Psyllid ID: psy11889

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
MHANPENDFNSIPLGLWWALVTMTTVGYGDMVPKTYVGMFVGALCALAGVLTIALPVPVIVSNFSRFYSHAQARSKLPKKRRRVLPVEQPRPKRGESVNVINRRMTAIKNNPSMFTGAKIGSN
ccccccccccccccHHHEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHcccHHHHccHHHHHHHHHHHcccHHHHHcccccccccccccccHHHHHccccccccccccccccccccc
cccccccccccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHEEccccEEEccHHHHHHHHHHHHHcHHHHHHcccccccccccccccccccccccccccccccccccccccc
mhanpendfnsiplGLWWALVTMTTvgygdmvpktYVGMFVGALCALAGVltialpvpvivsnfsrfyshaqarsklpkkrrrvlpveqprpkrgesvNVINRRMTaiknnpsmftgakigsn
MHANPENDFNSIPLGLWWALVTMTTVGYGDMVPKTYVGMFVGALCALAGVLTIALPVPVIVSNFSRFYShaqarsklpkkrrrvlpveqprpkrgesvnvinrrmtaiknnpsmftgakigsn
MHANPENDFNSIPLGLWWALVTMTTVGYGDMVPKTYVGMFVGALCALAGVLTIALPVPVIVSNFSRFYSHAQARSKLPKKRRRVLPVEQPRPKRGESVNVINRRMTAIKNNPSMFTGAKIGSN
*********NSIPLGLWWALVTMTTVGYGDMVPKTYVGMFVGALCALAGVLTIALPVPVIVSNFSRFYSH*****************************************************
******NDFNSIPLGLWWALVTMTTVGYGDMVPKTYVGMFVGALCALAGVLTIALPVPVIVSNFSRFY*******************************************************
MHANPENDFNSIPLGLWWALVTMTTVGYGDMVPKTYVGMFVGALCALAGVLTIALPVPVIVSNFSRFYSHA***********RVLPVEQPRPKRGESVNVINRRMTAIKNNPSMFTGAKIGSN
******NDFNSIPLGLWWALVTMTTVGYGDMVPKTYVGMFVGALCALAGVLTIALPVPVIVSNFSRFYSHAQARSKLPK****V***************************************
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHANPENDFNSIPLGLWWALVTMTTVGYGDMVPKTYVGMFVGALCALAGVLTIALPVPVIVSNFSRFYSHAQARSKLPKKRRRVLPVEQPRPKRGESVNVINRRMTAIKNNPSMFTGAKIGSN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query123 2.2.26 [Sep-21-2011]
P17972498 Potassium voltage-gated c no N/A 0.764 0.188 0.861 1e-43
G5EFC3558 Potassium voltage-gated c yes N/A 0.739 0.163 0.769 1e-37
Q14B80 642 Potassium voltage-gated c yes N/A 0.682 0.130 0.642 8e-28
P22462 638 Potassium voltage-gated c yes N/A 0.682 0.131 0.642 8e-28
Q96PR1 638 Potassium voltage-gated c no N/A 0.682 0.131 0.642 1e-27
Q63734625 Potassium voltage-gated c no N/A 0.577 0.113 0.704 4e-25
Q8R1C0628 Potassium voltage-gated c no N/A 0.577 0.113 0.704 4e-25
Q03721 635 Potassium voltage-gated c no N/A 0.577 0.111 0.704 4e-25
Q16322511 Potassium voltage-gated c no N/A 0.796 0.191 0.544 4e-24
P25122585 Potassium voltage-gated c no N/A 0.577 0.121 0.676 6e-24
>sp|P17972|KCNAW_DROME Potassium voltage-gated channel protein Shaw OS=Drosophila melanogaster GN=Shaw PE=2 SV=1 Back     alignment and function desciption
 Score =  174 bits (442), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 86/94 (91%)

Query: 1   MHANPENDFNSIPLGLWWALVTMTTVGYGDMVPKTYVGMFVGALCALAGVLTIALPVPVI 60
           +  NP NDFNSIPLGLWWALVTMTTVGYGDM PKTY+GMFVGALCALAGVLTIALPVPVI
Sbjct: 353 IQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVI 412

Query: 61  VSNFSRFYSHAQARSKLPKKRRRVLPVEQPRPKR 94
           VSNF+ +YSH QAR+KLPKKRRRVLPVEQPR  R
Sbjct: 413 VSNFAMYYSHTQARAKLPKKRRRVLPVEQPRQPR 446
Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.
Drosophila melanogaster (taxid: 7227)
>sp|G5EFC3|KCNAG_CAEEL Potassium voltage-gated channel protein egl-36 OS=Caenorhabditis elegans GN=egl-36 PE=1 SV=1 Back     alignment and function description
>sp|Q14B80|KCNC2_MOUSE Potassium voltage-gated channel subfamily C member 2 OS=Mus musculus GN=Kcnc2 PE=1 SV=1 Back     alignment and function description
>sp|P22462|KCNC2_RAT Potassium voltage-gated channel subfamily C member 2 OS=Rattus norvegicus GN=Kcnc2 PE=1 SV=1 Back     alignment and function description
>sp|Q96PR1|KCNC2_HUMAN Potassium voltage-gated channel subfamily C member 2 OS=Homo sapiens GN=KCNC2 PE=1 SV=1 Back     alignment and function description
>sp|Q63734|KCNC4_RAT Potassium voltage-gated channel subfamily C member 4 OS=Rattus norvegicus GN=Kcnc4 PE=1 SV=1 Back     alignment and function description
>sp|Q8R1C0|KCNC4_MOUSE Potassium voltage-gated channel subfamily C member 4 OS=Mus musculus GN=Kcnc4 PE=2 SV=1 Back     alignment and function description
>sp|Q03721|KCNC4_HUMAN Potassium voltage-gated channel subfamily C member 4 OS=Homo sapiens GN=KCNC4 PE=1 SV=2 Back     alignment and function description
>sp|Q16322|KCA10_HUMAN Potassium voltage-gated channel subfamily A member 10 OS=Homo sapiens GN=KCNA10 PE=1 SV=2 Back     alignment and function description
>sp|P25122|KCNC1_RAT Potassium voltage-gated channel subfamily C member 1 OS=Rattus norvegicus GN=Kcnc1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query123
158296930 558 AGAP008202-PA [Anopheles gambiae str. PE 0.959 0.211 0.758 5e-46
91089261 613 PREDICTED: similar to Potassium voltage- 0.975 0.195 0.748 5e-46
328707216 601 PREDICTED: potassium voltage-gated chann 0.869 0.178 0.775 6e-45
325297082 514 Shaw potassium channel Kv3.1a [Aplysia c 0.902 0.215 0.735 3e-44
195434963 612 GK14646 [Drosophila willistoni] gi|19416 0.764 0.153 0.872 3e-43
1100227 489 Shaw potassium channel [Panulirus interr 0.837 0.210 0.790 4e-43
158296934 454 AGAP008200-PA [Anopheles gambiae str. PE 0.764 0.207 0.872 4e-43
194759548 593 GF15250 [Drosophila ananassae] gi|190615 0.764 0.158 0.872 5e-43
321461703 479 hypothetical protein DAPPUDRAFT_110446 [ 0.813 0.208 0.81 6e-43
328723490 471 PREDICTED: potassium voltage-gated chann 0.764 0.199 0.882 8e-43
>gi|158296930|ref|XP_317265.4| AGAP008202-PA [Anopheles gambiae str. PEST] gi|157014949|gb|EAA43883.4| AGAP008202-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
 Score =  187 bits (476), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 91/120 (75%), Positives = 99/120 (82%), Gaps = 2/120 (1%)

Query: 1   MHANPENDFNSIPLGLWWALVTMTTVGYGDMVPKTYVGMFVGALCALAGVLTIALPVPVI 60
           +  NP+N F SIPLGLWWA+VTMTTVGYGDM PKTYVGMFVGALCALAGVLTIALPVPVI
Sbjct: 441 LQDNPDNQFKSIPLGLWWAIVTMTTVGYGDMAPKTYVGMFVGALCALAGVLTIALPVPVI 500

Query: 61  VSNFSRFYSHAQARSKLPKKRRRVLPVEQPRPKRGESVNVINRRMTAIKNNPSMFTGAKI 120
           VSNFS FYSH QARSKLPKKRRRVLPVEQPR KR   + V NRR+ A+K+  +  T   I
Sbjct: 501 VSNFSMFYSHTQARSKLPKKRRRVLPVEQPRRKR--DMGVANRRVNALKHQHTQPTHPAI 558

Source: Anopheles gambiae str. PEST

Species: Anopheles gambiae

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|91089261|ref|XP_969930.1| PREDICTED: similar to Potassium voltage-gated channel protein Shaw (Shaw2) [Tribolium castaneum] gi|270012487|gb|EFA08935.1| hypothetical protein TcasGA2_TC006642 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328707216|ref|XP_001951310.2| PREDICTED: potassium voltage-gated channel protein Shaw-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|325297082|ref|NP_001191546.1| Shaw potassium channel Kv3.1a [Aplysia californica] gi|3219511|gb|AAC23503.1| Shaw potassium channel Kv3.1a [Aplysia californica] Back     alignment and taxonomy information
>gi|195434963|ref|XP_002065471.1| GK14646 [Drosophila willistoni] gi|194161556|gb|EDW76457.1| GK14646 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|1100227|gb|AAB39267.1| Shaw potassium channel [Panulirus interruptus] Back     alignment and taxonomy information
>gi|158296934|ref|XP_317268.4| AGAP008200-PA [Anopheles gambiae str. PEST] gi|157014951|gb|EAA12472.5| AGAP008200-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|194759548|ref|XP_001962009.1| GF15250 [Drosophila ananassae] gi|190615706|gb|EDV31230.1| GF15250 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|321461703|gb|EFX72733.1| hypothetical protein DAPPUDRAFT_110446 [Daphnia pulex] Back     alignment and taxonomy information
>gi|328723490|ref|XP_001951251.2| PREDICTED: potassium voltage-gated channel protein Shaw-like [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query123
FB|FBgn0003386498 Shaw "Shaker cognate w" [Droso 0.739 0.182 0.890 4.6e-41
FB|FBgn0085395 941 Shawl "Shaw-like" [Drosophila 0.951 0.124 0.754 1.4e-40
WB|WBGene00001202558 egl-36 [Caenorhabditis elegans 0.739 0.163 0.769 1.3e-33
WB|WBGene00004793479 shw-3 [Caenorhabditis elegans 0.723 0.185 0.696 6e-32
WB|WBGene00008819619 shw-1 [Caenorhabditis elegans 0.796 0.158 0.653 2.6e-31
UNIPROTKB|I3LVR1318 I3LVR1 "Uncharacterized protei 0.731 0.283 0.648 1.2e-28
UNIPROTKB|F1PBM4598 KCNC4 "Uncharacterized protein 0.731 0.150 0.648 5.7e-28
UNIPROTKB|E1B7T7623 KCNC4 "Uncharacterized protein 0.731 0.144 0.648 6.6e-28
UNIPROTKB|H7BZ66624 KCNC4 "Potassium voltage-gated 0.731 0.144 0.648 6.6e-28
RGD|1589169625 Kcnc4 "potassium voltage gated 0.731 0.144 0.648 6.7e-28
FB|FBgn0003386 Shaw "Shaker cognate w" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 436 (158.5 bits), Expect = 4.6e-41, P = 4.6e-41
 Identities = 81/91 (89%), Positives = 85/91 (93%)

Query:     4 NPENDFNSIPLGLWWALVTMTTVGYGDMVPKTYVGMFVGALCALAGVLTIALPVPVIVSN 63
             NP NDFNSIPLGLWWALVTMTTVGYGDM PKTY+GMFVGALCALAGVLTIALPVPVIVSN
Sbjct:   356 NPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSN 415

Query:    64 FSRFYSHAQARSKLPKKRRRVLPVEQPRPKR 94
             F+ +YSH QAR+KLPKKRRRVLPVEQPR  R
Sbjct:   416 FAMYYSHTQARAKLPKKRRRVLPVEQPRQPR 446
GO:0005886 "plasma membrane" evidence=ISS
GO:0016021 "integral to membrane" evidence=NAS
GO:0005249 "voltage-gated potassium channel activity" evidence=NAS;TAS
GO:0006813 "potassium ion transport" evidence=IEA;NAS;TAS
GO:0008076 "voltage-gated potassium channel complex" evidence=IEA;TAS
GO:0051260 "protein homooligomerization" evidence=IEA
GO:0055085 "transmembrane transport" evidence=IEA
GO:0030431 "sleep" evidence=IMP
GO:0005251 "delayed rectifier potassium channel activity" evidence=IBA
FB|FBgn0085395 Shawl "Shaw-like" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00001202 egl-36 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00004793 shw-3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00008819 shw-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|I3LVR1 I3LVR1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PBM4 KCNC4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1B7T7 KCNC4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|H7BZ66 KCNC4 "Potassium voltage-gated channel subfamily C member 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1589169 Kcnc4 "potassium voltage gated channel, Shaw-related subfamily, member 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
G5EFC3KCNAG_CAEELNo assigned EC number0.76920.73980.1630yesN/A
P22462KCNC2_RATNo assigned EC number0.64280.68290.1316yesN/A
Q14B80KCNC2_MOUSENo assigned EC number0.64280.68290.1308yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query123
pfam00520194 pfam00520, Ion_trans, Ion transport protein 3e-09
pfam0788574 pfam07885, Ion_trans_2, Ion channel 4e-09
PRK10537 393 PRK10537, PRK10537, voltage-gated potassium channe 3e-05
>gnl|CDD|215968 pfam00520, Ion_trans, Ion transport protein Back     alignment and domain information 
 Score = 51.9 bits (125), Expect = 3e-09
 Identities = 23/63 (36%), Positives = 32/63 (50%), Gaps = 6/63 (9%)

Query: 4   NPENDFNSIPLGLWWALVTMTTVGYGD-----MVPKTYVGM-FVGALCALAGVLTIALPV 57
           N  ++F+S    L W   T+TT G+GD     +VP T +G  F      L GVL + L +
Sbjct: 132 NGNSNFDSYGEALLWLFRTLTTEGWGDVMYDTLVPGTVLGKIFFVIFIILGGVLLLNLLI 191

Query: 58  PVI 60
            VI
Sbjct: 192 GVI 194

This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices. Length = 194
>gnl|CDD|219619 pfam07885, Ion_trans_2, Ion channel Back     alignment and domain information
>gnl|CDD|236711 PRK10537, PRK10537, voltage-gated potassium channel; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 123
KOG3713|consensus477 99.83
KOG1419|consensus 654 99.78
PF0788579 Ion_trans_2: Ion channel; InterPro: IPR013099 This 99.73
KOG1545|consensus507 99.65
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.55
KOG1418|consensus 433 99.5
KOG4390|consensus 632 99.49
PRK10537 393 voltage-gated potassium channel; Provisional 99.49
KOG4404|consensus350 99.34
KOG0498|consensus 727 99.3
KOG4404|consensus 350 99.2
KOG0501|consensus 971 99.08
KOG3684|consensus489 99.0
KOG1420|consensus 1103 98.95
KOG1418|consensus433 98.7
PF01007 336 IRK: Inward rectifier potassium channel; InterPro: 98.69
KOG3193|consensus 1087 98.25
PF00520200 Ion_trans: Ion transport protein calcium channel s 98.06
KOG0500|consensus 536 97.91
KOG0499|consensus 815 97.35
KOG3827|consensus 400 96.75
PF00060148 Lig_chan: Ligand-gated ion channel; InterPro: IPR0 95.95
KOG1054|consensus 897 93.66
KOG3676|consensus782 91.12
COG1226212 Kch Kef-type K+ transport systems, predicted NAD-b 84.72
KOG1052|consensus 656 84.46
TIGR00933390 2a38 potassium uptake protein, TrkH family. The pr 83.92
PRK05482559 potassium-transporting ATPase subunit A; Provision 83.17
KOG4440|consensus 993 82.65
PF07077180 DUF1345: Protein of unknown function (DUF1345); In 82.33
TIGR00870743 trp transient-receptor-potential calcium channel p 80.64
PF10011 371 DUF2254: Predicted membrane protein (DUF2254); Int 80.03
>KOG3713|consensus Back     alignment and domain information 
Probab=99.83  E-value=6.3e-21  Score=150.20  Aligned_cols=85  Identities=56%  Similarity=1.066  Sum_probs=76.5

Q ss_pred             CCCCCCCCchhhHHHHHhhhhhccccccccccCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhchhhhh
Q psy11889          3 ANPENDFNSIPLGLWWALVTMTTVGYGDMVPKTYVGMFVGALCALAGVLTIALPVPVIVSNFSRFYSHAQARSKLPKKRR   82 (123)
Q Consensus         3 ~~~~~~f~s~~~aly~~~vt~tTVGyGDi~P~t~~gr~~~~~~~l~Gi~~~~~~i~~i~~~~~~~~~~~~~~~~~~~~~~   82 (123)
                      +.++++|+|.+.++||++||||||||||++|.|..||+++.+.++.|+.++|+++.+|.+.|...+++.+.+++..+.++
T Consensus       369 ~~~~~~FtSIPa~~WWaiVTMTTVGYGDm~P~T~~Gklvas~cil~GVLvlAlPItiIv~nF~~~y~~~k~~~~~~~~~~  448 (477)
T KOG3713|consen  369 DEPDTKFTSIPAGFWWAVVTMTTVGYGDMVPVTVLGKLVASLCILCGVLVLALPITIIVNNFSMYYSELKAREKAPKRRE  448 (477)
T ss_pred             cCCCCCCccccchhheeeEEEeeecccCccccccchHHHHHHHHHHhHHHhhcchHhHhhhHHHHHHHHHHHHHhhhhhc
Confidence            34566799999999999999999999999999999999999999999999999999999999999999888877766666


Q ss_pred             ccccc
Q psy11889         83 RVLPV   87 (123)
Q Consensus        83 ~~~~~   87 (123)
                      .....
T Consensus       449 ~~~~~  453 (477)
T KOG3713|consen  449 ALEPA  453 (477)
T ss_pred             ccccc
Confidence            55544

>KOG1419|consensus Back     alignment and domain information
>PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] Back     alignment and domain information
>KOG1545|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG1418|consensus Back     alignment and domain information
>KOG4390|consensus Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>KOG4404|consensus Back     alignment and domain information
>KOG0498|consensus Back     alignment and domain information
>KOG4404|consensus Back     alignment and domain information
>KOG0501|consensus Back     alignment and domain information
>KOG3684|consensus Back     alignment and domain information
>KOG1420|consensus Back     alignment and domain information
>KOG1418|consensus Back     alignment and domain information
>PF01007 IRK: Inward rectifier potassium channel; InterPro: IPR013521 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>KOG3193|consensus Back     alignment and domain information
>PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins Back     alignment and domain information
>KOG0500|consensus Back     alignment and domain information
>KOG0499|consensus Back     alignment and domain information
>KOG3827|consensus Back     alignment and domain information
>PF00060 Lig_chan: Ligand-gated ion channel; InterPro: IPR001320 The ability of synapses to modify their synaptic strength in response to activity is a fundamental property of the nervous system and may be an essential component of learning and memory Back     alignment and domain information
>KOG1054|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>COG1226 Kch Kef-type K+ transport systems, predicted NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1052|consensus Back     alignment and domain information
>TIGR00933 2a38 potassium uptake protein, TrkH family Back     alignment and domain information
>PRK05482 potassium-transporting ATPase subunit A; Provisional Back     alignment and domain information
>KOG4440|consensus Back     alignment and domain information
>PF07077 DUF1345: Protein of unknown function (DUF1345); InterPro: IPR009781 This family consists of several hypothetical bacterial proteins of around 230 residues in length Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PF10011 DUF2254: Predicted membrane protein (DUF2254); InterPro: IPR018723 Members of this family of proteins comprises various hypothetical and putative membrane proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query123
3lut_B499 A Structural Model For The Full-Length Shaker Potas 3e-22
2a79_B499 Mammalian Shaker Kv1.2 Potassium Channel- Beta Subu 3e-22
2r9r_B514 Shaker Family Voltage Dependent Potassium Channel ( 5e-22
3lnm_B514 F233w Mutant Of The Kv2.1 Paddle-Kv1.2 Chimera Chan 5e-22
4h33_A137 Crystal Structure Of A Voltage-gated K+ Channel Por 2e-08
2a0l_A241 Crystal Structure Of Kvap-33h1 Fv Complex Length = 1e-07
1orq_C223 X-Ray Structure Of A Voltage-Dependent Potassium Ch 1e-07
3beh_A355 Structure Of A Bacterial Cyclic Nucleotide Regulate 2e-07
2k1e_A103 Nmr Studies Of A Channel Protein Without Membranes: 1e-06
3eff_K139 The Crystal Structure Of Full-Length Kcsa In Its Cl 4e-06
3pjs_K166 Mechanism Of Activation Gating In The Full-Length K 7e-06
1f6g_A160 Potassium Channel (Kcsa) Full-Length Fold Length = 7e-06
3ogc_C131 Kcsa E71a Variant In Presence Of Na+ Length = 131 9e-06
3or7_C103 On The Structural Basis Of Modal Gating Behavior In 1e-05
3stl_C103 Kcsa Potassium Channel Mutant Y82c With Cadmium Bou 2e-05
3stz_C102 Kcsa Potassium Channel Mutant Y82c With Nitroxide S 2e-05
2atk_C124 Structure Of A Mutant Kcsa K+ Channel Length = 124 2e-05
3ifx_A129 Crystal Structure Of The Spin-Labeled Kcsa Mutant V 2e-05
2a9h_A155 Nmr Structural Studies Of A Potassium Channel Chary 2e-05
1zwi_C103 Structure Of Mutant Kcsa Potassium Channel Length = 2e-05
1k4d_C124 Potassium Channel Kcsa-Fab Complex In Low Concentra 3e-05
2jk5_C124 Potassium Channel Kcsa In Complex With Tetrabutylam 3e-05
2p7t_C103 Crystal Structure Of Kcsa Mutant Length = 103 3e-05
1jvm_A125 Kcsa Potassium Channel With Tba (Tetrabutylammonium 3e-05
1j95_A125 Kcsa Potassium Channel With Tba (Tetrabutylammonium 3e-05
3or6_C103 On The Structural Basis Of Modal Gating Behavior In 4e-05
2hjf_C103 Potassium Channel Kcsa-Fab Complex With Tetrabutyla 4e-05
3hpl_C124 Kcsa E71h-F103a Mutant In The Closed State Length = 5e-05
1s5h_C124 Potassium Channel Kcsa-Fab Complex T75c Mutant In K 7e-05
1bl8_A97 Potassium Channel (Kcsa) From Streptomyces Lividans 8e-05
2ih1_C122 Ion Selectivity In A Semi-Synthetic K+ Channel Lock 9e-05
3f5w_C104 Kcsa Potassium Channel In The Open-Inactivated Stat 1e-04
3rbz_A 340 Mthk Channel, Ca2+-Bound Length = 340 2e-04
1lnq_A 336 Crystal Structure Of Mthk At 3.3 A Length = 336 3e-04
>pdb|3LUT|B Chain B, A Structural Model For The Full-Length Shaker Potassium Channel Kv1.2 Length = 499 Back     alignment and structure 
Iteration: 1

 Score =  100 bits (248), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 45/63 (71%), Positives = 52/63 (82%)
Query: 6   ENDFNSIPLGLWWALVTMTTVGYGDMVPKTYVGMFVGALCALAGVLTIALPVPVIVSNFS 65
           ++ F SIP   WWA+V+MTTVGYGDMVP T  G  VG+LCA+AGVLTIALPVPVIVSNF+
Sbjct: 355 DSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFN 414
Query: 66  RFY 68
            FY
Sbjct: 415 YFY 417
>pdb|2A79|B Chain B, Mammalian Shaker Kv1.2 Potassium Channel- Beta Subunit Complex Length = 499 Back     alignment and structure
>pdb|2R9R|B Chain B, Shaker Family Voltage Dependent Potassium Channel (Kv1.2-Kv2.1 Paddle Chimera Channel) In Association With Beta Subunit Length = 514 Back     alignment and structure
>pdb|3LNM|B Chain B, F233w Mutant Of The Kv2.1 Paddle-Kv1.2 Chimera Channel Length = 514 Back     alignment and structure
>pdb|4H33|A Chain A, Crystal Structure Of A Voltage-gated K+ Channel Pore Module In A Closed State In Lipid Membranes, Tetragonal Crystal Form Length = 137 Back     alignment and structure
>pdb|2A0L|A Chain A, Crystal Structure Of Kvap-33h1 Fv Complex Length = 241 Back     alignment and structure
>pdb|1ORQ|C Chain C, X-Ray Structure Of A Voltage-Dependent Potassium Channel In Complex With An Fab Length = 223 Back     alignment and structure
>pdb|3BEH|A Chain A, Structure Of A Bacterial Cyclic Nucleotide Regulated Ion Channel Length = 355 Back     alignment and structure
>pdb|2K1E|A Chain A, Nmr Studies Of A Channel Protein Without Membranes: Structure And Dynamics Of Water-Solubilized Kcsa Length = 103 Back     alignment and structure
>pdb|3EFF|K Chain K, The Crystal Structure Of Full-Length Kcsa In Its Closed Conformation Length = 139 Back     alignment and structure
>pdb|3PJS|K Chain K, Mechanism Of Activation Gating In The Full-Length Kcsa K+ Channel Length = 166 Back     alignment and structure
>pdb|1F6G|A Chain A, Potassium Channel (Kcsa) Full-Length Fold Length = 160 Back     alignment and structure
>pdb|3OGC|C Chain C, Kcsa E71a Variant In Presence Of Na+ Length = 131 Back     alignment and structure
>pdb|3OR7|C Chain C, On The Structural Basis Of Modal Gating Behavior In K+channels - E71i Length = 103 Back     alignment and structure
>pdb|3STL|C Chain C, Kcsa Potassium Channel Mutant Y82c With Cadmium Bound Length = 103 Back     alignment and structure
>pdb|3STZ|C Chain C, Kcsa Potassium Channel Mutant Y82c With Nitroxide Spin Label Length = 102 Back     alignment and structure
>pdb|2ATK|C Chain C, Structure Of A Mutant Kcsa K+ Channel Length = 124 Back     alignment and structure
>pdb|3IFX|A Chain A, Crystal Structure Of The Spin-Labeled Kcsa Mutant V48r1 Length = 129 Back     alignment and structure
>pdb|2A9H|A Chain A, Nmr Structural Studies Of A Potassium Channel Charybdotoxin Complex Length = 155 Back     alignment and structure
>pdb|1ZWI|C Chain C, Structure Of Mutant Kcsa Potassium Channel Length = 103 Back     alignment and structure
>pdb|1K4D|C Chain C, Potassium Channel Kcsa-Fab Complex In Low Concentration Of K+ Length = 124 Back     alignment and structure
>pdb|2JK5|C Chain C, Potassium Channel Kcsa In Complex With Tetrabutylammonium In High K Length = 124 Back     alignment and structure
>pdb|2P7T|C Chain C, Crystal Structure Of Kcsa Mutant Length = 103 Back     alignment and structure
>pdb|1JVM|A Chain A, Kcsa Potassium Channel With Tba (Tetrabutylammonium) And Rubidium Length = 125 Back     alignment and structure
>pdb|1J95|A Chain A, Kcsa Potassium Channel With Tba (Tetrabutylammonium) And Potassium Length = 125 Back     alignment and structure
>pdb|3OR6|C Chain C, On The Structural Basis Of Modal Gating Behavior In K+channels - E71q Length = 103 Back     alignment and structure
>pdb|2HJF|C Chain C, Potassium Channel Kcsa-Fab Complex With Tetrabutylammonium (Tba) Length = 103 Back     alignment and structure
>pdb|3HPL|C Chain C, Kcsa E71h-F103a Mutant In The Closed State Length = 124 Back     alignment and structure
>pdb|1S5H|C Chain C, Potassium Channel Kcsa-Fab Complex T75c Mutant In K+ Length = 124 Back     alignment and structure
>pdb|1BL8|A Chain A, Potassium Channel (Kcsa) From Streptomyces Lividans Length = 97 Back     alignment and structure
>pdb|2IH1|C Chain C, Ion Selectivity In A Semi-Synthetic K+ Channel Locked In The Conductive Conformation Length = 122 Back     alignment and structure
>pdb|3F5W|C Chain C, Kcsa Potassium Channel In The Open-Inactivated State With 32 A Opening At T112 Length = 104 Back     alignment and structure
>pdb|3RBZ|A Chain A, Mthk Channel, Ca2+-Bound Length = 340 Back     alignment and structure
>pdb|1LNQ|A Chain A, Crystal Structure Of Mthk At 3.3 A Length = 336 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query123
2r9r_B514 Paddle chimera voltage gated potassium channel KV; 1e-41
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 4e-37
3eff_K139 Voltage-gated potassium channel; FULL length KCSA, 2e-36
3pjs_K166 KCSA, voltage-gated potassium channel; ION channel 5e-36
1orq_C223 Potassium channel; voltage-dependent, KVAP, FAB co 5e-35
2a9h_A155 Voltage-gated potassium channel; potassium channel 1e-34
2ih3_C122 Voltage-gated potassium channel; ION channel D-ami 1e-33
2k1e_A103 Water soluble analogue of potassium channel, KCSA; 8e-33
1p7b_A 333 Integral membrane channel and cytosolic domains; t 4e-18
1xl4_A 301 Inward rectifier potassium channel; integral membr 4e-17
2qks_A 321 KIR3.1-prokaryotic KIR channel chimera; G-protein 4e-16
3ldc_A82 Calcium-gated potassium channel MTHK; transmembran 3e-15
1lnq_A 336 MTHK channels, potassium channel related protein; 8e-13
3vou_A148 ION transport 2 domain protein, voltage-gated SOD 6e-12
3ouf_A97 Potassium channel protein; ION channel, membrane, 3e-11
2q67_A114 Potassium channel protein; inverted teepee, helix 3e-11
3sya_A 340 G protein-activated inward rectifier potassium CH; 4e-06
3spc_A 343 Inward-rectifier K+ channel KIR2.2; PIP, membrane 2e-05
3ukm_A280 Potassium channel subfamily K member 1; membrane p 1e-04
>2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Length = 514 Back     alignment and structure
 Score =  142 bits (360), Expect = 1e-41
 Identities = 49/113 (43%), Positives = 63/113 (55%), Gaps = 5/113 (4%)

Query: 2   HANPENDFNSIPLGLWWALVTMTTVGYGDMVPKTYVGMFVGALCALAGVLTIALPVPVIV 61
               ++ F SIP   WWA+V+MTTVGYGDMVP T  G  VG+LCA+AGVLTIALPVPVIV
Sbjct: 366 ADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIV 425

Query: 62  SNFSRFYSHAQARSKLPKKRRRVLPVEQPRPKRGESVNVINRRMTAIKNNPSM 114
           SNF+ FY       +  +  +         PK   S ++   R  +  +    
Sbjct: 426 SNFNYFYHRETEGEEQAQYLQV-----TSSPKIPSSPDLKKSRSASTISKSDY 473
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Length = 355 Back     alignment and structure
>3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} Length = 139 Back     alignment and structure
>3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A Length = 166 Back     alignment and structure
>1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A Length = 223 Back     alignment and structure
>2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 Length = 155 Back     alignment and structure
>2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... Length = 122 Back     alignment and structure
>2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A Length = 103 Back     alignment and structure
>1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* Length = 333 Back     alignment and structure
>1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* Length = 301 Back     alignment and structure
>2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} Length = 321 Back     alignment and structure
>3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 3r65_A 3ous_A 3ldd_A Length = 82 Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Length = 336 Back     alignment and structure
>3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Length = 148 Back     alignment and structure
>3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Length = 97 Back     alignment and structure
>2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Length = 114 Back     alignment and structure
>3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* Length = 340 Back     alignment and structure
>3spc_A Inward-rectifier K+ channel KIR2.2; PIP, membrane protein, lipid, receptor, metal transport; HET: P8P; 2.45A {Gallus gallus} PDB: 3jyc_A* 3spi_A* 3sph_A* 3spj_A 3spg_A* Length = 343 Back     alignment and structure
>3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Length = 280 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query123
4h33_A137 LMO2059 protein; bilayers, KVLM, lipidic cubic pha 99.85
2ih3_C122 Voltage-gated potassium channel; ION channel D-ami 99.81
3eff_K139 Voltage-gated potassium channel; FULL length KCSA, 99.81
2a9h_A155 Voltage-gated potassium channel; potassium channel 99.81
2k1e_A103 Water soluble analogue of potassium channel, KCSA; 99.79
3ldc_A82 Calcium-gated potassium channel MTHK; transmembran 99.74
3pjs_K166 KCSA, voltage-gated potassium channel; ION channel 99.74
3ouf_A97 Potassium channel protein; ION channel, membrane, 99.73
2q67_A114 Potassium channel protein; inverted teepee, helix 99.73
3vou_A148 ION transport 2 domain protein, voltage-gated SOD 99.72
1orq_C223 Potassium channel; voltage-dependent, KVAP, FAB co 99.71
3um7_A309 Potassium channel subfamily K member 4; potassium 99.69
3ukm_A280 Potassium channel subfamily K member 1; membrane p 99.64
2qks_A 321 KIR3.1-prokaryotic KIR channel chimera; G-protein 99.62
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 99.62
1xl4_A 301 Inward rectifier potassium channel; integral membr 99.61
1p7b_A 333 Integral membrane channel and cytosolic domains; t 99.6
2r9r_B514 Paddle chimera voltage gated potassium channel KV; 99.59
3um7_A309 Potassium channel subfamily K member 4; potassium 99.55
3ukm_A280 Potassium channel subfamily K member 1; membrane p 99.54
4gx0_A 565 TRKA domain protein; membrane protein, ION channel 99.51
1lnq_A 336 MTHK channels, potassium channel related protein; 99.49
3sya_A 340 G protein-activated inward rectifier potassium CH; 99.42
3spc_A 343 Inward-rectifier K+ channel KIR2.2; PIP, membrane 99.37
3rvy_A285 ION transport protein; tetrameric ION channel, vol 99.26
4dxw_A229 Navrh, ION transport protein; tetrameric, voltage- 97.58
3kg2_A 823 Glutamate receptor 2; ION channel, membrane protei 96.55
>4h33_A LMO2059 protein; bilayers, KVLM, lipidic cubic phase (LCP), pore module, ION membrane protein; HET: OLC; 3.10A {Listeria monocytogenes} PDB: 4h37_A Back     alignment and structure
Probab=99.85  E-value=4e-22  Score=135.12  Aligned_cols=60  Identities=40%  Similarity=0.734  Sum_probs=56.3

Q ss_pred             CCCCchhhHHHHHhhhhhccccccccccCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy11889          7 NDFNSIPLGLWWALVTMTTVGYGDMVPKTYVGMFVGALCALAGVLTIALPVPVIVSNFSR   66 (123)
Q Consensus         7 ~~f~s~~~aly~~~vt~tTVGyGDi~P~t~~gr~~~~~~~l~Gi~~~~~~i~~i~~~~~~   66 (123)
                      +++++|.||+||+++|+|||||||++|.|+.||+++++++++|+++++++++.+.+.+..
T Consensus        39 ~~~~~~~~a~y~~~~T~tTvGyGDi~P~t~~gr~~~~~~~~~g~~~~~~~~~~i~~~~~~   98 (137)
T 4h33_A           39 PEINNYPDALWWAIVTATTVGYGDIVPVTPIGRILASIMMLFGIAFIGMITSTITNFFRC   98 (137)
T ss_dssp             SSCCSHHHHHHHHHHHHTTCCCSSSCCCSHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTT
T ss_pred             cCCCCHHHHHHHHHHHHHcccCCCCCCCCHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            568999999999999999999999999999999999999999999999999998877654
>2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... Back     alignment and structure
>3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} Back     alignment and structure
>2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 Back     alignment and structure
>2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A Back     alignment and structure
>3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 4hyo_A 4hz3_D 3r65_A 3ous_A 3ldd_A Back     alignment and structure
>3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A Back     alignment and structure
>3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Back     alignment and structure
>2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Back     alignment and structure
>3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Back     alignment and structure
>1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A Back     alignment and structure
>3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Back     alignment and structure
>3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Back     alignment and structure
>2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* Back     alignment and structure
>1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* Back     alignment and structure
>2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Back     alignment and structure
>3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Back     alignment and structure
>3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* Back     alignment and structure
>3spc_A Inward-rectifier K+ channel KIR2.2; PIP, membrane protein, lipid, receptor, metal transport; HET: P8P; 2.45A {Gallus gallus} PDB: 3jyc_A* 3spi_A* 3sph_A* 3spj_A 3spg_A* Back     alignment and structure
>3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 4ekw_A* 3rw0_A* Back     alignment and structure
>4dxw_A Navrh, ION transport protein; tetrameric, voltage-gated sodium channel, sodium selective, gated ION channel; HET: BNG PX4; 3.05A {Alpha proteobacterium HIMB114} Back     alignment and structure
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 123
d1r3jc_103 f.14.1.1 (C:) Potassium channel protein {Streptomy 5e-17
d1xl4a2116 f.14.1.1 (A:23-138) Inward rectifier potassium cha 5e-16
d1p7ba2116 f.14.1.1 (A:36-151) Inward rectifier potassium cha 1e-15
d1lnqa280 f.14.1.1 (A:19-98) Potassium channel-related prote 3e-13
d2h8pc157 f.14.1.1 (C:22-78) Potassium channel protein {Stre 1e-08
>d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Length = 103 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Voltage-gated potassium channels
superfamily: Voltage-gated potassium channels
family: Voltage-gated potassium channels
domain: Potassium channel protein
species: Streptomyces coelicolor [TaxId: 1902]

 Score = 68.8 bits (168), Expect = 5e-17
 Identities = 21/71 (29%), Positives = 32/71 (45%)

Query: 2   HANPENDFNSIPLGLWWALVTMTTVGYGDMVPKTYVGMFVGALCALAGVLTIALPVPVIV 61
              P     + P  LWW++ T TTVGYGD+ P T  G  V  +  +AG+ +  L    + 
Sbjct: 31  RGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALA 90

Query: 62  SNFSRFYSHAQ 72
           + F       +
Sbjct: 91  TWFVGREQERR 101
>d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Length = 116 Back     information, alignment and structure
>d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Length = 116 Back     information, alignment and structure
>d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 80 Back     information, alignment and structure
>d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Length = 57 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query123
d1r3jc_103 Potassium channel protein {Streptomyces coelicolor 99.86
d1xl4a2116 Inward rectifier potassium channel kirbac3.1 {Magn 99.75
d1p7ba2116 Inward rectifier potassium channel Kirbac1.1 {Burk 99.74
d1lnqa280 Potassium channel-related protein MthK {Archaeon M 99.66
d2h8pc157 Potassium channel protein {Streptomyces coelicolor 98.87
d2p7tc134 Potassium channel protein {Streptomyces lividans [ 87.41
>d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Voltage-gated potassium channels
superfamily: Voltage-gated potassium channels
family: Voltage-gated potassium channels
domain: Potassium channel protein
species: Streptomyces coelicolor [TaxId: 1902]

Probab=99.86  E-value=3.7e-22  Score=127.72  Aligned_cols=65  Identities=32%  Similarity=0.617  Sum_probs=59.9

Q ss_pred             CCCCCCCCchhhHHHHHhhhhhccccccccccCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy11889          3 ANPENDFNSIPLGLWWALVTMTTVGYGDMVPKTYVGMFVGALCALAGVLTIALPVPVIVSNFSRF   67 (123)
Q Consensus         3 ~~~~~~f~s~~~aly~~~vt~tTVGyGDi~P~t~~gr~~~~~~~l~Gi~~~~~~i~~i~~~~~~~   67 (123)
                      +.++++|.+|.||+||+++|+|||||||++|.|..||+++++++++|+.+++++++.+.+.+...
T Consensus        32 ~~~~~~~~s~~~aly~~~vT~tTvGYGDi~P~t~~gr~~~~~~~~~Gi~~~~~~~~~i~~~~~~~   96 (103)
T d1r3jc_          32 GAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGR   96 (103)
T ss_dssp             TSTTCCCCSHHHHHHHHHHHHTTCCCSSSCCCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             cCCCcccCchhhhhhhheeeecccccCccccCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34567899999999999999999999999999999999999999999999999999998877654
>d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Back     information, alignment and structure
>d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2p7tc1 f.14.1.1 (C:86-119) Potassium channel protein {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure