysyl-tRNA synthetase; beta sandwitch, zinc-binding structure, rossmann fold, alpha-helix CAGE; 2.60A {Pyrococcus horikoshii} SCOP: a.97.1.2 c.26.1.1	Back alignment and structure

>3aii_A Glutamyl-tRNA synthetase; amino-acyl tRNA synthetase, ligase; 1.65A {Methanothermobacter thermautotrophicusorganism_taxid}	Back alignment and structure

>1qtq_A GLNRS, protein (glutaminyl-tRNA synthetase); glutamine, trnaGln, E. coli, complex, ligase/RNA complex; HET: QSI; 2.25A {Escherichia coli} SCOP: b.53.1.2 c.26.1.1 PDB: 1gsg_P* 1gts_A* 1gtr_A* 1zjw_A* 1o0b_A* 1o0c_A* 1qru_A* 1qrs_A* 1qrt_A* 1euy_A* 1euq_A* 1exd_A* 2rd2_A* 2re8_A* 1nyl_A	Back alignment and structure

>2hz7_A Glutaminyl-tRNA synthetase; rossmann fold, GLNRS core, class I aminoacyl-tRNA synthetase, ligase; 2.30A {Deinococcus radiodurans}	Back alignment and structure

>2cfo_A Glutamyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetase, ATP-binding, nucleotide-B; HET: GLU; 2.45A {Synechococcus elongatus}	Back alignment and structure

>2o5r_A Glutamyl-tRNA synthetase 1; TM1351, EC 6.1.1.17, glutamate-T ligase 1, glurs 1, structural genomics, joint center for ST genomics, JCSG; 2.34A {Thermotoga maritima}	Back alignment and structure

>1j09_A Glutamyl-tRNA synthetase; glurs-ATP-Glu complex, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLU ATP; 1.80A {Thermus thermophilus} SCOP: a.97.1.1 c.26.1.1 PDB: 1n75_A* 1n77_A* 1n78_A* 2cuz_A* 2cv0_A* 2cv1_A* 2cv2_A* 2dxi_A* 1g59_A 1gln_A	Back alignment and structure

>2cyb_A Tyrosyl-tRNA synthetase; rossmann-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: TYR; 1.80A {Archaeoglobus fulgidus}	Back alignment and structure

>3afh_A Glutamyl-tRNA synthetase 2; protein-substrate complex, aminoacyl-tRNA synthetase, ATP-binding, ligase, nucleotide-binding; HET: GSU; 2.00A {Thermotoga maritima} PDB: 3akz_B*	Back alignment and structure

>3al0_C Glutamyl-tRNA(Gln) amidotransferase subunit C, GL tRNA synthetase 2; protein-RNA complex, ligase-RNA complex; HET: GSU; 3.37A {Thermotoga maritima}	Back alignment and structure

>1nzj_A Hypothetical protein YADB; Zn cluster, glutamyl T-RNA synthetase, structural genomics, unknown function; 1.50A {Escherichia coli} SCOP: c.26.1.1 PDB: 2zlz_A* 4a91_A*	Back alignment and structure

>2ja2_A Glutamyl-tRNA synthetase; non-discriminating glutamyl-tRNA aminoacylation, protein biosynthesis, aminoacyl-tRNA synthetase, ligase; 1.65A {Mycobacterium tuberculosis} PDB: 3pny_A 3pnv_A	Back alignment and structure

>1y42_X Tyrosyl-tRNA synthetase, mitochondrial; CYT-18, tRNA ligase, group I intron; HET: TYR; 1.95A {Neurospora crassa} PDB: 2rkj_A	Back alignment and structure

>2yxn_A Tyrosyl-tRNA synthetase; tRNA synthetases class I, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: AZY; 1.80A {Escherichia coli str} PDB: 1wq3_A* 1wq4_A* 1x8x_A* 1vbn_A* 1vbm_A*	Back alignment and structure

>1h3f_A Tyrosyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetase; HET: TYE; 2.00A {Thermus thermophilus} SCOP: c.26.1.1 d.66.1.4 PDB: 1h3e_A*	Back alignment and structure

>2pid_A Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase, protein-substrate complex, ATP-BI ligase, mitochondrion, nucleotide-binding, protein biosynth; HET: YSA; 2.20A {Homo sapiens} PDB: 3zxi_A*	Back alignment and structure

>2g36_A Tryptophanyl-tRNA synthetase; TM0492, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI, ligase; HET: TRP; 2.50A {Thermotoga maritima}	Back alignment and structure

>2ts1_A Tyrosyl-tRNA synthetase; ligase (synthetase); 2.30A {Geobacillus stearothermophilus} SCOP: c.26.1.1 PDB: 3ts1_A* 1tyd_E* 1tya_E* 1tyc_A 1tyb_E* 4ts1_A* 1jh3_A	Back alignment and structure

>3tzl_A Tryptophanyl-tRNA synthetase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta structure; HET: ADP TRP; 2.15A {Campylobacter jejuni subsp} SCOP: c.26.1.0 PDB: 3m5w_A*	Back alignment and structure

>1jil_A Tyrrs, tyrosyl-tRNA synthetase; truncation, based inhibitor design, ligase; HET: 485; 2.20A {Staphylococcus aureus} SCOP: c.26.1.1 PDB: 1jij_A* 1jii_A* 1jik_A*	Back alignment and structure

>4g6z_A Glutamate-tRNA ligase; aminoacyl-tRNA synthetase, AARS, class 1B AARS, ATP-dependen charging, protein synthesis, structural genomics; HET: GLU; 2.05A {Burkholderia thailandensis}	Back alignment and structure

>2jan_A Tyrosyl-tRNA synthetase; protein biosynthesis, aminoacyl-tRNA synthetase, tyrrs, ligase, tyrosine, RNA-binding, ATP-binding; 2.9A {Mycobacterium tuberculosis}	Back alignment and structure

>1n3l_A Tyrosyl-tRNA synthetase; rossmann fold AS catalytic domain, unique anticodon recognit domain, dimer, ligase; 1.18A {Homo sapiens} SCOP: c.26.1.1 PDB: 1q11_A*	Back alignment and structure

>2zp1_A Tyrosyl-tRNA synthetase; tRNA synthetases class I, ligase, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, nucleotide-binding; HET: IYR; 1.70A {Methanocaldococcus jannaschii} PDB: 1zh6_A* 1j1u_A* 1u7d_A 2q1g_A* 2pxh_A* 1zh0_A* 2q1i_A* 2ag6_A* 3qe4_A* 3d6u_A* 3d6v_A* 1u7x_A 3n2y_A* 2hgz_A*	Back alignment and structure

>1yi8_B Tryptophanyl-tRNA synthetase; ligase; HET: TRP; 2.10A {Deinococcus radiodurans} PDB: 1yia_B* 1yid_B* 2a4m_A*	Back alignment and structure

>2el7_A Tryptophanyl-tRNA synthetase; aminoacyl-tRNA synthetase, translation, structural GEN NPPSFA; 2.50A {Thermus thermophilus}	Back alignment and structure

>2dlc_X Tyrosyl-tRNA synthetase, cytoplasmic; tyrrs, ligase-tRNA complex; HET: 2MG OMG M2G PSU 6IA 5MC 5MU 1MA YMP; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3hzr_A Tryptophanyl-tRNA synthetase; APO tRNA-ligase, structural genomics, medical structural GEN pathogenic protozoa, MSGPP, ligase; 3.00A {Entamoeba histolytica}	Back alignment and structure

>3i05_A Tryptophanyl-tRNA synthetase; APO tRNA-ligase, ATP-binding, aminoacyl-tRNA synthetase, LIG nucleotide-binding, protein biosynthesis; 2.80A {Trypanosoma brucei} SCOP: c.26.1.0	Back alignment and structure

>1i6k_A TRPRS, tryptophanyl-tRNA synthetase; class I tRNA synthetase, AARS, induced FIT, ligase; HET: TYM; 1.72A {Geobacillus stearothermophilus} SCOP: c.26.1.1 PDB: 1i6l_A* 1i6m_A* 1m83_A* 1mau_A* 1maw_A* 1mb2_A* 2ov4_A* 3fhj_A* 3fi0_A* 1d2r_A 3u1v_A	Back alignment and structure

>3vgj_A Tyrosyl-tRNA synthetase, putative; tyrrs, ligase; HET: YAP; 2.21A {Plasmodium falciparum}	Back alignment and structure

>2yy5_A Tryptophanyl-tRNA synthetase; aminoaccyl tRNA synthetase, structural genomics, NPPSFA; HET: WSA; 2.55A {Mycoplasma pneumoniae}	Back alignment and structure

>3hv0_A Tryptophanyl-tRNA synthetase; tRNA-ligase, ATP-binding, aminoacyl-tRNA synthetase, ligase, nucleotide-binding; HET: TRP; 2.42A {Cryptosporidium parvum iowa II} SCOP: c.26.1.0	Back alignment and structure

>1r6u_A Tryptophanyl-tRNA synthetase; class IC tRNA synthetase, rossmann fold catalytic domain, AN recognition domain, bound Trp-AMP, ligase; HET: TYM; 2.00A {Homo sapiens} SCOP: c.26.1.1 PDB: 1ulh_A 2dr2_A* 2ake_A* 1o5t_A	Back alignment and structure

>4gri_A Glutamate--tRNA ligase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, aminoacyl-tRNA synthetase; HET: GLU; 2.60A {Borrelia burgdorferi}	Back alignment and structure

>2cya_A Tyrosyl-tRNA synthetase; tyrrs, aminoacylation, structural genomics, NPPSFA, national on protein structural and functional analyses; 2.20A {Aeropyrum pernix}	Back alignment and structure

>3jxe_A Tryptophanyl-tRNA synthetase; adenosine triphosphate, rossmann fold, crystallography, X-RAY, P. horikoshii, aminoacyl-tRNA synthetase; HET: TYM; 3.00A {Pyrococcus horikoshii}	Back alignment and structure

>2ip1_A Tryptophanyl-tRNA synthetase; rossmann fold, structural genomics, PSI-2, protein structure initiative; HET: PG4; 1.80A {Saccharomyces cerevisiae} PDB: 3kt0_A* 3kt3_A* 3kt6_A* 3kt8_A*	Back alignment and structure

>1r6t_A Tryptophanyl-tRNA synthetase; class IC tRNA synthetase, rossmann fold catalytical domain, recognition domain, bound Trp-AMP, ligase; HET: TYM; 2.10A {Homo sapiens} SCOP: a.16.1.3 c.26.1.1 PDB: 2azx_A* 2quh_A* 2qui_A* 2quj_A* 2quk_A	Back alignment and structure

>3foc_A Tryptophanyl-tRNA synthetase; structural genomics, giardiasi aminoacyl-tRNA synthetase, ligase; 2.09A {Giardia lamblia atcc 50803}	Back alignment and structure

>2cyc_A Tyrosyl-tRNA synthetase; tyrosine, tyrrs, aminoacylation, structural genomics; HET: TYR; 2.20A {Pyrococcus horikoshii}	Back alignment and structure

>2j5b_A Tyrosyl-tRNA synthetase; ligase, protein biosynthesis, ATP-binding; HET: TYE; 2.20A {Acanthamoeba polyphaga mimivirus}	Back alignment and structure

>3tze_A Tryptophanyl-tRNA synthetase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, amino acylation; HET: TRP; 2.60A {Encephalitozoon cuniculi}	Back alignment and structure

>3sz3_A Tryptophanyl-tRNA synthetase; structural genomics, center for structural genomics of infec diseases, csgid, rossmann fold; HET: TRP; 1.50A {Vibrio cholerae o1 biovar el tor}	Back alignment and structure

>3n9i_A Tryptophanyl-tRNA synthetase; tryptophan-tRNA ligase, csgid, structural genomics, niaid, center for structural genomics infectious diseases; 1.95A {Yersinia pestis} SCOP: c.26.1.1	Back alignment and structure

>3p0j_A Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, tyrrs, pseudod translation, ATP-binding, nucleotide-binding, ligase; HET: TYE; 2.89A {Leishmania major} PDB: 3p0i_A* 3p0h_A*	Back alignment and structure

>3prh_A Tryptophanyl-tRNA synthetase; TRPRS, protein biosynthesis, translation, class I tRNA synth rossman fold, high motif, KMSKS motif; 2.80A {Bacillus subtilis}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		255
d1li5a2		315	c.26.1.1 (A:1-315) Cysteinyl-tRNA synthetase (CysR	3e-18
d1rqga2		361	c.26.1.1 (A:1-138,A:174-396) Methionyl-tRNA synthe	2e-11
d1pfva2		350	c.26.1.1 (A:4-140,A:176-388) Methionyl-tRNA synthe	3e-11
d1ivsa4		425	c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase	1e-10
d2d5ba2		348	c.26.1.1 (A:1-348) Methionyl-tRNA synthetase (MetR	1e-10
d1ffya3		450	c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthe	8e-09
d1ilea3		452	c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthe	1e-08
d1irxa2		317	c.26.1.1 (A:3-319) Class I lysyl-tRNA synthetase {	2e-08
d1h3na3		494	c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetas	5e-05

>d1li5a2 c.26.1.1 (A:1-315) Cysteinyl-tRNA synthetase (CysRS) {Escherichia coli [TaxId: 562]} Length = 315	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Nucleotidylyl transferase
family: Class I aminoacyl-tRNA synthetases (RS), catalytic domain
domain: Cysteinyl-tRNA synthetase (CysRS)
species: Escherichia coli [TaxId: 562]

 Score = 80.4 bits (197), Expect = 3e-18
 Identities = 22/76 (28%), Positives = 39/76 (51%)

Query: 1   MSFRFQAYFNNDSWVRYFLHSGHLTIAGCKMSKSLKNFITIQDALNKHTARQLRLAFLLH 60
                    ++  +V Y++HSG + +   KMSKSL NF T++D L  + A  +R   +  
Sbjct: 237 NEIAQSTCAHDGQYVNYWMHSGMVMVDREKMSKSLGNFFTVRDVLKYYDAETVRYFLMSG 296

Query: 61  AWHQTLDYSDNTMEMA 76
            +   L+YS+  ++ A
Sbjct: 297 HYRSQLNYSEENLKQA 312

PyMOL of d1li5a2

>d1rqga2 c.26.1.1 (A:1-138,A:174-396) Methionyl-tRNA synthetase (MetRS) {Pyrococcus abyssi [TaxId: 29292]} Length = 361	Back information, alignment and structure

>d1pfva2 c.26.1.1 (A:4-140,A:176-388) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]} Length = 350	Back information, alignment and structure

>d1ivsa4 c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]} Length = 425	Back information, alignment and structure

>d2d5ba2 c.26.1.1 (A:1-348) Methionyl-tRNA synthetase (MetRS) {Thermus thermophilus [TaxId: 274]} Length = 348	Back information, alignment and structure

>d1ffya3 c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]} Length = 450	Back information, alignment and structure

>d1ilea3 c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]} Length = 452	Back information, alignment and structure

>d1irxa2 c.26.1.1 (A:3-319) Class I lysyl-tRNA synthetase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 317	Back information, alignment and structure

>d1h3na3 c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]} Length = 494	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		255
d1li5a2		315	Cysteinyl-tRNA synthetase (CysRS) {Escherichia col	99.83
d1pfva2		350	Methionyl-tRNA synthetase (MetRS) {Escherichia col	99.79
d1rqga2		361	Methionyl-tRNA synthetase (MetRS) {Pyrococcus abys	99.79
d1ivsa4		425	Valyl-tRNA synthetase (ValRS) {Thermus thermophilu	99.79
d1ffya3		450	Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus	99.78
d1ilea3		452	Isoleucyl-tRNA synthetase (IleRS) {Thermus thermop	99.77
d2d5ba2		348	Methionyl-tRNA synthetase (MetRS) {Thermus thermop	99.77
d1h3na3		494	Leucyl-tRNA synthetase (LeuRS) {Thermus thermophil	99.61
d1irxa2		317	Class I lysyl-tRNA synthetase {Archaeon Pyrococcus	99.49
d1li5a1		87	Cysteinyl-tRNA synthetase (CysRS) {Escherichia col	98.97
d1iq0a2		370	Arginyl-tRNA synthetase (ArgRS) {Thermus thermophi	98.64
d1rqga1		210	Methionyl-tRNA synthetase (MetRS) {Pyrococcus abys	98.54
d1f7ua2		348	Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Sa	98.35
d1pfva1		162	Methionyl-tRNA synthetase (MetRS) {Escherichia col	98.08
d1h3na1		128	Leucyl-tRNA synthetase (LeuRS) {Thermus thermophil	98.02
d2d5ba1		152	Methionyl-tRNA synthetase (MetRS) {Thermus thermop	97.86
d1j09a2		305	Glutamyl-tRNA synthetase (GluRS) {Thermus thermoph	97.54
d1iq0a1		126	Arginyl-tRNA synthetase (ArgRS) {Thermus thermophi	96.92
d1ivsa2		218	Valyl-tRNA synthetase (ValRS) {Thermus thermophilu	96.9
d1ffya1		273	Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus	96.62
d1f7ua1		124	Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Sa	96.42
d1ilea1		180	Isoleucyl-tRNA synthetase (IleRS) {Thermus thermop	96.2
d1h3fa1		343	Tyrosyl-tRNA synthetase (TyrRS) {Thermus thermophi	94.42
d1jila_		323	Tyrosyl-tRNA synthetase (TyrRS) {Staphylococcus au	92.35
d1j1ua_		306	Tyrosyl-tRNA synthetase (TyrRS) {Archaeon Methanoc	90.85
d1gtra2		331	Glutaminyl-tRNA synthetase (GlnRS) {Escherichia co	84.1

>d1li5a2 c.26.1.1 (A:1-315) Cysteinyl-tRNA synthetase (CysRS) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Nucleotidylyl transferase
family: Class I aminoacyl-tRNA synthetases (RS), catalytic domain
domain: Cysteinyl-tRNA synthetase (CysRS)
species: Escherichia coli [TaxId: 562]

Probab=99.83  E-value=1.3e-21  Score=168.78  Aligned_cols=72  Identities=31%  Similarity=0.534  Sum_probs=66.2

Q ss_pred             ccccCCCcccceeeeeeEeeecCccccccCCCccCHHHHHhhcChhHHHHHHhccCCCCCcccChhHHHHHHH
Q psy11866          6 QAYFNNDSWVRYFLHSGHLTIAGCKMSKSLKNFITIQDALNKHTARQLRLAFLLHAWHQTLDYSDNTMEMAVT   78 (255)
Q Consensus         6 ~a~~~~~~~~~~~~h~g~l~~~g~KMSKSlGN~i~~~d~l~~~~~d~lR~~ll~~~y~~~~~fs~~~l~~a~~   78 (255)
                      .+.++ ..+++.|+|+|||+++|+|||||+||||+|+|+++.||+|++|||||+.+|+++++||++.|.++++
T Consensus       243 ~~~~~-~~~~~~~~~~~~l~~~G~KMSKs~Gn~V~~~dlle~~g~D~lRy~lls~~~~s~ldFs~e~l~~a~~  314 (315)
T d1li5a2         243 TCAHD-GQYVNYWMHSGMVMVDREKMSKSLGNFFTVRDVLKYYDAETVRYFLMSGHYRSQLNYSEENLKQARA  314 (315)
T ss_dssp             HHHSS-SCCEEEECCBCCEEETTBCCCGGGTCCCBHHHHHTTSCHHHHHHHHHSSCTTSCEEECHHHHHHHHH
T ss_pred             hcccc-cccccEEEEEEEEecCCcEecCcCCCcccHHHHHHhCCHHHHHHHHHcCCCCCCCCcCHHHHHHHhh
Confidence            34444 4689999999999999999999999999999999999999999999999999999999999998864

PyMOL of d1li5a2

>d1pfva2 c.26.1.1 (A:4-140,A:176-388) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1rqga2 c.26.1.1 (A:1-138,A:174-396) Methionyl-tRNA synthetase (MetRS) {Pyrococcus abyssi [TaxId: 29292]}	Back information, alignment and structure

>d1ivsa4 c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1ffya3 c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1ilea3 c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2d5ba2 c.26.1.1 (A:1-348) Methionyl-tRNA synthetase (MetRS) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1h3na3 c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1irxa2 c.26.1.1 (A:3-319) Class I lysyl-tRNA synthetase {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1li5a1 a.27.1.1 (A:316-402) Cysteinyl-tRNA synthetase (CysRS) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1iq0a2 c.26.1.1 (A:97-466) Arginyl-tRNA synthetase (ArgRS) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1rqga1 a.27.1.1 (A:397-606) Methionyl-tRNA synthetase (MetRS) {Pyrococcus abyssi [TaxId: 29292]}	Back information, alignment and structure

>d1f7ua2 c.26.1.1 (A:136-483) Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1pfva1 a.27.1.1 (A:389-550) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1h3na1 a.27.1.1 (A:687-814) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2d5ba1 a.27.1.1 (A:349-500) Methionyl-tRNA synthetase (MetRS) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1j09a2 c.26.1.1 (A:1-305) Glutamyl-tRNA synthetase (GluRS) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1iq0a1 a.27.1.1 (A:467-592) Arginyl-tRNA synthetase (ArgRS) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1ivsa2 a.27.1.1 (A:579-796) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1ffya1 a.27.1.1 (A:645-917) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1f7ua1 a.27.1.1 (A:484-607) Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ilea1 a.27.1.1 (A:642-821) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1h3fa1 c.26.1.1 (A:5-347) Tyrosyl-tRNA synthetase (TyrRS) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1jila_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1j1ua_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1gtra2 c.26.1.1 (A:8-338) Glutaminyl-tRNA synthetase (GlnRS) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure