Psyllid ID: psy11885


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------
MVDSKTEYSLNSPPEDGITAVKFAPNSNQFLLASSWDCNVSLYDITNNNLRLKYAHSDPVLDCCFQDAVHSFSGGLDCTLKMFDFNTQTETVIGTHDQPIRAVEYSDEVNCILTGSWDTSVKMWDPRSSRCVGNYTQPDKVFTMSLCGEKFVVGTAGRKVCIWDLRNMGYIMQRRESSLKFQTRCIKCFPNKQGYVLSSIEGRAAVEYLDTGPEMQKMKYAFKCHRIKEDGIEKIYPVNAISFHQEYNTFATGGSDGYVNIWDGFNKKRLCQFHRYDTGITSLCFSYDGNVLAIACSYNYELETPPDPIPPNNIFIRHVTDQETKPK
cccccccccccccccccEEEEEEccccccEEEEEEccccEEEEEccccEEEEcccccccEEEEEEEcccEEEEEEccccEEEEEcccccEEEcccccccEEEEEEcccccEEEEEEccccEEEEEcccccccEEEccccEEEEEEccccEEEEEccccEEEEEEcccccEEEEEEEccccccEEEEEEEccccEEEEEEccccEEEEEccccccccccccccccEEccccccccEEEEEEEEEcccccEEEEEcccccEEEEEccccccccccccccccEEEEEEcccccEEEEEEccccEEccccccccccEEEEEcccccccccc
ccccccEEEEEccccccEEEEEEccccccEEEEEccccEEEEEEcccccEEEEEcccccEEEEEEccccEEEEEccccEEEEEEcccccEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEccccccEEEEEEccccEEEEccccEEEEEEcccccEEEEEEccccccEEEEEEEcccccEEEEEEccccEEEEEEEccccccEEEEEEEcccccccccccEEEEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEccccEEEEEEccccccEEEEEccccccccccc
mvdskteyslnsppedgitavkfapnsnqFLLASswdcnvslyditnnnlrlkyahsdpvldccfqdavhsfsggldctlkmfdfntqtetvigthdqpiraveysdevnciltgswdtsvkmwdprssrcvgnytqpdkvftmslcgekfvvgtagrKVCIWDLRNMGYIMQRRESSLKFQTRCIkcfpnkqgyvlSSIEGRAAveyldtgpemQKMKYAFKCHRikedgiekiypvnaisfhqeyntfatggsdgyvniWDGFnkkrlcqfhrydtgitslcfsydgnVLAIACSYnyeletppdpippnnifirhvtdqetkpk
mvdskteyslnsppedgITAVKFAPNSNQFLLASSWDCNVSLYDITNNNLRLKYAHSDPVLDCCFQDAVHSFSGGLDCTLKMFDFNTQTETvigthdqpiraVEYSDEVNCILTgswdtsvkmwdpRSSRCVGNYTQPDKVFTMSLCGEkfvvgtagrkvcIWDLRNMGYIMQRRESSLKFQTRCIKCFPNKQGYVLSSIEGRAAVEYLDTGPEMQKMKYAFKCHRIKEDGIEKIYPVNAISFHQEYNTFATGGSDGYVNIWDGFNKKRLCQFHRYDTGITSLCFSYDGNVLAIACSYNYELETPPDPIPPNNIFIRHVtdqetkpk
MVDSKTEYSLNSPPEDGITAVKFAPNSNQFLLASSWDCNVSLYDITNNNLRLKYAHSDPVLDCCFQDAVHSFSGGLDCTLKMFDFNTQTETVIGTHDQPIRAVEYSDEVNCILTGSWDTSVKMWDPRSSRCVGNYTQPDKVFTMSLCGEKFVVGTAGRKVCIWDLRNMGYIMQRRESSLKFQTRCIKCFPNKQGYVLSSIEGRAAVEYLDTGPEMQKMKYAFKCHRIKEDGIEKIYPVNAISFHQEYNTFATGGSDGYVNIWDGFNKKRLCQFHRYDTGITSLCFSYDGNVLAIACSYNYELETppdpippnniFIRHVTDQETKPK
******************TAVKFAPNSNQFLLASSWDCNVSLYDITNNNLRLKYAHSDPVLDCCFQDAVHSFSGGLDCTLKMFDFNTQTETVIGTHDQPIRAVEYSDEVNCILTGSWDTSVKMWDPRSSRCVGNYTQPDKVFTMSLCGEKFVVGTAGRKVCIWDLRNMGYIMQRRESSLKFQTRCIKCFPNKQGYVLSSIEGRAAVEYLDTGPEMQKMKYAFKCHRIKEDGIEKIYPVNAISFHQEYNTFATGGSDGYVNIWDGFNKKRLCQFHRYDTGITSLCFSYDGNVLAIACSYNYELET*******NNIFIR**********
MVDSKTEYSLNSPPEDGITAVKFAPNSNQFLLASSWDCNVSLYDITNNNLRLKYAHSDPVLDCCFQDAVHSFSGGLDCTLKMFDFNTQTETVIGTHDQPIRAVEYSDEVNCILTGSWDTSVKMWDPRSSRCVGNYTQPDKVFTMSLCGEKFVVGTAGRKVCIWDLRNMGYI****ESSLKFQTRCIKCFPNKQGYVLSSIEGRAAVEYLDTGPEMQKMKYAFKCHRIKEDGIEKIYPVNAISFHQEYNTFATGGSDGYVNIWDGFNKKRLCQFHRYDTGITSLCFSYDGNVLAIACSYNYELETPPDPIPPNNIFIRHVTD***KP*
************PPEDGITAVKFAPNSNQFLLASSWDCNVSLYDITNNNLRLKYAHSDPVLDCCFQDAVHSFSGGLDCTLKMFDFNTQTETVIGTHDQPIRAVEYSDEVNCILTGSWDTSVKMWDPRSSRCVGNYTQPDKVFTMSLCGEKFVVGTAGRKVCIWDLRNMGYIMQRRESSLKFQTRCIKCFPNKQGYVLSSIEGRAAVEYLDTGPEMQKMKYAFKCHRIKEDGIEKIYPVNAISFHQEYNTFATGGSDGYVNIWDGFNKKRLCQFHRYDTGITSLCFSYDGNVLAIACSYNYELETPPDPIPPNNIFIRHVTDQETKPK
***SKTEYSLNSPPEDGITAVKFAPNSNQFLLASSWDCNVSLYDITNNNLRLKYAHSDPVLDCCFQDAVHSFSGGLDCTLKMFDFNTQTETVIGTHDQPIRAVEYSDEVNCILTGSWDTSVKMWDPRSSRCVGNYTQPDKVFTMSLCGEKFVVGTAGRKVCIWDLRNMGYIMQRRESSLKFQTRCIKCFPNKQGYVLSSIEGRAAVEYLDTGPEMQKMKYAFKCHRIKEDGIEKIYPVNAISFHQEYNTFATGGSDGYVNIWDGFNKKRLCQFHRYDTGITSLCFSYDGNVLAIACSYNYELETPPDPIPPNNIFIRHV********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVDSKTEYSLNSPPEDGITAVKFAPNSNQFLLASSWDCNVSLYDITNNNLRLKYAHSDPVLDCCFQDAVHSFSGGLDCTLKMFDFNTQTETVIGTHDQPIRAVEYSDEVNCILTGSWDTSVKMWDPRSSRCVGNYTQPDKVFTMSLCGEKFVVGTAGRKVCIWDLRNMGYIMQRRESSLKFQTRCIKCFPNKQGYVLSSIEGRAAVEYLDTGPEMQKMKYAFKCHRIKEDGIEKIYPVNAISFHQEYNTFATGGSDGYVNIWDGFNKKRLCQFHRYDTGITSLCFSYDGNVLAIACSYNYELETPPDPIPPNNIFIRHVTDQETKPK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query327 2.2.26 [Sep-21-2011]
Q9WVA3326 Mitotic checkpoint protei yes N/A 0.975 0.978 0.666 1e-130
Q1JQB2326 Mitotic checkpoint protei yes N/A 0.975 0.978 0.666 1e-130
O43684328 Mitotic checkpoint protei yes N/A 0.975 0.972 0.666 1e-130
Q9YGY3330 Mitotic checkpoint protei N/A N/A 0.975 0.966 0.666 1e-130
Q5RB58328 Mitotic checkpoint protei yes N/A 0.975 0.972 0.663 1e-129
Q54DM1331 Mitotic checkpoint protei yes N/A 0.957 0.945 0.445 3e-75
P40066365 Nucleoporin GLE2 OS=Sacch yes N/A 0.990 0.887 0.35 6e-53
Q38942349 Rae1-like protein At1g806 no N/A 0.960 0.899 0.353 1e-50
Q7ZWF0368 mRNA export factor OS=Dan no N/A 0.975 0.866 0.353 1e-50
P41838352 Poly(A)+ RNA export prote yes N/A 0.984 0.914 0.327 2e-49
>sp|Q9WVA3|BUB3_MOUSE Mitotic checkpoint protein BUB3 OS=Mus musculus GN=Bub3 PE=2 SV=2 Back     alignment and function desciption
 Score =  466 bits (1198), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 214/321 (66%), Positives = 257/321 (80%), Gaps = 2/321 (0%)

Query: 7   EYSLNSPPEDGITAVKFAPNSNQFLLASSWDCNVSLYDITNNNLRLKYAHSDPVLDCCFQ 66
           E+ LN PPEDGI++VKF+PN++QFLL SSWD +V LYD+  N++RLKY H+  VLDC F 
Sbjct: 6   EFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFY 65

Query: 67  DAVHSFSGGLDCTLKMFDFNTQTETVIGTHDQPIRAVEYSDEVNCILTGSWDTSVKMWDP 126
           D  H++SGGLD  LKM D NT  E ++GTHD PIR VEY  EVN ++TGSWD +VK+WDP
Sbjct: 66  DPTHAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWDP 125

Query: 127 RSSRCVGNYTQPDKVFTMSLCGEKFVVGTAGRKVCIWDLRNMGYIMQRRESSLKFQTRCI 186
           R+    G ++QP+KV+T+S+ G++ +VGTAGR+V +WDLRNMGY+ QRRESSLK+QTRCI
Sbjct: 126 RTPCNAGTFSQPEKVYTLSVSGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCI 185

Query: 187 KCFPNKQGYVLSSIEGRAAVEYLDTGPEMQKMKYAFKCHRIKEDGIEKIYPVNAISFHQE 246
           + FPNKQGYVLSSIEGR AVEYLD  PE+QK KYAFKCHR+KE+ IE+IYPVNAISFH  
Sbjct: 186 RAFPNKQGYVLSSIEGRVAVEYLDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNI 245

Query: 247 YNTFATGGSDGYVNIWDGFNKKRLCQFHRYDTGITSLCFSYDGNVLAIACSYNYELETPP 306
           +NTFATGGSDG+VNIWD FNKKRLCQFHRY T I SL FS DG  LAIA SY YE++   
Sbjct: 246 HNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTE 305

Query: 307 DPIPPNNIFIRHVTDQETKPK 327
              P + IFIR VTD ETKPK
Sbjct: 306 H--PEDGIFIRQVTDAETKPK 324




Has a dual function in spindle-assembly checkpoint signaling and in promoting the establishment of correct kinetochore-microtubule (K-MT) attachments. Promotes the formation of stable end-on bipolar attachments. Necessary for kinetochore localization of BUB1. The BUB1/BUB3 complex plays a role in the inhibition of anaphase-promoting complex or cyclosome (APC/C) when spindle-assembly checkpoint is activated and inhibits the ubiquitin ligase activity of APC/C by phosphorylating its activator CDC20. This complex can also phosphorylate MAD1L1 (By similarity). Regulates chromosome segregation during oocyte meiosis.
Mus musculus (taxid: 10090)
>sp|Q1JQB2|BUB3_BOVIN Mitotic checkpoint protein BUB3 OS=Bos taurus GN=BUB3 PE=2 SV=1 Back     alignment and function description
>sp|O43684|BUB3_HUMAN Mitotic checkpoint protein BUB3 OS=Homo sapiens GN=BUB3 PE=1 SV=1 Back     alignment and function description
>sp|Q9YGY3|BUB3_XENLA Mitotic checkpoint protein BUB3 OS=Xenopus laevis GN=bub3 PE=1 SV=1 Back     alignment and function description
>sp|Q5RB58|BUB3_PONAB Mitotic checkpoint protein BUB3 OS=Pongo abelii GN=BUB3 PE=2 SV=1 Back     alignment and function description
>sp|Q54DM1|BUB3_DICDI Mitotic checkpoint protein bub3 OS=Dictyostelium discoideum GN=bub3 PE=3 SV=1 Back     alignment and function description
>sp|P40066|GLE2_YEAST Nucleoporin GLE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLE2 PE=1 SV=1 Back     alignment and function description
>sp|Q38942|RAE1L_ARATH Rae1-like protein At1g80670 OS=Arabidopsis thaliana GN=At1g80670 PE=2 SV=2 Back     alignment and function description
>sp|Q7ZWF0|RAE1L_DANRE mRNA export factor OS=Danio rerio GN=rae1 PE=2 SV=2 Back     alignment and function description
>sp|P41838|RAE1_SCHPO Poly(A)+ RNA export protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rae1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query327
193643642328 PREDICTED: mitotic checkpoint protein BU 0.993 0.990 0.729 1e-144
91091890331 PREDICTED: similar to BUB3 budding uninh 0.996 0.984 0.717 1e-142
405953484326 Mitotic checkpoint protein BUB3 [Crassos 0.993 0.996 0.709 1e-140
187610693326 mitotic checkpoint protein [Penaeus mono 0.996 1.0 0.703 1e-139
332027727326 Mitotic checkpoint protein BUB3 [Acromyr 0.996 1.0 0.696 1e-137
156537448326 PREDICTED: mitotic checkpoint protein BU 0.996 1.0 0.696 1e-136
66549453326 PREDICTED: mitotic checkpoint protein BU 0.996 1.0 0.693 1e-136
340709324326 PREDICTED: mitotic checkpoint protein BU 0.996 1.0 0.693 1e-136
443718958328 hypothetical protein CAPTEDRAFT_21337 [C 0.978 0.975 0.688 1e-136
383861126357 PREDICTED: mitotic checkpoint protein BU 0.996 0.913 0.693 1e-136
>gi|193643642|ref|XP_001947199.1| PREDICTED: mitotic checkpoint protein BUB3-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  516 bits (1330), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 237/325 (72%), Positives = 276/325 (84%)

Query: 3   DSKTEYSLNSPPEDGITAVKFAPNSNQFLLASSWDCNVSLYDITNNNLRLKYAHSDPVLD 62
           +S++E+ L +PPEDGI++VKF P+S+QFLL SSWDC+V LYD+  N++R KY H  PVLD
Sbjct: 4   ESRSEFRLKNPPEDGISSVKFGPSSSQFLLVSSWDCSVRLYDVQANSMRTKYTHDRPVLD 63

Query: 63  CCFQDAVHSFSGGLDCTLKMFDFNTQTETVIGTHDQPIRAVEYSDEVNCILTGSWDTSVK 122
             FQDAVHSFSGGLD  LKM+D N+ +E+V+G+HD  +R VEYS+EVN +L+G WD +VK
Sbjct: 64  VSFQDAVHSFSGGLDNKLKMYDLNSNSESVLGSHDNAVRCVEYSNEVNVVLSGGWDGNVK 123

Query: 123 MWDPRSSRCVGNYTQPDKVFTMSLCGEKFVVGTAGRKVCIWDLRNMGYIMQRRESSLKFQ 182
           MWD RSS+CVG   QPDKVFTMS  GEK VVGTAGRKV +WDLRN  YIMQRRES+LKFQ
Sbjct: 124 MWDTRSSQCVGTLPQPDKVFTMSNVGEKLVVGTAGRKVFVWDLRNTAYIMQRRESNLKFQ 183

Query: 183 TRCIKCFPNKQGYVLSSIEGRAAVEYLDTGPEMQKMKYAFKCHRIKEDGIEKIYPVNAIS 242
           TRCI+C PNKQGYVLSSIEGR AVEY DT PE+QK KYAFKCHRIK++ IE IYPVNAIS
Sbjct: 184 TRCIRCSPNKQGYVLSSIEGRVAVEYFDTAPEIQKKKYAFKCHRIKDNDIECIYPVNAIS 243

Query: 243 FHQEYNTFATGGSDGYVNIWDGFNKKRLCQFHRYDTGITSLCFSYDGNVLAIACSYNYEL 302
           FHQ +NTFATGGSDGYVNIWDGFNKKRLCQFHRY+TGITSLCFS+DG+ LAI  SY YE 
Sbjct: 244 FHQVFNTFATGGSDGYVNIWDGFNKKRLCQFHRYNTGITSLCFSHDGSSLAIGSSYMYEQ 303

Query: 303 ETPPDPIPPNNIFIRHVTDQETKPK 327
           +  PDPIP NN++IR+VTDQETKPK
Sbjct: 304 DVHPDPIPENNVYIRYVTDQETKPK 328




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|91091890|ref|XP_970295.1| PREDICTED: similar to BUB3 budding uninhibited by benzimidazoles 3 [Tribolium castaneum] gi|270001257|gb|EEZ97704.1| budding uninhibited by benzimidazoles 3 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|405953484|gb|EKC21138.1| Mitotic checkpoint protein BUB3 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|187610693|gb|ACD13595.1| mitotic checkpoint protein [Penaeus monodon] Back     alignment and taxonomy information
>gi|332027727|gb|EGI67795.1| Mitotic checkpoint protein BUB3 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|156537448|ref|XP_001607033.1| PREDICTED: mitotic checkpoint protein BUB3-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|66549453|ref|XP_393536.2| PREDICTED: mitotic checkpoint protein BUB3 [Apis mellifera] gi|380023328|ref|XP_003695475.1| PREDICTED: mitotic checkpoint protein BUB3-like [Apis florea] Back     alignment and taxonomy information
>gi|340709324|ref|XP_003393260.1| PREDICTED: mitotic checkpoint protein BUB3-like [Bombus terrestris] gi|350425078|ref|XP_003494004.1| PREDICTED: mitotic checkpoint protein BUB3-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|443718958|gb|ELU09330.1| hypothetical protein CAPTEDRAFT_21337 [Capitella teleta] Back     alignment and taxonomy information
>gi|383861126|ref|XP_003706037.1| PREDICTED: mitotic checkpoint protein BUB3-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query327
UNIPROTKB|Q1JQB2326 BUB3 "Mitotic checkpoint prote 0.975 0.978 0.660 9.8e-119
UNIPROTKB|O43684328 BUB3 "Mitotic checkpoint prote 0.975 0.972 0.660 9.8e-119
UNIPROTKB|F2Z5F3328 BUB3 "Uncharacterized protein" 0.975 0.972 0.660 9.8e-119
MGI|MGI:1343463326 Bub3 "budding uninhibited by b 0.975 0.978 0.660 9.8e-119
UNIPROTKB|Q5RB58328 BUB3 "Mitotic checkpoint prote 0.975 0.972 0.657 1.8e-117
UNIPROTKB|Q5ZHW3329 BUB3 "Uncharacterized protein" 0.975 0.969 0.651 1e-116
ZFIN|ZDB-GENE-041010-210326 bub3 "BUB3 budding uninhibited 0.975 0.978 0.641 6.4e-115
UNIPROTKB|J3QT28278 BUB3 "Mitotic checkpoint prote 0.831 0.978 0.683 2.7e-107
UNIPROTKB|E1C9E5258 BUB3 "Uncharacterized protein" 0.773 0.980 0.660 4.2e-95
FB|FBgn0025457327 Bub3 "Bub3" [Drosophila melano 0.975 0.975 0.56 1.4e-94
UNIPROTKB|Q1JQB2 BUB3 "Mitotic checkpoint protein BUB3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 1169 (416.6 bits), Expect = 9.8e-119, P = 9.8e-119
 Identities = 212/321 (66%), Positives = 254/321 (79%)

Query:     7 EYSLNSPPEDGITAVKFAPNSNQFLLASSWDCNVSLYDITNNNLRLKYAHSDPVLDCCFQ 66
             E+ LN PPEDGI++VKF+PN++QFLL SSWD +V LYD+  N++RLKY H+  VLDC F 
Sbjct:     6 EFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFY 65

Query:    67 DAVHSFSGGLDCTLKMFDFNTQTETVIGTHDQPIRAVEYSDEVNCILTGSWDTSVKMWDP 126
             D  H++SGGLD  LKM D NT  E ++GTHD PIR VEY  EVN ++TGSWD +VK+WDP
Sbjct:    66 DPTHAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWDP 125

Query:   127 RSSRCVGNYTQPDKVFTMSLCGEKFVVGTAGRKVCIWDLRNMGYIMQRRESSLKFQTRCI 186
             R+    G ++QP+KV+T+S+ G++ +VGTAGR+V +WDLRNMGY+ QRRESSLK+QTRCI
Sbjct:   126 RTPCNAGTFSQPEKVYTLSVSGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTRCI 185

Query:   187 KCFPNKQGYVLSSIEGRAAVEYLDTGPEMQKMKYAFKCHRIKEDGIEKIYPVNAISFHQE 246
             + FPNKQGYVLSSIEGR AVEYLD  PE+QK KYAFKCHR+KE+ IE+IYPVNAISFH  
Sbjct:   186 RAFPNKQGYVLSSIEGRVAVEYLDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNI 245

Query:   247 YNTFATGGSDGYVNIWDGFNKKRLCQFHRYDTGITSLCFSYDGNVLAIACSYNYELETXX 306
             +NTFATGGSDG+VNIWD FNKKRLCQFHRY T I SL FS DG  LAIA SY YE++   
Sbjct:   246 HNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTE 305

Query:   307 XXXXXXXXFIRHVTDQETKPK 327
                     FIR VTD ETKPK
Sbjct:   306 HPEDGI--FIRQVTDAETKPK 324




GO:0051983 "regulation of chromosome segregation" evidence=ISS
GO:0071173 "spindle assembly checkpoint" evidence=ISS
GO:0005634 "nucleus" evidence=IEA
GO:0000777 "condensed chromosome kinetochore" evidence=IEA
GO:0008608 "attachment of spindle microtubules to kinetochore" evidence=IEA
GO:0000070 "mitotic sister chromatid segregation" evidence=IEA
GO:0051301 "cell division" evidence=IEA
GO:0007126 "meiosis" evidence=IEA
UNIPROTKB|O43684 BUB3 "Mitotic checkpoint protein BUB3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5F3 BUB3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1343463 Bub3 "budding uninhibited by benzimidazoles 3 homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RB58 BUB3 "Mitotic checkpoint protein BUB3" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZHW3 BUB3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041010-210 bub3 "BUB3 budding uninhibited by benzimidazoles 3 homolog (yeast)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|J3QT28 BUB3 "Mitotic checkpoint protein BUB3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C9E5 BUB3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0025457 Bub3 "Bub3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9WVA3BUB3_MOUSENo assigned EC number0.66660.97550.9785yesN/A
O43684BUB3_HUMANNo assigned EC number0.66660.97550.9725yesN/A
Q1JQB2BUB3_BOVINNo assigned EC number0.66660.97550.9785yesN/A
P41838RAE1_SCHPONo assigned EC number0.32730.98470.9147yesN/A
Q54DM1BUB3_DICDINo assigned EC number0.44510.95710.9456yesN/A
P40066GLE2_YEASTNo assigned EC number0.350.99080.8876yesN/A
Q5RB58BUB3_PONABNo assigned EC number0.66350.97550.9725yesN/A
Q9YGY3BUB3_XENLANo assigned EC number0.66660.97550.9666N/AN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query327
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 7e-29
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 8e-23
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 4e-22
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 4e-21
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 5e-17
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-15
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 4e-07
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 8e-05
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 1e-04
smart0032040 smart00320, WD40, WD40 repeats 3e-04
smart0032040 smart00320, WD40, WD40 repeats 4e-04
PTZ00421493 PTZ00421, PTZ00421, coronin; Provisional 0.004
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score =  112 bits (281), Expect = 7e-29
 Identities = 65/292 (22%), Positives = 119/292 (40%), Gaps = 29/292 (9%)

Query: 15  EDGITAVKFAPNSNQFLLASSWDCNVSLYDITNNN-LRLKYAHSDPVLDCCFQDAVHS-F 72
             G+T V F+P+    L   S D  + ++D+     LR    H+ PV D           
Sbjct: 9   TGGVTCVAFSPDGK-LLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDVAASADGTYLA 67

Query: 73  SGGLDCTLKMFDFNTQTET-VIGTHDQPIRAVEYSDEVNCILTGSWDTSVKMWDPRSSRC 131
           SG  D T++++D  T      +  H   + +V +S +   + + S D ++K+WD  + +C
Sbjct: 68  SGSSDKTIRLWDLETGECVRTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVWDVETGKC 127

Query: 132 VGNYT-QPDKVFTMSLCGEKFVVGTAG--RKVCIWDLRNMGYIMQRRESSLKFQT---RC 185
           +       D V +++   +   V ++     + +WDLR    +       L   T     
Sbjct: 128 LTTLRGHTDWVNSVAFSPDGTFVASSSQDGTIKLWDLRTGKCVAT-----LTGHTGEVNS 182

Query: 186 IKCFPNKQGYVLSSIEGRAAVEYLDTGPEMQKMKYAFKCHRIKEDGIEKIYPVNAISFHQ 245
           +   P+ +  + SS +G   +  L TG    K     + H            VN+++F  
Sbjct: 183 VAFSPDGEKLLSSSSDGTIKLWDLSTG----KCLGTLRGHE---------NGVNSVAFSP 229

Query: 246 EYNTFATGGSDGYVNIWDGFNKKRLCQFHRYDTGITSLCFSYDGNVLAIACS 297
           +    A+G  DG + +WD    + +     +   +TSL +S DG  L  + S
Sbjct: 230 DGYLLASGSEDGTIRVWDLRTGECVQTLSGHTNSVTSLAWSPDGKRL-ASGS 280


Length = 289

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|173611 PTZ00421, PTZ00421, coronin; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 327
KOG1036|consensus323 100.0
KOG0647|consensus347 100.0
KOG0271|consensus480 100.0
KOG0271|consensus480 100.0
KOG0272|consensus459 100.0
KOG0315|consensus311 100.0
KOG0286|consensus343 100.0
KOG0282|consensus503 100.0
KOG0316|consensus307 100.0
KOG0279|consensus315 100.0
KOG0265|consensus338 100.0
KOG0292|consensus 1202 100.0
KOG0272|consensus459 100.0
KOG0315|consensus311 100.0
KOG0273|consensus524 100.0
KOG0263|consensus707 100.0
KOG0285|consensus460 100.0
KOG0318|consensus603 100.0
KOG0286|consensus343 100.0
KOG1446|consensus311 100.0
KOG0279|consensus315 100.0
KOG0266|consensus456 100.0
PLN00181793 protein SPA1-RELATED; Provisional 100.0
KOG0295|consensus406 100.0
KOG0296|consensus399 100.0
KOG0291|consensus 893 100.0
KOG0284|consensus464 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.98
KOG0288|consensus459 99.98
KOG0273|consensus524 99.98
KOG0284|consensus464 99.98
KOG0263|consensus707 99.97
KOG0291|consensus 893 99.97
KOG0276|consensus 794 99.97
KOG0278|consensus334 99.97
KOG0275|consensus508 99.97
KOG0645|consensus312 99.97
KOG0283|consensus 712 99.97
KOG0313|consensus423 99.97
KOG0293|consensus519 99.97
KOG1407|consensus313 99.97
KOG0318|consensus603 99.97
PTZ00421 493 coronin; Provisional 99.96
KOG0319|consensus 775 99.96
KOG1407|consensus313 99.96
KOG0277|consensus311 99.96
KOG0299|consensus479 99.96
KOG0310|consensus 487 99.96
KOG0278|consensus334 99.96
KOG0645|consensus312 99.96
KOG0281|consensus499 99.96
KOG0319|consensus 775 99.96
KOG0266|consensus456 99.96
KOG0306|consensus 888 99.96
KOG0281|consensus499 99.96
KOG0643|consensus327 99.96
KOG0268|consensus433 99.95
PTZ00420 568 coronin; Provisional 99.95
KOG0293|consensus519 99.95
PLN00181793 protein SPA1-RELATED; Provisional 99.95
KOG0282|consensus503 99.95
KOG0285|consensus460 99.95
KOG0973|consensus 942 99.94
KOG0265|consensus338 99.94
KOG0295|consensus406 99.94
KOG0305|consensus484 99.94
KOG0643|consensus327 99.94
KOG0294|consensus362 99.94
KOG0296|consensus399 99.93
KOG0308|consensus 735 99.93
PTZ00421 493 coronin; Provisional 99.93
KOG0274|consensus537 99.93
PTZ00420 568 coronin; Provisional 99.93
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.93
KOG0647|consensus347 99.93
KOG0641|consensus350 99.93
KOG0274|consensus537 99.93
KOG0264|consensus422 99.93
KOG0316|consensus307 99.93
KOG1539|consensus 910 99.93
KOG0292|consensus 1202 99.93
KOG0276|consensus 794 99.93
KOG0275|consensus508 99.93
KOG0288|consensus459 99.92
KOG0306|consensus 888 99.92
KOG0277|consensus311 99.92
KOG0289|consensus506 99.92
KOG0772|consensus 641 99.91
KOG2055|consensus514 99.91
KOG0310|consensus 487 99.91
KOG0640|consensus430 99.91
KOG1332|consensus299 99.91
KOG0283|consensus712 99.91
KOG0305|consensus484 99.91
KOG1274|consensus 933 99.91
KOG0772|consensus 641 99.91
KOG0641|consensus350 99.91
KOG0640|consensus430 99.91
KOG0646|consensus 476 99.91
KOG2096|consensus420 99.91
KOG2106|consensus626 99.91
KOG0639|consensus705 99.9
KOG0313|consensus423 99.9
KOG2106|consensus 626 99.9
KOG0267|consensus 825 99.9
KOG0299|consensus479 99.9
KOG4328|consensus498 99.89
KOG4283|consensus397 99.89
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.89
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.89
KOG0289|consensus506 99.89
KOG0294|consensus362 99.89
KOG0301|consensus 745 99.89
KOG0300|consensus481 99.88
KOG0302|consensus440 99.87
KOG1446|consensus311 99.87
KOG0300|consensus481 99.87
KOG0269|consensus 839 99.87
KOG0268|consensus 433 99.87
KOG1036|consensus323 99.86
KOG0321|consensus 720 99.86
KOG0301|consensus 745 99.86
KOG0308|consensus 735 99.85
KOG1408|consensus 1080 99.85
KOG0264|consensus422 99.85
KOG0973|consensus 942 99.85
KOG0269|consensus 839 99.85
KOG0642|consensus577 99.84
KOG0270|consensus463 99.84
KOG2048|consensus 691 99.84
KOG0322|consensus323 99.84
KOG1274|consensus 933 99.83
KOG0267|consensus 825 99.83
KOG0321|consensus 720 99.83
KOG2445|consensus361 99.83
KOG4283|consensus397 99.83
KOG1009|consensus434 99.83
KOG1539|consensus 910 99.82
KOG0639|consensus705 99.82
KOG1408|consensus 1080 99.81
KOG2096|consensus420 99.81
KOG1034|consensus385 99.81
KOG4227|consensus 609 99.81
KOG1273|consensus405 99.81
KOG2055|consensus514 99.81
KOG4378|consensus 673 99.8
KOG2048|consensus 691 99.8
KOG1273|consensus 405 99.8
KOG0646|consensus 476 99.8
KOG1538|consensus 1081 99.8
KOG0650|consensus733 99.8
KOG1063|consensus764 99.79
KOG1332|consensus299 99.79
KOG0302|consensus440 99.76
KOG1963|consensus 792 99.76
KOG0307|consensus 1049 99.76
KOG0290|consensus364 99.74
KOG1517|consensus1387 99.74
KOG1445|consensus 1012 99.74
KOG0303|consensus472 99.74
KOG2919|consensus406 99.73
KOG1034|consensus385 99.73
PRK11028330 6-phosphogluconolactonase; Provisional 99.73
KOG0644|consensus 1113 99.72
KOG2445|consensus361 99.72
KOG1063|consensus 764 99.72
KOG2110|consensus 391 99.71
KOG0270|consensus463 99.71
KOG4328|consensus498 99.71
COG2319466 FOG: WD40 repeat [General function prediction only 99.7
KOG0649|consensus325 99.69
KOG4378|consensus 673 99.69
KOG0771|consensus398 99.69
KOG1334|consensus559 99.67
KOG1587|consensus555 99.66
KOG1007|consensus370 99.66
KOG0307|consensus 1049 99.65
KOG1524|consensus 737 99.65
KOG0303|consensus 472 99.64
KOG1310|consensus 758 99.64
PRK01742429 tolB translocation protein TolB; Provisional 99.64
KOG2111|consensus346 99.64
COG2319466 FOG: WD40 repeat [General function prediction only 99.63
PRK11028330 6-phosphogluconolactonase; Provisional 99.61
KOG1188|consensus376 99.6
KOG1445|consensus1012 99.59
KOG1240|consensus1431 99.59
KOG1517|consensus1387 99.59
KOG1587|consensus555 99.59
KOG0650|consensus733 99.57
KOG0649|consensus325 99.56
KOG1538|consensus 1081 99.56
KOG1963|consensus 792 99.55
KOG1272|consensus 545 99.55
KOG2919|consensus406 99.55
KOG1524|consensus 737 99.55
KOG1009|consensus434 99.53
KOG1007|consensus370 99.52
PRK01742429 tolB translocation protein TolB; Provisional 99.52
KOG1523|consensus361 99.51
PRK03629429 tolB translocation protein TolB; Provisional 99.51
KOG0771|consensus398 99.5
KOG1188|consensus376 99.48
KOG0642|consensus577 99.47
KOG2139|consensus445 99.45
PRK05137435 tolB translocation protein TolB; Provisional 99.44
KOG4227|consensus 609 99.43
KOG2110|consensus391 99.43
KOG1523|consensus 361 99.4
PRK04922433 tolB translocation protein TolB; Provisional 99.4
PRK03629429 tolB translocation protein TolB; Provisional 99.39
PRK04922433 tolB translocation protein TolB; Provisional 99.39
KOG0290|consensus364 99.38
KOG4497|consensus447 99.38
KOG2321|consensus 703 99.37
PRK02889427 tolB translocation protein TolB; Provisional 99.37
KOG1310|consensus 758 99.36
KOG0322|consensus323 99.36
KOG1240|consensus1431 99.35
KOG0644|consensus 1113 99.35
PRK02889427 tolB translocation protein TolB; Provisional 99.35
KOG3881|consensus412 99.35
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.34
PRK05137435 tolB translocation protein TolB; Provisional 99.34
KOG2394|consensus 636 99.34
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.33
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.31
KOG4497|consensus447 99.31
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.31
KOG2111|consensus346 99.31
KOG0974|consensus 967 99.3
KOG3881|consensus412 99.3
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.29
KOG2139|consensus445 99.27
KOG2394|consensus636 99.25
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.22
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.21
KOG4547|consensus 541 99.21
PRK04792448 tolB translocation protein TolB; Provisional 99.2
KOG1272|consensus545 99.2
PRK00178430 tolB translocation protein TolB; Provisional 99.2
PRK00178430 tolB translocation protein TolB; Provisional 99.17
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.09
KOG0974|consensus 967 99.07
KOG1064|consensus2439 99.03
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.03
PRK04792448 tolB translocation protein TolB; Provisional 99.02
KOG1064|consensus2439 99.0
KOG4532|consensus344 98.99
PRK01029428 tolB translocation protein TolB; Provisional 98.99
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.99
KOG2315|consensus 566 98.98
KOG1354|consensus433 98.97
KOG1354|consensus433 98.94
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.93
KOG1334|consensus 559 98.91
KOG2321|consensus 703 98.89
KOG2315|consensus566 98.89
KOG0280|consensus339 98.89
KOG2041|consensus 1189 98.88
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.88
PRK01029428 tolB translocation protein TolB; Provisional 98.86
KOG1409|consensus404 98.83
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.83
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.83
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.79
KOG2314|consensus 698 98.78
KOG3914|consensus390 98.73
KOG2695|consensus425 98.7
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.67
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.66
KOG4190|consensus1034 98.64
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.62
KOG0882|consensus 558 98.62
PRK04043419 tolB translocation protein TolB; Provisional 98.6
KOG3914|consensus390 98.59
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.59
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.57
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.57
KOG0280|consensus339 98.56
PRK04043419 tolB translocation protein TolB; Provisional 98.55
KOG2695|consensus425 98.51
KOG4547|consensus 541 98.51
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.49
KOG4190|consensus1034 98.47
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.46
COG4946668 Uncharacterized protein related to the periplasmic 98.44
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.4
KOG1912|consensus 1062 98.39
KOG1832|consensus1516 98.39
KOG1409|consensus404 98.36
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.35
KOG2041|consensus 1189 98.34
KOG4532|consensus344 98.33
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.29
KOG1275|consensus 1118 98.28
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.24
KOG3617|consensus 1416 98.23
COG4946668 Uncharacterized protein related to the periplasmic 98.19
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.19
KOG1645|consensus463 98.17
KOG2314|consensus 698 98.16
KOG2066|consensus 846 98.16
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.14
KOG2066|consensus 846 98.1
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.1
KOG0309|consensus 1081 98.09
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.06
KOG1008|consensus 783 98.06
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 98.04
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.99
KOG4714|consensus319 97.98
KOG0309|consensus 1081 97.96
KOG0882|consensus 558 97.96
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.92
KOG4714|consensus319 97.87
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.83
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 97.81
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.8
KOG1912|consensus 1062 97.8
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 97.78
KOG1645|consensus463 97.76
KOG1275|consensus 1118 97.72
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.68
KOG3621|consensus 726 97.66
KOG1832|consensus 1516 97.66
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.58
KOG2114|consensus 933 97.57
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 97.57
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.54
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 97.53
KOG1920|consensus 1265 97.51
KOG2114|consensus 933 97.41
PRK02888 635 nitrous-oxide reductase; Validated 97.4
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.35
KOG1920|consensus 1265 97.19
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.18
KOG1008|consensus 783 97.16
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.14
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.12
KOG2395|consensus 644 97.05
KOG2444|consensus238 97.03
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.0
KOG4640|consensus 665 96.95
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.95
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.8
KOG3617|consensus 1416 96.77
KOG4649|consensus354 96.75
KOG3621|consensus 726 96.71
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 96.63
KOG1897|consensus 1096 96.62
KOG2444|consensus238 96.52
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 96.52
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 96.43
COG0823425 TolB Periplasmic component of the Tol biopolymer t 96.33
KOG4640|consensus 665 96.31
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 96.14
KOG4441|consensus571 96.02
COG3391381 Uncharacterized conserved protein [Function unknow 95.86
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 95.8
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 95.55
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 95.5
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.41
KOG2079|consensus 1206 95.3
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 95.14
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 95.04
KOG2395|consensus644 95.01
COG3391381 Uncharacterized conserved protein [Function unknow 94.9
COG0823425 TolB Periplasmic component of the Tol biopolymer t 94.81
PHA02713557 hypothetical protein; Provisional 94.8
KOG4649|consensus354 94.65
PRK02888635 nitrous-oxide reductase; Validated 94.58
COG3386307 Gluconolactonase [Carbohydrate transport and metab 94.56
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 94.51
KOG4499|consensus310 94.34
KOG2079|consensus 1206 94.16
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 94.13
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 94.1
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 93.86
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 93.59
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 93.46
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 93.27
PHA02713557 hypothetical protein; Provisional 93.12
KOG4460|consensus 741 92.79
PRK13616591 lipoprotein LpqB; Provisional 92.64
PF00930 353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 92.61
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 92.58
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 92.52
PF02897 414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 92.29
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 92.11
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 91.98
COG3823262 Glutamine cyclotransferase [Posttranslational modi 91.92
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 91.54
KOG2377|consensus 657 91.37
KOG4499|consensus310 91.36
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 91.21
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 90.76
PF14655 415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 90.39
PRK13616591 lipoprotein LpqB; Provisional 89.62
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 89.25
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 88.98
KOG1897|consensus 1096 88.97
PF11715547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 88.96
COG3490 366 Uncharacterized protein conserved in bacteria [Fun 88.73
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 88.59
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 88.05
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 87.96
KOG4441|consensus571 87.26
COG5167 776 VID27 Protein involved in vacuole import and degra 87.04
COG3386307 Gluconolactonase [Carbohydrate transport and metab 86.57
KOG3630|consensus 1405 86.48
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 85.95
KOG2280|consensus 829 85.89
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 85.85
PF14761 215 HPS3_N: Hermansky-Pudlak syndrome 3 85.75
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 85.59
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 85.08
PHA03098534 kelch-like protein; Provisional 84.98
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 84.2
PHA02790480 Kelch-like protein; Provisional 83.26
PHA03098534 kelch-like protein; Provisional 83.05
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 82.96
KOG3616|consensus 1636 82.78
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 82.44
smart0056433 PQQ beta-propeller repeat. Beta-propeller repeat o 82.41
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 81.82
PF0101138 PQQ: PQQ enzyme repeat family.; InterPro: IPR00237 80.84
TIGR02171 912 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogou 80.65
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 80.48
>KOG1036|consensus Back     alignment and domain information
Probab=100.00  E-value=6.6e-57  Score=363.86  Aligned_cols=320  Identities=56%  Similarity=0.979  Sum_probs=302.3

Q ss_pred             ceeecCCCCCCCeeEEEEecCCCcEEEEEECCCcEEEEECCCCeEEEEecCCCceeeEEEeCCceEEEEecCCcEEEEEc
Q psy11885          6 TEYSLNSPPEDGITAVKFAPNSNQFLLASSWDCNVSLYDITNNNLRLKYAHSDPVLDCCFQDAVHSFSGGLDCTLKMFDF   85 (327)
Q Consensus         6 ~~~~~~~~~~~~I~~i~fs~~~~~~l~s~~~d~~i~iwd~~~~~~~~~~~h~~~v~~~~~~~~~~~~sgs~Dg~i~vwd~   85 (327)
                      .++.+.-++++.|..+.|+|. ...|+++++||++++||+...+++..+.|+.++++|+|.+..++++|+.||.||++|+
T Consensus         4 ~~~~l~npP~d~IS~v~f~~~-~~~LLvssWDgslrlYdv~~~~l~~~~~~~~plL~c~F~d~~~~~~G~~dg~vr~~Dl   82 (323)
T KOG1036|consen    4 NEFELENPPEDGISSVKFSPS-SSDLLVSSWDGSLRLYDVPANSLKLKFKHGAPLLDCAFADESTIVTGGLDGQVRRYDL   82 (323)
T ss_pred             cccccCCCChhceeeEEEcCc-CCcEEEEeccCcEEEEeccchhhhhheecCCceeeeeccCCceEEEeccCceEEEEEe
Confidence            356778888999999999985 4677778899999999999998888899999999999999999999999999999999


Q ss_pred             CCCceeeeecCCccEEEEEEeCCCCEEEEEECCCeEEEEeCCCCceeeeeeCCCcEEEEecCCCeEEEEeCCCeEEEEEC
Q psy11885         86 NTQTETVIGTHDQPIRAVEYSDEVNCILTGSWDTSVKMWDPRSSRCVGNYTQPDKVFTMSLCGEKFVVGTAGRKVCIWDL  165 (327)
Q Consensus        86 ~~~~~~~~~~h~~~V~~l~~~~~~~~l~sgs~d~~i~lwdl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~v~iwD~  165 (327)
                      +++....++.|..+|+++.+++....+++||+|++|++||.+...+...+.....+++++..++.|++|+.++.|.+||+
T Consensus        83 n~~~~~~igth~~~i~ci~~~~~~~~vIsgsWD~~ik~wD~R~~~~~~~~d~~kkVy~~~v~g~~LvVg~~~r~v~iyDL  162 (323)
T KOG1036|consen   83 NTGNEDQIGTHDEGIRCIEYSYEVGCVISGSWDKTIKFWDPRNKVVVGTFDQGKKVYCMDVSGNRLVVGTSDRKVLIYDL  162 (323)
T ss_pred             cCCcceeeccCCCceEEEEeeccCCeEEEcccCccEEEEeccccccccccccCceEEEEeccCCEEEEeecCceEEEEEc
Confidence            99999999999999999999998899999999999999999987777788888899999999999999999999999999


Q ss_pred             CCCccceeeecccceeeeEEeEEeeCCCceEEEeecCeEEEEEccCCcccccceeeeeeeeeccCCeeeEEEeeEEEEec
Q psy11885        166 RNMGYIMQRRESSLKFQTRCIKCFPNKQGYVLSSIEGRAAVEYLDTGPEMQKMKYAFKCHRIKEDGIEKIYPVNAISFHQ  245 (327)
Q Consensus       166 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~h~~~~~~~~~~~~v~~v~~sp  245 (327)
                      |+++...+.++..+..+.+|+++.|+..++++++.+|.+.+.+++..+..+..+++|+||+..+.+.+.++||++++|||
T Consensus       163 Rn~~~~~q~reS~lkyqtR~v~~~pn~eGy~~sSieGRVavE~~d~s~~~~skkyaFkCHr~~~~~~~~~yPVNai~Fhp  242 (323)
T KOG1036|consen  163 RNLDEPFQRRESSLKYQTRCVALVPNGEGYVVSSIEGRVAVEYFDDSEEAQSKKYAFKCHRLSEKDTEIIYPVNAIAFHP  242 (323)
T ss_pred             ccccchhhhccccceeEEEEEEEecCCCceEEEeecceEEEEccCCchHHhhhceeEEeeecccCCceEEEEeceeEecc
Confidence            99998888899999999999999999999999999999999999988777888999999999999999999999999999


Q ss_pred             CCCeEEEecCCCeEEEEeCCCceeeeecCcCCcceEEEEECCCCCEEEEEEccccccCCCCCCCCCCcEEEEEccccccc
Q psy11885        246 EYNTFATGGSDGYVNIWDGFNKKRLCQFHRYDTGITSLCFSYDGNVLAIACSYNYELETPPDPIPPNNIFIRHVTDQETK  325 (327)
Q Consensus       246 d~~~lasgs~dg~i~iWd~~~~~~~~~~~~~~~~v~~l~fspdg~~la~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  325 (327)
                      -.++||||+.||.|.+||..+.+++.++.+.+..|-+++||-||..||+|+++.++.+..| .++.+.|||+.++|.+.+
T Consensus       243 ~~~tfaTgGsDG~V~~Wd~~~rKrl~q~~~~~~SI~slsfs~dG~~LAia~sy~ye~~~~~-~~~~~~i~I~~l~d~e~~  321 (323)
T KOG1036|consen  243 IHGTFATGGSDGIVNIWDLFNRKRLKQLAKYETSISSLSFSMDGSLLAIASSYQYERADTP-THERNAIFIRDLTDYETK  321 (323)
T ss_pred             ccceEEecCCCceEEEccCcchhhhhhccCCCCceEEEEeccCCCeEEEEechhhhcCCCC-CCCCCceEEEeccccccC
Confidence            9999999999999999999999999999999888999999999999999999999999988 999999999999999999


Q ss_pred             CC
Q psy11885        326 PK  327 (327)
Q Consensus       326 ~~  327 (327)
                      ||
T Consensus       322 pk  323 (323)
T KOG1036|consen  322 PK  323 (323)
T ss_pred             CC
Confidence            97



>KOG0647|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>smart00564 PQQ beta-propeller repeat Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF01011 PQQ: PQQ enzyme repeat family Back     alignment and domain information
>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171 Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query327
3mmy_A368 Structural And Functional Analysis Of The Interacti 6e-48
2i3s_A349 Bub3 Complex With Bub1 Glebs Motif Length = 349 9e-25
2i3t_A341 Bub3 Complex With Mad3 (Bubr1) Glebs Motif Length = 9e-25
1yfq_A342 High Resolution S. Cerevisiae Bub3 Mitotic Checkpoi 1e-24
1u4c_A349 Structure Of Spindle Checkpoint Protein Bub3 Length 5e-24
3zey_7318 High-resolution Cryo-electron Microscopy Structure 2e-08
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 3e-08
2gnq_A336 Structure Of Wdr5 Length = 336 1e-07
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 1e-07
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 1e-07
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 1e-07
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 1e-07
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 1e-07
2h9l_A329 Wdr5delta23 Length = 329 1e-07
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 2e-07
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 2e-07
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 2e-07
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 2e-07
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 2e-07
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 2e-07
2g9a_A311 Structural Basis For The Specific Recognition Of Me 2e-07
2g99_A308 Structural Basis For The Specific Recognition Of Me 2e-07
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 2e-07
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 4e-07
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 4e-07
1a0r_B340 Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA- 3e-06
1got_B340 Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer 3e-06
2bcj_B340 Crystal Structure Of G Protein-coupled Receptor Kin 7e-06
1gg2_B340 G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet 7e-06
3sn6_B351 Crystal Structure Of The Beta2 Adrenergic Receptor- 9e-06
3dm0_A694 Maltose Binding Protein Fusion With Rack1 From A. T 2e-05
3dm0_A694 Maltose Binding Protein Fusion With Rack1 From A. T 8e-04
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 7e-05
2pbi_B354 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 7e-05
2pbi_B354 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 9e-05
4aow_A340 Crystal Structure Of The Human Rack1 Protein At A R 1e-04
2zkq_a317 Structure Of A Mammalian Ribosomal 40s Subunit With 1e-04
1p22_A435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 5e-04
>pdb|3MMY|A Chain A, Structural And Functional Analysis Of The Interaction Between The Nucleoporin Nup98 And The Mrna Export Factor Rae1 Length = 368 Back     alignment and structure

Iteration: 1

Score = 187 bits (476), Expect = 6e-48, Method: Compositional matrix adjust. Identities = 105/309 (33%), Positives = 164/309 (53%), Gaps = 16/309 (5%) Query: 7 EYSLNSPPEDGITAVKFAPNS--NQFLLASSWDCNVSLYDITNNNLRLKYA---HSDPVL 61 + + S P+D I + F+P + FL+A SW +V +++ ++ + A H+ PVL Sbjct: 31 DIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVL 90 Query: 62 DCCFQD-AVHSFSGGLDCTLKMFDFNTQTETVIGTHDQPIRAVEYSDEVN--CILTGSWD 118 D C+ D F+ D T KM+D ++ I HD P++ + + N C++TGSWD Sbjct: 91 DVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWD 150 Query: 119 TSVKMWDPRSSRCVGNYTQPDKVFTMSLCGEKFVVGTAGRKVCIWDLRNMGYIMQRRESS 178 ++K WD RSS + P++ + + VV TA R + ++ L N +R ES Sbjct: 151 KTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESP 210 Query: 179 LKFQTRCIKCFPNKQ----GYVLSSIEGRAAVEYLDTGPEMQKMKYAFKCHR---IKEDG 231 LK Q RC+ F +KQ G+ L SIEGR A+ Y++ P K + FKCHR Sbjct: 211 LKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYINP-PNPAKDNFTFKCHRSNGTNTSA 269 Query: 232 IEKIYPVNAISFHQEYNTFATGGSDGYVNIWDGFNKKRLCQFHRYDTGITSLCFSYDGNV 291 + IY VN I+FH + T AT GSDG + WD + +L + D I++ CF+++GN+ Sbjct: 270 PQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNI 329 Query: 292 LAIACSYNY 300 A A SY++ Sbjct: 330 FAYASSYDW 338
>pdb|2I3S|A Chain A, Bub3 Complex With Bub1 Glebs Motif Length = 349 Back     alignment and structure
>pdb|2I3T|A Chain A, Bub3 Complex With Mad3 (Bubr1) Glebs Motif Length = 341 Back     alignment and structure
>pdb|1YFQ|A Chain A, High Resolution S. Cerevisiae Bub3 Mitotic Checkpoint Protein Length = 342 Back     alignment and structure
>pdb|1U4C|A Chain A, Structure Of Spindle Checkpoint Protein Bub3 Length = 349 Back     alignment and structure
>pdb|3ZEY|7 Chain 7, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 318 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|1A0R|B Chain B, Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA-Gamma Length = 340 Back     alignment and structure
>pdb|1GOT|B Chain B, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 340 Back     alignment and structure
>pdb|2BCJ|B Chain B, Crystal Structure Of G Protein-coupled Receptor Kinase 2 In Complex With Galpha-q And Gbetagamma Subunits Length = 340 Back     alignment and structure
>pdb|1GG2|B Chain B, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 340 Back     alignment and structure
>pdb|3SN6|B Chain B, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 351 Back     alignment and structure
>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 Back     alignment and structure
>pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 Back     alignment and structure
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query327
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.98
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.98
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.98
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.97
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.97
3jro_A 753 Fusion protein of protein transport protein SEC13 99.97
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.97
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.97
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.97
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.97
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.97
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.97
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.97
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.97
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.97
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.97
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.97
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.97
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.97
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.97
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.97
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.97
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.97
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.96
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.96
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.96
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.96
2pm7_B297 Protein transport protein SEC13, protein transport 99.96
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.96
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.96
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.96
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.96
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.96
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.96
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.96
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.96
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.96
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.95
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.95
3jrp_A379 Fusion protein of protein transport protein SEC13 99.95
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.95
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.95
3jro_A 753 Fusion protein of protein transport protein SEC13 99.94
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.94
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.93
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.93
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.93
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.93
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.92
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.91
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.91
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.91
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.9
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.9
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.9
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.89
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.89
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.89
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.89
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.87
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.87
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.87
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.87
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.87
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.86
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.86
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.85
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.85
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.84
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.84
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.83
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.83
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.82
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.79
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.79
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.78
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.78
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.78
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.77
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.75
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.74
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.73
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.72
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.72
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.71
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.7
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.7
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.69
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.68
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.68
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.66
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.65
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.64
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.63
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.61
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.61
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.59
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.55
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.54
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.54
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.52
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.51
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.51
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.49
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.48
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.47
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.47
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.47
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.46
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 99.45
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.45
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.43
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.4
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.4
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.4
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.38
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.36
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.34
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.31
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.31
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.29
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.28
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.26
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.25
2qe8_A343 Uncharacterized protein; structural genomics, join 99.25
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.24
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.22
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 99.22
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.22
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.21
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 99.2
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.18
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.13
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.12
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.11
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.09
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 99.07
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.07
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.05
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.05
2ece_A462 462AA long hypothetical selenium-binding protein; 99.03
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.02
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.97
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.95
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.94
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.93
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.93
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.91
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.87
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.84
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.82
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 98.78
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 98.72
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.68
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.68
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.65
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.65
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 98.61
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.59
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.58
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 98.58
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.5
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.49
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.48
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 98.46
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.41
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.4
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.35
2qe8_A343 Uncharacterized protein; structural genomics, join 98.35
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.34
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.31
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.28
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.24
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.22
2ece_A462 462AA long hypothetical selenium-binding protein; 98.21
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.2
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.16
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.12
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 98.06
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.05
3v9f_A 781 Two-component system sensor histidine kinase/RESP 98.03
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 97.95
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 97.93
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.91
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.76
3v9f_A 781 Two-component system sensor histidine kinase/RESP 97.69
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 97.5
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 97.49
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.43
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.35
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.31
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 97.16
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.12
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.09
3v65_B386 Low-density lipoprotein receptor-related protein; 97.04
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 96.93
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 96.93
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 96.92
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 96.8
3v65_B386 Low-density lipoprotein receptor-related protein; 96.78
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 96.73
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 96.69
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 96.65
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 96.64
1bpo_A 494 Protein (clathrin); clathrin endocytosis beta-prop 96.58
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 96.3
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 96.25
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 96.13
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 95.86
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 95.83
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 95.74
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 95.63
2p4o_A306 Hypothetical protein; putative lactonase, structur 95.59
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 95.56
3p5b_L400 Low density lipoprotein receptor variant; B-propel 95.42
3p5b_L400 Low density lipoprotein receptor variant; B-propel 95.33
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 95.21
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 95.11
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 94.8
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 94.74
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 94.65
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 94.6
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 94.58
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 94.47
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 94.18
3kya_A496 Putative phosphatase; structural genomics, joint c 94.07
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 93.46
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 93.45
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 93.33
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 92.75
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 92.46
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 92.41
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 92.4
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 92.33
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 91.17
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 90.83
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 90.43
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 89.8
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 89.57
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 89.36
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 88.9
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 87.65
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 86.47
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 84.8
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 83.79
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 83.01
3kya_A496 Putative phosphatase; structural genomics, joint c 82.94
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 82.76
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 82.59
3das_A 347 Putative oxidoreductase; aldose sugar dehydrogenas 82.56
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 81.58
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 81.27
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 80.91
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 80.36
3zwu_A592 Alkaline phosphatase PHOX; hydrolase, beta-propell 80.28
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=6e-40  Score=290.47  Aligned_cols=319  Identities=34%  Similarity=0.667  Sum_probs=254.7

Q ss_pred             eeecCCCCCCCeeEEEEecCC--CcEEEEEECCCcEEEEECCC-CeE--EEEecCCCceeeEEEe-CCceEEEEecCCcE
Q psy11885          7 EYSLNSPPEDGITAVKFAPNS--NQFLLASSWDCNVSLYDITN-NNL--RLKYAHSDPVLDCCFQ-DAVHSFSGGLDCTL   80 (327)
Q Consensus         7 ~~~~~~~~~~~I~~i~fs~~~--~~~l~s~~~d~~i~iwd~~~-~~~--~~~~~h~~~v~~~~~~-~~~~~~sgs~Dg~i   80 (327)
                      .......|.+.|++++|+|++  +.+|++++.|+.|++||+.+ ++.  .....|..+|.+++|+ ++.++++++.|+.|
T Consensus        31 ~~~~~~~h~~~v~~~~~~~~~~~g~~l~~~~~dg~i~iw~~~~~~~~~~~~~~~h~~~v~~~~~~~~~~~l~s~~~dg~v  110 (368)
T 3mmy_A           31 DIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTA  110 (368)
T ss_dssp             CEECSSCCSSCEEEEEECCTTSSSEEEEEEETTSEEEEEEECTTSCEEEEEEEECSSCEEEEEECTTSSEEEEEETTSEE
T ss_pred             eeEeccCCCCceEEEEEcCCCCCceEEEEECCCCcEEEEEcCCCCceeEEEeccccCCEEEEEECcCCCEEEEEcCCCcE
Confidence            344556788999999999964  58999999999999999987 443  4455799999999995 77899999999999


Q ss_pred             EEEEcCCCceeeeecCCccEEEEEE--eCCCCEEEEEECCCeEEEEeCCCCceeeeeeCCCcEEEEecCCCeEEEEeCCC
Q psy11885         81 KMFDFNTQTETVIGTHDQPIRAVEY--SDEVNCILTGSWDTSVKMWDPRSSRCVGNYTQPDKVFTMSLCGEKFVVGTAGR  158 (327)
Q Consensus        81 ~vwd~~~~~~~~~~~h~~~V~~l~~--~~~~~~l~sgs~d~~i~lwdl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~  158 (327)
                      ++||++++....+..|..+|.+++|  +++++.|++++.|+.|++||+++++++..+..+..+.++.+.+..+++++.++
T Consensus       111 ~iwd~~~~~~~~~~~~~~~v~~~~~~~~~~~~~l~~~~~dg~i~vwd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  190 (368)
T 3mmy_A          111 KMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAER  190 (368)
T ss_dssp             EEEETTTTEEEEEEECSSCEEEEEEEECSSCEEEEEEETTSEEEEECSSCSSCSEEEECSSCEEEEEEETTEEEEEEGGG
T ss_pred             EEEEcCCCCceeeccccCceEEEEEEeCCCCCEEEEccCCCcEEEEECCCCcEEEEEecCCCceEEEecCCeeEEEeCCC
Confidence            9999998887777789999999999  89999999999999999999999999988888888888888888999999999


Q ss_pred             eEEEEECCCCccceeeecccceeeeEEeEEeeCCCc----eEEEeecCeEEEEEccCCcccccceeeeeeeeecc---CC
Q psy11885        159 KVCIWDLRNMGYIMQRRESSLKFQTRCIKCFPNKQG----YVLSSIEGRAAVEYLDTGPEMQKMKYAFKCHRIKE---DG  231 (327)
Q Consensus       159 ~v~iwD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~h~~~~---~~  231 (327)
                      .+++||++..................++.+.+....    +++++.++.+.+|.++..... .....+..|....   ..
T Consensus       191 ~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dg~i~i~~~~~~~~~-~~~~~~~~~~~~~~~~~~  269 (368)
T 3mmy_A          191 GLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYINPPNPA-KDNFTFKCHRSNGTNTSA  269 (368)
T ss_dssp             CEEEEECSSSCEEEEECCCSCSSCEEEEEEEECTTSCEEEEEEEETTSEEEEEESSCSCHH-HHSEEEECSEEC----CC
T ss_pred             cEEEEEeccccchhhhccccccCCCceEEEcccCCCCCCeEEEecCCCcEEEEecCCCCcc-ccceeeeeeecccccccc
Confidence            999999987654333333333334456666665544    888888888888776654321 2223334443211   11


Q ss_pred             eeeEEEeeEEEEecCCCeEEEecCCCeEEEEeCCCceeeeecCcCCcceEEEEECCCCCEEEEEEccccccCCC-CCCCC
Q psy11885        232 IEKIYPVNAISFHQEYNTFATGGSDGYVNIWDGFNKKRLCQFHRYDTGITSLCFSYDGNVLAIACSYNYELETP-PDPIP  310 (327)
Q Consensus       232 ~~~~~~v~~v~~spd~~~lasgs~dg~i~iWd~~~~~~~~~~~~~~~~v~~l~fspdg~~la~~~~~~~~~~~~-~~~~~  310 (327)
                      ..+..+|.+++|+|++++|++|+.||.|++||+.+++.+..+..|..+|++++|||||++||+++++++..... -+.-.
T Consensus       270 ~~~~~~v~~~~~sp~~~~l~s~~~dg~i~iwd~~~~~~~~~~~~~~~~v~~~~~s~~g~~l~~~s~d~~~~~~~~~~~~~  349 (368)
T 3mmy_A          270 PQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQK  349 (368)
T ss_dssp             CEEECCEEEEEECTTTCCEEEEETTSCEEEEETTTTEEEEECCCCSSCEEEEEECTTSSCEEEEECCCSTTCGGGCCTTS
T ss_pred             cccccceEEEEEecCCCEEEEEccCCeEEEEECCCCcEEEEecCCCCCceEEEECCCCCeEEEEecccccccccccCCCc
Confidence            22334699999999999999999999999999999999999999999999999999999999999887655542 34457


Q ss_pred             CCcEEEEEcccccccCC
Q psy11885        311 PNNIFIRHVTDQETKPK  327 (327)
Q Consensus       311 ~~~~~~~~~~~~~~~~~  327 (327)
                      .+.|++..+.+ +-+||
T Consensus       350 ~~~i~~~~~~~-~~~p~  365 (368)
T 3mmy_A          350 KNYIFLRNAAE-ELKPR  365 (368)
T ss_dssp             CCEEEEECCTT-TTSBC
T ss_pred             cceeeehhcCc-ccCcc
Confidence            78999999885 66664



>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 327
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 1e-33
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-20
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-11
d1vyhc1 317 b.69.4.1 (C:92-408) Platelet-activating factor ace 7e-05
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 4e-18
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 4e-11
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 7e-10
d1tbga_ 340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 9e-06
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 8e-16
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-13
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-11
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-10
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-08
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-13
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 4e-07
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 1e-04
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 5e-13
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 3e-10
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 8e-09
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 5e-07
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-11
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 3e-07
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-06
d1gxra_ 337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-04
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 5e-11
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-10
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 6e-04
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 6e-04
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 0.003
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 3e-10
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 0.002
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 0.003
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 3e-10
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-09
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 8e-06
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 5e-05
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 4e-04
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 9e-04
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 3e-09
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 2e-04
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 0.002
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 3e-09
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 4e-04
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 3e-08
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 0.003
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-06
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 8e-05
d1pbyb_ 337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 0.002
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-06
d1jmxb_ 346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 5e-05
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-04
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-04
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 3e-06
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 1e-05
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 2e-04
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: Cell cycle arrest protein BUB3
domain: Cell cycle arrest protein BUB3
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score =  124 bits (310), Expect = 1e-33
 Identities = 66/312 (21%), Positives = 125/312 (40%), Gaps = 23/312 (7%)

Query: 10  LNSPPEDGITAVKFAPNSNQFLLASSWDCNVSLYDITNNN----LRLKYAHSDPVLDCCF 65
           +   P+D I+ +K  P+ +  LL +SWD ++++Y          L     +  P+L C F
Sbjct: 6   IEQAPKDYISDIKIIPSKS-LLLITSWDGSLTVYKFDIQAKNVDLLQSLRYKHPLLCCNF 64

Query: 66  QD----AVHSFSGGLDCTLKMFDFNTQTETVIGTHDQPIRAVEYSDEVNCILTGSWDTSV 121
            D     ++  +   +        +   + +                 + ++  SWD  +
Sbjct: 65  IDNTDLQIYVGTVQGEILKVDLIGSPSFQALTNNEANLGICRICKYGDDKLIAASWDGLI 124

Query: 122 KMWDPRSSRC---------VGNYTQPDKVFTMSLCGEKFVVGTAGRKVCIWDLRNM--GY 170
           ++ DPR+              N    +K+FTM     + +VG    +V  + L       
Sbjct: 125 EVIDPRNYGDGVIAVKNLNSNNTKVKNKIFTMDTNSSRLIVGMNNSQVQWFRLPLCEDDN 184

Query: 171 IMQRRESSLKFQTRCIKCFPNKQGYVLSSIEGRAAVEYLDTGPEM--QKMKYAFKCHRIK 228
                                ++GY  SSI+GR AVE+ D   +      ++AF+CHR+ 
Sbjct: 185 GTIEESGLKYQIRDVALLPKEQEGYACSSIDGRVAVEFFDDQGDDYNSSKRFAFRCHRLN 244

Query: 229 EDGIEKIYPVNAISFHQEYNTFATGGSDGYVNIWDGFNKKRLCQFHRYDTGITSLCFSYD 288
                  YPVN+I F   +    T GSDG ++ W+   +K++  F +++   + +  +  
Sbjct: 245 LKDTNLAYPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNE-DSVVKIACS 303

Query: 289 GNVLAIACSYNY 300
            N+L +A S + 
Sbjct: 304 DNILCLATSDDT 315


>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query327
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.97
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.97
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.97
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.97
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.97
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.97
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.96
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.96
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.96
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.95
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.94
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.94
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.94
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.93
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.92
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.92
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.92
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.91
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.91
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.9
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.89
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.87
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.85
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.83
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.79
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.79
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.78
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.71
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.71
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.7
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.68
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.66
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.64
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.64
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.6
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.48
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.35
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.33
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.28
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.25
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.1
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.95
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.77
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.75
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.71
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.71
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.42
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.38
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.33
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.33
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.25
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.07
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.0
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.96
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.94
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.9
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.79
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.69
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.48
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 97.31
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 96.71
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 95.91
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 95.56
d1fwxa2 459 Nitrous oxide reductase, N-terminal domain {Paraco 94.75
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 94.45
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 94.44
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 94.36
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 94.22
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 93.66
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 93.56
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 92.53
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 92.53
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 92.43
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 92.35
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 91.57
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 91.3
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 90.23
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 89.75
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 88.51
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 87.72
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 82.71
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 81.61
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=9.7e-37  Score=266.17  Aligned_cols=268  Identities=17%  Similarity=0.227  Sum_probs=212.7

Q ss_pred             CCCCCeeEEEEecCCCcEEEEEECCCcEEEEECCCCeE------EEEecCCCceeeEEEe-CCceEEEEecCCcEEEEEc
Q psy11885         13 PPEDGITAVKFAPNSNQFLLASSWDCNVSLYDITNNNL------RLKYAHSDPVLDCCFQ-DAVHSFSGGLDCTLKMFDF   85 (327)
Q Consensus        13 ~~~~~I~~i~fs~~~~~~l~s~~~d~~i~iwd~~~~~~------~~~~~h~~~v~~~~~~-~~~~~~sgs~Dg~i~vwd~   85 (327)
                      .|.+.|++++|+|+ +++|++|+ ||.|+|||+.+++.      .....|.+.|.+++|+ ++.++++|+.|++|++||+
T Consensus        49 ~H~~~V~~v~fs~~-g~~latg~-dg~V~iWd~~~~~~~~~~~~~~~~~h~~~I~~v~~s~dg~~l~s~~~dg~i~iwd~  126 (337)
T d1gxra_          49 NHGEVVCAVTISNP-TRHVYTGG-KGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDL  126 (337)
T ss_dssp             CCSSCCCEEEECSS-SSEEEEEC-BSEEEEEETTSTTCCSCSEEEECSCTTSBEEEEEECTTSSEEEEEESSSEEEEEEC
T ss_pred             CCCCcEEEEEECCC-CCEEEEEE-CCEEEEEEccCCcccceeEEeeecCCCCcEEEEEEcCCCCEEEEeecccccccccc
Confidence            57789999999995 58999987 89999999976431      1223688899999995 7889999999999999999


Q ss_pred             CCCce---eeeecCCccEEEEEEeCCCCEEEEEECCCeEEEEeCCCCceeeeeeCC-CcE--EEEecCCCeEEEEeCCCe
Q psy11885         86 NTQTE---TVIGTHDQPIRAVEYSDEVNCILTGSWDTSVKMWDPRSSRCVGNYTQP-DKV--FTMSLCGEKFVVGTAGRK  159 (327)
Q Consensus        86 ~~~~~---~~~~~h~~~V~~l~~~~~~~~l~sgs~d~~i~lwdl~~~~~~~~~~~~-~~~--~~~~~~~~~~~~~~~d~~  159 (327)
                      .....   ..+..|...|..++|+|++..+++++.|+.|++||++++++......+ ..+  +++++.+..+++++.|+.
T Consensus       127 ~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~s~~~d~~i~~~~~~~~~~~~~~~~~~~~v~~l~~s~~~~~~~~~~~d~~  206 (337)
T d1gxra_         127 AAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNT  206 (337)
T ss_dssp             CCC--EEEEEEECSSSCEEEEEECTTSSEEEEEETTSCEEEEETTTTEEEEEECCCSSCEEEEEECTTSSEEEEEETTSE
T ss_pred             cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            76543   235678899999999999999999999999999999998877665542 334  445567889999999999


Q ss_pred             EEEEECCCCccceeeecccceeeeEEeEEeeCCCceEEEeecCeEEEEEccCCcccccceeeeeeeeeccCCeeeEEEee
Q psy11885        160 VCIWDLRNMGYIMQRRESSLKFQTRCIKCFPNKQGYVLSSIEGRAAVEYLDTGPEMQKMKYAFKCHRIKEDGIEKIYPVN  239 (327)
Q Consensus       160 v~iwD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~h~~~~~~~~~~~~v~  239 (327)
                      |++||+++.+.+...   .......++++.|+++.+++++.++.+.++........     ....|         ..+|.
T Consensus       207 v~i~d~~~~~~~~~~---~~~~~i~~l~~~~~~~~l~~~~~d~~i~i~d~~~~~~~-----~~~~~---------~~~i~  269 (337)
T d1gxra_         207 VRSWDLREGRQLQQH---DFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKY-----QLHLH---------ESCVL  269 (337)
T ss_dssp             EEEEETTTTEEEEEE---ECSSCEEEEEECTTSSEEEEEETTSCEEEEETTSSCEE-----EECCC---------SSCEE
T ss_pred             ccccccccceeeccc---ccccceEEEEEcccccccceeccccccccccccccccc-----ccccc---------ccccc
Confidence            999999987643221   22334577888888888888888888888665443211     11112         12588


Q ss_pred             EEEEecCCCeEEEecCCCeEEEEeCCCceeeeecCcCCcceEEEEECCCCCEEEEEEcccc
Q psy11885        240 AISFHQEYNTFATGGSDGYVNIWDGFNKKRLCQFHRYDTGITSLCFSYDGNVLAIACSYNY  300 (327)
Q Consensus       240 ~v~~spd~~~lasgs~dg~i~iWd~~~~~~~~~~~~~~~~v~~l~fspdg~~la~~~~~~~  300 (327)
                      +++|+|++++|++|+.||.|++||..+++.+..+ .|..+|++++|||||++||+|+.++.
T Consensus       270 ~v~~s~~g~~l~s~s~Dg~i~iwd~~~~~~~~~~-~~~~~v~~~~~s~d~~~l~t~s~D~~  329 (337)
T d1gxra_         270 SLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQS-KESSSVLSCDISVDDKYIVTGSGDKK  329 (337)
T ss_dssp             EEEECTTSSEEEEEETTSEEEEEETTTCCEEEEE-ECSSCEEEEEECTTSCEEEEEETTSC
T ss_pred             eEEECCCCCEEEEEeCCCeEEEEECCCCCEEEEc-cCCCCEEEEEEeCCCCEEEEEeCCCe
Confidence            9999999999999999999999999999888765 46788999999999999999986543



>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure