Psyllid ID: psy11967


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------54
MDGIEDPALVERIRNTEDFMNVEKDEPNAGEPQSSQFYCCEHTRSTLIRNSKASDLENQENLAPPGGCDCNHKMDGIEDPALVERIRNTEDFMNVEKDELCKVWSEQKIRKEWTVEDVINTNDLSALVFRFAVNLVISGHDDDDIALHFNPRFDVNYCVRNSCRNKVWGEEEKAAYVSNPFKLGENFVLEIFCAPSEFMFAVNGTHFCSFPYRYPLYTITRLQILPRVDIFKIQTKLLHSYPATTQDDLVAQLKDQPLYHHHVLGYEKVDVSGKVPKFFINLQHGKLLWPHPNISFHTSVRFKYKAESNVTSGDVKQENVTVQKVIGDILAPAFCKRYKNVTSGDVKQENVTVQKVIGDILGIQNITSISDSATLSDLGLDSLMAADVKNVLQSKFNISLTNEQIKELKFNAVESLLKVPKSFVMRILLKEDHFSVSIDDEKFINYKYDRGVSINTNDLSALVFRFAVNLVISGHDDDDIALHFNPRFDVNYCVRNSCRNKVWGEEEKAAYVSNPFKLGENFVLEIFCAPSEFMPVPIN
ccccccHHHHHEEccccccccccccccccccccccEEEEEcccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEccccccccEEEEEEEccccccccEEEEEccEEcccEEEEcccccccccccHHccccccccccccEEEEEEEEEccEEEEEEccEEEEEEcccccccccEEEEEcccccEEEEEEEccccccccccccccccccccccccccccccEEEEEccccccEEEEEcccccccccccEEEEEccccccccccEEEccccccccccccccccccccccEEcEEEEEccccccEEEEEEEEEEEEEEEEcccEEEEcccccccccccccEEccEEEEEEEcccEEcccccccccccccccccccccccEEEEEEEccccccccccccccccccccccEEEEEccccccEEEEEEEEEccccccccEEEEEcEEEcccEEEEEccccccccHHHHcccccccccccccEEEEEEEccccEEEEEcc
ccccccHHHHHHHHccHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHEccccccHHEEEEEccccccccccccccccccccccccccEEEEEEEEEEccccccEEEEEEEccccccccEEEEEEEEccccEEEEEEEEccEEcccEEcccccccccccccEEEEEEEcccEEEEEEcccEEEEEEEEccHHcEEEEEEEcEEEEEEEEEcccccccccccccccccccccccccccccccEEEEEEccccEEEEEEEEcccccccccEEEEEcccccccEEEcccccHHHccccccccccccEEEEEEcccEEEEEEcccccEEEEEEEEccccccEEEEEEEEEccEcccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccEEEcccccccEEEcccEEEEEEEEEEEEEEccccccccEEEEEEEEccccEEEEEEEEccEEcccEEcccccccccccccEEEEEEEccccEEEEEEc
MDGIEDPALVERIRNTEDfmnvekdepnagepqssqfyccehtrstlirnskasdlenqenlappggcdcnhkmdgiedpaLVERIRNTEDFMNVEKDELCKVWSeqkirkewtvedvintNDLSALVFRFAVNLVIsghddddialhfnprfdvnycvrnscrnkvwgeeekaayvsnpfklgeNFVLEIfcapsefmfavngthfcsfpyryplytitrlqilprvDIFKIQTKllhsypattqdDLVAqlkdqplyhhhvlgyekvdvsgkvpKFFINlqhgkllwphpnisfhtsvrfkykaesnvtsgdvkqenVTVQKVIGDILAPafckryknvtsgdvkqenVTVQKVIGDILGiqnitsisdsatlsdlgldSLMAADVKNVLQSKFNISLTNEQIKELKFNAVESLLKVPKSFVMRILLkedhfsvsiddekfinykydrgvsintndLSALVFRFAVNLVIsghddddialhfnprfdvnycvrnscrnkvwgeeekaayvsnpfklgeNFVLEifcapsefmpvpin
mdgiedpalverirntedfMNVEKDepnagepqssqFYCCEHTRSTLIRNSKASDLENQENLAPPGGCDCNHKMDGIEDPALVERIRNTEDFMNVEKDELCKVwseqkirkewtvedvINTNDLSALVFRFAVNLVISGHDDDDIALHFnprfdvnycVRNSCRNKVWGEEEKAAYVSNPFKLGENFVLEIFCAPSEFMFAVNGTHFCSFPYRYPLYTITRLQILPRVDIFKIQTKLLHSYPATTQDDLVAQLKDQPLYHHHVLGYEKVDVSGKVPKFFINLQHGKLLWPHPNISFHTSVRFKYKAEsnvtsgdvkqenvTVQKVIGDILAPAFCKRYKnvtsgdvkqenvtVQKVIGDILGIQNITSISDSATLSDLGLDSLMAADVKNVLQSKFNISLTNEQIKELKFNAVESLLKVPKSFVMRILLKedhfsvsiddeKFINYKYDRGVSINTNDLSALVFRFAVNLVISGHDDDDIALHFnprfdvnycVRNSCRNKVWGEEEKAAYVSNPFKLGENFVLEIFCApsefmpvpin
MDGIEDPALVERIRNTEDFMNVEKDEPNAGEPQSSQFYCCEHTRSTLIRNSKASDLENQENLAPPGGCDCNHKMDGIEDPALVERIRNTEDFMNVEKDELCKVWSEQKIRKEWTVEDVINTNDLSALVFRFAVNLVISGHDDDDIALHFNPRFDVNYCVRNSCRNKVWGEEEKAAYVSNPFKLGENFVLEIFCAPSEFMFAVNGTHFCSFPYRYPLYTITRLQILPRVDIFKIQTKLLHSYPATTQDDLVAQLKDQPLYHHHVLGYEKVDVSGKVPKFFINLQHGKLLWPHPNISFHTSVRFKYKAESNVTSGDVKQENVTVQKVIGDILAPAFCKRYKNVTSGDVKQENVTVQKVIGDILGIQNITSISDSATLSDLGLDSLMAADVKNVLQSKFNISLTNEQIKELKFNAVESLLKVPKSFVMRILLKEDHFSVSIDDEKFINYKYDRGVSINTNDLSALVFRFAVNLVISGHDDDDIALHFNPRFDVNYCVRNSCRNKVWGEEEKAAYVSNPFKLGENFVLEIFCAPSEFMPVPIN
************************************FYCCEHT*******************************DGIEDPALVERIRNTEDFMNVEKDELCKVWSEQKIRKEWTVEDVINTNDLSALVFRFAVNLVI********ALHFNPRFDVNYCVRNSCRNKVWGEEEKAAYVSNPFKLGENFVLEIFCAPSEFMFAVNGTHFCSFPYRYPLYTITRLQILPRVDIFKIQTKLLHSYPATTQDDLVAQLKDQPLYHHHVLGYEKVDVSGKVPKFFINLQHGKLLWPHPNISFHTSVRFKYKAESNVTSGDVKQENVTVQKVIGDILAPAFCKRYKNVTSGDVKQENVTVQKVIGDILGIQNITSISDSATLSDLGLDSLMAADVKNVLQSKFNISLTNEQIKELKFNAVESLLKVPKSFVMRILLKEDHFSVSIDDEKFINYKYDRGVSINTNDLSALVFRFAVNLVI********ALHFNPRFDVNYCVRNSCRNKVWGEEEKAAYVSNPFKLGENFVLEIFCAPSEF******
*********VERIRNTEDFMN***************FYCCEHTRSTLIRNS***D*E**ENLAPPGGCDCNHKMD******************NVEKDELCKVWSEQKIRKEWTVEDVINTNDLSALVFRFAVNLVISGHDDDDIALHFNPRFDVNYCVRNSCRNKVWGEEEKAAYVSNPFKLGENFVLEIFCAPSEFMFAVNGTHFCSFPYRYPLYTITRLQILPRVDIFKIQTKLLHSYPATTQDDLVAQLKDQPLYHHHVLGYEKVDVSGKVPKFFINLQHGKLLWPHPNISFHTSVRFKYKAESNVTS*DV****VTVQKVIGDILAPAFCKRYKNVTSGDVKQENVTVQKVIGDILGIQNITSISDSATLSDLGLDSLMAADVKNVLQSKFNISLTNEQIKELKFNAVESLLKVPKSFVMRILLKEDHFSVSIDDEKFINYKYDRGVSINTNDLSALVFRFAVNLVISGHDDDDIALHFNPRFDVNYCVRNSCRNKVWGEEEKAAYVSNPFKLGENFVLEIFCAPSEFMPVPIN
MDGIEDPALVERIRNTEDFMNVEKDEPNAGEPQSSQFYCCEHTRSTLIRNSKASDLENQENLAPPGGCDCNHKMDGIEDPALVERIRNTEDFMNVEKDELCKVWSEQKIRKEWTVEDVINTNDLSALVFRFAVNLVISGHDDDDIALHFNPRFDVNYCVRNSCRNKVWGEEEKAAYVSNPFKLGENFVLEIFCAPSEFMFAVNGTHFCSFPYRYPLYTITRLQILPRVDIFKIQTKLLHSYPATTQDDLVAQLKDQPLYHHHVLGYEKVDVSGKVPKFFINLQHGKLLWPHPNISFHTSVRFKYKAESNVTSGDVKQENVTVQKVIGDILAPAFCKRYKNVTSGDVKQENVTVQKVIGDILGIQNITSISDSATLSDLGLDSLMAADVKNVLQSKFNISLTNEQIKELKFNAVESLLKVPKSFVMRILLKEDHFSVSIDDEKFINYKYDRGVSINTNDLSALVFRFAVNLVISGHDDDDIALHFNPRFDVNYCVRNSCRNKVWGEEEKAAYVSNPFKLGENFVLEIFCAPSEFMPVPIN
**GIEDPALVERIRNTEDFMNVEK*********SSQFYCCEHTRSTLIRNSKASDLENQENLAPPGGCDCNHKMDGIEDPALVERIRNTEDFMNVEKDELCKVWSEQKIRKEWTVEDVINTNDLSALVFRFAVNLVISGHDDDDIALHFNPRFDVNYCVRNSCRNKVWGEEEKAAYVSNPFKLGENFVLEIFCAPSEFMFAVNGTHFCSFPYRYPLYTITRLQILPRVDIFKIQTKLLHSYPATTQDDLVAQLKDQPLYHHHVLGYEKVDVSGKVPKFFINLQHGKLLWPHPNISFHTSVRFKYKAESNVTSGDVKQENVTVQKVIGDILAPAFCKRYKNVTSGDVKQENVTVQKVIGDILGIQNITSISDSATLSDLGLDSLMAADVKNVLQSKFNISLTNEQIKELKFNAVESLLKVPKSFVMRILLKEDHFSVSIDDEKFINYKYDRGVSINTNDLSALVFRFAVNLVISGHDDDDIALHFNPRFDVNYCVRNSCRNKVWGEEEKAAYVSNPFKLGENFVLEIFCAPSEFMPVPIN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDGIEDPALVERIRNTEDFMNVEKDEPNAGEPQSSQFYCCEHTRSTLIRNSKASDLENQENLAPPGGCDCNHKMDGIEDPALVERIRNTEDFMNVEKDELCKVWSEQKIRKEWTVEDVINTNDLSALVFRFAVNLVISGHDDDDIALHFNPRFDVNYCVRNSCRNKVWGEEEKAAYVSNPFKLGENFVLEIFCAPSEFMFAVNGTHFCSFPYRYPLYTITRLQILPRVDIFKIQTKLLHSYPATTQDDLVAQLKDQPLYHHHVLGYEKVDVSGKVPKFFINLQHGKLLWPHPNISFHTSVRFKYKAESNVTSGDVKQENVTVQKVIGDILAPAFCKRYKNVTSGDVKQENVTVQKVIGDILGIQNITSISDSATLSDLGLDSLMAADVKNVLQSKFNISLTNEQIKELKFNAVESLLKVPKSFVMRILLKEDHFSVSIDDEKFINYKYDRGVSINTNDLSALVFRFAVNLVISGHDDDDIALHFNPRFDVNYCVRNSCRNKVWGEEEKAAYVSNPFKLGENFVLEIFCAPSEFMPVPIN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query539 2.2.26 [Sep-21-2011]
Q3T0D6332 Galectin-4 OS=Bos taurus yes N/A 0.231 0.376 0.346 4e-12
P47967145 Galectin-5 OS=Rattus norv yes N/A 0.189 0.703 0.383 5e-12
O08573353 Galectin-9 OS=Mus musculu no N/A 0.189 0.288 0.383 6e-12
Q8K419326 Galectin-4 OS=Mus musculu no N/A 0.172 0.285 0.385 2e-11
O54891301 Galectin-6 OS=Mus musculu no N/A 0.207 0.372 0.352 2e-11
P38552324 Galectin-4 OS=Rattus norv no N/A 0.209 0.348 0.364 3e-11
P36573279 32 kDa beta-galactoside-b no N/A 0.189 0.365 0.383 4e-11
O44126283 32 kDa beta-galactoside-b N/A N/A 0.189 0.360 0.383 1e-10
Q3MHZ8355 Galectin-9 OS=Bos taurus no N/A 0.204 0.309 0.368 1e-10
Q29058323 Galectin-4 OS=Sus scrofa no N/A 0.172 0.287 0.406 2e-10
>sp|Q3T0D6|LEG4_BOVIN Galectin-4 OS=Bos taurus GN=LGALS4 PE=2 SV=1 Back     alignment and function desciption
 Score = 73.2 bits (178), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 61/130 (46%), Gaps = 5/130 (3%)

Query: 130 RFAVNLVISGHDDDDIALHFNPRFDV-NYCVRNSCRNKVWGEEEKAAYVSNPFKLGENFV 188
           RF VN  +      D+A HFNPRFD  +  V NS +N  WG+EE+   +S PF+ G  F 
Sbjct: 45  RFFVNFEVGQGQGADVAFHFNPRFDGWDKVVLNSKQNGSWGQEERK--MSMPFRKGAAFE 102

Query: 189 LEIFCAPSEFMFAVNGTHFCSFPYRYPLYTITRLQILPRVDIFKIQTKLLHSYPATTQDD 248
           L        F   VNGT F  F +R PL  +T L +    D+       +   P + Q  
Sbjct: 103 LVFMVMTEHFKVVVNGTPFHEFKHRIPLQMVTHLHV--DGDLMLQSINFIGGQPPSNQMP 160

Query: 249 LVAQLKDQPL 258
           + AQ    P+
Sbjct: 161 MPAQAYPMPM 170




Galectin that binds lactose and a related range of sugars. May be involved in the assembly of adherens junctions.
Bos taurus (taxid: 9913)
>sp|P47967|LEG5_RAT Galectin-5 OS=Rattus norvegicus GN=Lgals5 PE=1 SV=2 Back     alignment and function description
>sp|O08573|LEG9_MOUSE Galectin-9 OS=Mus musculus GN=Lgals9 PE=1 SV=1 Back     alignment and function description
>sp|Q8K419|LEG4_MOUSE Galectin-4 OS=Mus musculus GN=Lgals4 PE=1 SV=2 Back     alignment and function description
>sp|O54891|LEG6_MOUSE Galectin-6 OS=Mus musculus GN=Lgals6 PE=2 SV=1 Back     alignment and function description
>sp|P38552|LEG4_RAT Galectin-4 OS=Rattus norvegicus GN=Lgals4 PE=1 SV=1 Back     alignment and function description
>sp|P36573|LEC1_CAEEL 32 kDa beta-galactoside-binding lectin OS=Caenorhabditis elegans GN=lec-1 PE=1 SV=1 Back     alignment and function description
>sp|O44126|LEG1_HAECO 32 kDa beta-galactoside-binding lectin OS=Haemonchus contortus GN=GAL-1 PE=2 SV=1 Back     alignment and function description
>sp|Q3MHZ8|LEG9_BOVIN Galectin-9 OS=Bos taurus GN=LGALS9 PE=2 SV=1 Back     alignment and function description
>sp|Q29058|LEG4_PIG Galectin-4 OS=Sus scrofa GN=LGALS4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query539
242016416397 Galectin-4, putative [Pediculus humanus 0.333 0.453 0.338 1e-21
91080515344 PREDICTED: similar to galectin (AGAP0088 0.320 0.502 0.338 2e-20
170060270408 32 kDa beta-galactoside-binding lectin l 0.313 0.414 0.345 4e-19
157136839399 galectin [Aedes aegypti] gi|108880962|gb 0.313 0.423 0.323 4e-19
270006394361 hypothetical protein TcasGA2_TC007619 [T 0.320 0.479 0.315 5e-19
156543495337 PREDICTED: galectin-4-like [Nasonia vitr 0.343 0.548 0.326 3e-18
380012843337 PREDICTED: galectin-8-like [Apis florea] 0.345 0.551 0.325 4e-18
58392724426 AGAP008844-PA [Anopheles gambiae str. PE 0.313 0.396 0.325 1e-17
195160184503 GL16594 [Drosophila persimilis] gi|19411 0.508 0.544 0.225 2e-17
307188900336 Galectin-4 [Camponotus floridanus] 0.315 0.505 0.346 2e-17
>gi|242016416|ref|XP_002428817.1| Galectin-4, putative [Pediculus humanus corporis] gi|212513514|gb|EEB16079.1| Galectin-4, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  111 bits (277), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 68/201 (33%), Positives = 98/201 (48%), Gaps = 21/201 (10%)

Query: 130 RFAVNLVISGHDDDDIALHFNPRFDVNYCVRNSCRNKVWGEEEKAAYVSNPFKLGENFVL 189
           RF++NL      + D+ALHFNPR D    +RN      WG EE  +    PF LG NF +
Sbjct: 122 RFSINLSTDSESNSDLALHFNPRIDRRLVIRNHKIKNKWGVEEILSLQPFPFTLGRNFSV 181

Query: 190 EIFCAPSEFMFAVNGTHFCSFPYRYPLYTITRLQILPRVDIFKIQTKLLHSYPATTQDDL 249
            I  A  +F  AVN  H+C+F +R P+  +  L IL  + +  IQ      YP      +
Sbjct: 182 LILVADEKFFIAVNRIHYCAFAFRIPIEKVKYLIILGDITVTAIQHGNKTFYPPENLKKI 241

Query: 250 VAQLKDQPLYHHHV------------LGYEKVDVSGK---VPK-FFINLQHGKLLWPHPN 293
              +   PL +  V            +G  K+D+ G+   +P+ F++NLQ G  LWPHP 
Sbjct: 242 PKVVIPHPLTNESVKCEIRRKVKAIKIG-TKIDIFGRLKLLPRAFYVNLQKGIYLWPHPI 300

Query: 294 ISFHTSVRF----KYKAESNV 310
           I FH ++R      +K ES +
Sbjct: 301 IPFHMNLRLHPPGTHKTESEI 321




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|91080515|ref|XP_971732.1| PREDICTED: similar to galectin (AGAP008844-PA) [Tribolium castaneum] Back     alignment and taxonomy information
>gi|170060270|ref|XP_001865727.1| 32 kDa beta-galactoside-binding lectin lec-3 [Culex quinquefasciatus] gi|167878791|gb|EDS42174.1| 32 kDa beta-galactoside-binding lectin lec-3 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157136839|ref|XP_001656933.1| galectin [Aedes aegypti] gi|108880962|gb|EAT45187.1| AAEL003541-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|270006394|gb|EFA02842.1| hypothetical protein TcasGA2_TC007619 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|156543495|ref|XP_001601979.1| PREDICTED: galectin-4-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|380012843|ref|XP_003690484.1| PREDICTED: galectin-8-like [Apis florea] Back     alignment and taxonomy information
>gi|58392724|ref|XP_319586.2| AGAP008844-PA [Anopheles gambiae str. PEST] gi|55235134|gb|EAA14815.2| AGAP008844-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195160184|ref|XP_002020956.1| GL16594 [Drosophila persimilis] gi|194117906|gb|EDW39949.1| GL16594 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|307188900|gb|EFN73449.1| Galectin-4 [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query539
ZFIN|ZDB-GENE-030131-9543320 lgals9l1 "lectin, galactoside- 0.183 0.309 0.382 2.1e-21
ZFIN|ZDB-GENE-040718-159320 zgc:92326 "zgc:92326" [Danio r 0.183 0.309 0.382 6.8e-21
UNIPROTKB|F1Q317323 LGALS9 "Uncharacterized protei 0.181 0.303 0.401 1.6e-20
UNIPROTKB|E2R870314 LGALS4 "Galectin-4" [Canis lup 0.213 0.366 0.393 1.9e-20
UNIPROTKB|E2QXK6355 LGALS9 "Uncharacterized protei 0.205 0.312 0.381 1.9e-20
UNIPROTKB|F1RJ33355 LGALS9 "Uncharacterized protei 0.224 0.340 0.36 2.5e-20
MGI|MGI:107535301 Lgals6 "lectin, galactose bind 0.207 0.372 0.352 3e-19
FB|FBgn0031213503 galectin "galectin" [Drosophil 0.220 0.236 0.354 6e-19
UNIPROTKB|Q5E9E0323 LGALS9 "Lectin, galactoside-bi 0.209 0.349 0.376 7.1e-19
UNIPROTKB|Q3T0D6332 LGALS4 "Galectin-4" [Bos tauru 0.231 0.376 0.346 8.2e-19
ZFIN|ZDB-GENE-030131-9543 lgals9l1 "lectin, galactoside-binding, soluble, 9 (galectin 9)-like 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 199 (75.1 bits), Expect = 2.1e-21, Sum P(2) = 2.1e-21
 Identities = 39/102 (38%), Positives = 58/102 (56%)

Query:   130 RFAVNLVISGHDDDDIALHFNPRF-DVNYCVRNSCRNKVWGEEEKAAYVSNPFKLGENFV 188
             RF VNL    H + ++ALHFNPR+ D +Y V NS  N+ WG EE+  Y S PF  G+ F 
Sbjct:    42 RFHVNLQCGSHSEANVALHFNPRYEDTDYVVNNSYLNRTWGSEERK-YES-PFAQGQTFT 99

Query:   189 LEIFCAPSEFMFAVNGTHFCSFPYRYPLYTITRLQILPRVDI 230
             L+I  A  ++  + NG HF  + +R P   +  + +   V++
Sbjct:   100 LQILVAQDKYKISTNGRHFMDYKHRIPFTQVDTVAVEGMVEV 141


GO:0030246 "carbohydrate binding" evidence=IEA
GO:0008150 "biological_process" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0016936 "galactoside binding" evidence=ISS
ZFIN|ZDB-GENE-040718-159 zgc:92326 "zgc:92326" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q317 LGALS9 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2R870 LGALS4 "Galectin-4" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2QXK6 LGALS9 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RJ33 LGALS9 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:107535 Lgals6 "lectin, galactose binding, soluble 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0031213 galectin "galectin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q5E9E0 LGALS9 "Lectin, galactoside-binding, soluble, 9, transcript variant 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0D6 LGALS4 "Galectin-4" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query539
smart00908122 smart00908, Gal-bind_lectin, Galactoside-binding l 6e-32
pfam00337129 pfam00337, Gal-bind_lectin, Galactoside-binding le 7e-30
cd00070127 cd00070, GLECT, Galectin/galactose-binding lectin 1e-29
smart00276128 smart00276, GLECT, Galectin 2e-27
cd00070127 cd00070, GLECT, Galectin/galactose-binding lectin 8e-19
pfam00337129 pfam00337, Gal-bind_lectin, Galactoside-binding le 2e-18
smart00908122 smart00908, Gal-bind_lectin, Galactoside-binding l 3e-18
smart00276128 smart00276, GLECT, Galectin 8e-17
pfam0055066 pfam00550, PP-binding, Phosphopantetheine attachme 5e-07
smart0082386 smart00823, PKS_PP, Phosphopantetheine attachment 1e-05
>gnl|CDD|214904 smart00908, Gal-bind_lectin, Galactoside-binding lectin Back     alignment and domain information
 Score =  118 bits (299), Expect = 6e-32
 Identities = 49/105 (46%), Positives = 63/105 (60%), Gaps = 4/105 (3%)

Query: 130 RFAVNLVISGHDDDDIALHFNPRFDVNYCVRNSCRNKVWGEEEKAAYVSNPFKLGENFVL 189
           RF++NL      + DIALHFNPRFD    VRNS +N  WG+EE++     PF+ G+ F L
Sbjct: 22  RFSINLQ--CGPNADIALHFNPRFDEGTIVRNSKQNGKWGKEERSGG--FPFQPGQPFEL 77

Query: 190 EIFCAPSEFMFAVNGTHFCSFPYRYPLYTITRLQILPRVDIFKIQ 234
           EI     EF  AVNG HF  FP+R PL +I  L+I   V +  +Q
Sbjct: 78  EILVEEDEFKVAVNGQHFLEFPHRLPLESIDTLEISGDVQLTSVQ 122


Animal lectins display a wide variety of architectures. They are classified according to the carbohydrate-recognition domain (CRD) of which there are two main types, S-type and C-type. Galectins (previously S-lectins) bind exclusively beta-galactosides like lactose. They do not require metal ions for activity. Galectins are found predominantly, but not exclusively in mammals. Their function is unclear. They are developmentally regulated and may be involved in differentiation, cellular regulation and tissue construction. Length = 122

>gnl|CDD|215865 pfam00337, Gal-bind_lectin, Galactoside-binding lectin Back     alignment and domain information
>gnl|CDD|238025 cd00070, GLECT, Galectin/galactose-binding lectin Back     alignment and domain information
>gnl|CDD|214596 smart00276, GLECT, Galectin Back     alignment and domain information
>gnl|CDD|238025 cd00070, GLECT, Galectin/galactose-binding lectin Back     alignment and domain information
>gnl|CDD|215865 pfam00337, Gal-bind_lectin, Galactoside-binding lectin Back     alignment and domain information
>gnl|CDD|214904 smart00908, Gal-bind_lectin, Galactoside-binding lectin Back     alignment and domain information
>gnl|CDD|214596 smart00276, GLECT, Galectin Back     alignment and domain information
>gnl|CDD|215989 pfam00550, PP-binding, Phosphopantetheine attachment site Back     alignment and domain information
>gnl|CDD|214834 smart00823, PKS_PP, Phosphopantetheine attachment site Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 539
smart00276128 GLECT Galectin. Galectin - galactose-binding lecti 99.98
PF00337133 Gal-bind_lectin: Galactoside-binding lectin; Inter 99.98
cd00070127 GLECT Galectin/galactose-binding lectin. This doma 99.97
KOG3587|consensus143 99.95
PLN03133636 beta-1,3-galactosyltransferase; Provisional 99.92
smart00276128 GLECT Galectin. Galectin - galactose-binding lecti 99.88
cd00070127 GLECT Galectin/galactose-binding lectin. This doma 99.86
PF00337133 Gal-bind_lectin: Galactoside-binding lectin; Inter 99.86
KOG3587|consensus143 99.79
PLN03133 636 beta-1,3-galactosyltransferase; Provisional 99.69
KOG1202|consensus 2376 99.66
PF0055067 PP-binding: Phosphopantetheine attachment site; In 98.77
PRK0098278 acpP acyl carrier protein; Provisional 98.62
TIGR0051777 acyl_carrier acyl carrier protein. S (Ser) at posi 98.36
PRK0588391 acyl carrier protein; Validated 98.29
CHL0012482 acpP acyl carrier protein; Validated 98.28
PRK0535082 acyl carrier protein; Provisional 98.28
PRK0817282 putative acyl carrier protein IacP; Validated 98.2
PRK1244980 acyl carrier protein; Provisional 98.17
PRK0711779 acyl carrier protein; Validated 98.08
PRK0582884 acyl carrier protein; Validated 97.99
PRK0763986 acyl carrier protein; Provisional 97.97
COG023680 AcpP Acyl carrier protein [Lipid metabolism / Seco 97.96
PRK0708183 acyl carrier protein; Provisional 97.91
PTZ00171148 acyl carrier protein; Provisional 97.85
PRK0918489 acyl carrier protein; Provisional 97.84
PRK06060705 acyl-CoA synthetase; Validated 97.75
smart0082386 PKS_PP Phosphopantetheine attachment site. Phospho 97.74
PRK0650893 acyl carrier protein; Provisional 97.58
PRK0508778 D-alanine--poly(phosphoribitol) ligase subunit 2; 97.41
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 96.57
KOG1748|consensus131 96.42
TIGR0168873 dltC D-alanine--poly(phosphoribitol) ligase, subun 96.35
PRK10252 1296 entF enterobactin synthase subunit F; Provisional 96.05
PRK12467 3956 peptide synthase; Provisional 94.15
PRK05691 4334 peptide synthase; Validated 93.9
PRK123165163 peptide synthase; Provisional 93.27
PRK12316 5163 peptide synthase; Provisional 92.77
PRK12467 3956 peptide synthase; Provisional 92.42
PRK056914334 peptide synthase; Validated 91.93
COG343374 Aryl carrier domain [Secondary metabolites biosynt 86.36
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 84.92
>smart00276 GLECT Galectin Back     alignment and domain information
Probab=99.98  E-value=7.6e-32  Score=244.17  Aligned_cols=125  Identities=38%  Similarity=0.583  Sum_probs=117.4

Q ss_pred             eeecCCeeEEeeEEe-ecccCCCCceEEEEeccCCCCCCCeEEEEeeEeCCCEEEEeceeCCccCcceeecCCCCCCcCC
Q psy11967        106 EQKIRKEWTVEDVIN-TNDLSALVFRFAVNLVISGHDDDDIALHFNPRFDVNYCVRNSCRNKVWGEEEKAAYVSNPFKLG  184 (539)
Q Consensus       106 ~~~I~~~ltvgg~I~-~G~V~~~a~rFsINL~~g~~p~~DIaLHfNpRF~~~~IVrNS~~~G~WG~EEr~~~~~fPF~~G  184 (539)
                      ..+|+.++++|..+. +|.+..+++||+|||+++.   +||+|||||||++++|||||+.+|.||.|||..  .+||++|
T Consensus         2 ~~~lp~~l~~G~~i~i~G~~~~~~~~F~inl~~~~---~di~lH~n~rf~~~~iV~Ns~~~g~Wg~Eer~~--~~Pf~~g   76 (128)
T smart00276        2 TLPIPGGLKPGQTLTVRGIVLPDAKRFSINLLTGG---DDIALHFNPRFNENKIVCNSKLNGSWGSEEREG--GFPFQPG   76 (128)
T ss_pred             cccCCCCCCCCCEEEEEEEECCCCCEEEEEeecCC---CCEEEEEeccCCCCEEEEeCccCCccchheEcC--CCCCCCC
Confidence            455667788888875 8888999999999999986   599999999999999999999999999999997  7999999


Q ss_pred             CeEEEEEEEcCcEEEEEECCEEeEEecCCCCCCCeeEEEEecceEEEEEEE
Q psy11967        185 ENFVLEIFCAPSEFMFAVNGTHFCSFPYRYPLYTITRLQILPRVDIFKIQT  235 (539)
Q Consensus       185 ~~F~I~I~~~~~~F~I~VNG~h~~~F~hRlpl~~I~~L~V~GDV~v~sV~~  235 (539)
                      ++|+|+|++++++|+|+|||+|+++|.||+|+++|++|.|.||+++++|++
T Consensus        77 ~~F~l~i~~~~~~f~i~vng~~~~~f~~R~~~~~i~~l~v~Gdv~l~~v~~  127 (128)
T smart00276       77 QPFDLTIIVQPDHFQIFVNGVHITTFPHRLPLESIDYLSINGDVQLTSVSF  127 (128)
T ss_pred             CEEEEEEEEcCCEEEEEECCEeEEEecCCCCcccEeEEEEeCCEEEEEEEE
Confidence            999999999999999999999999999999999999999999999999987



Galectin - galactose-binding lectin

>PF00337 Gal-bind_lectin: Galactoside-binding lectin; InterPro: IPR001079 Galectins (also known as galaptins or S-lectin) are a family of proteins defined by having at least one characteristic carbohydrate recognition domain (CRD) with an affinity for beta-galactosides and sharing certain sequence elements Back     alignment and domain information
>cd00070 GLECT Galectin/galactose-binding lectin Back     alignment and domain information
>KOG3587|consensus Back     alignment and domain information
>PLN03133 beta-1,3-galactosyltransferase; Provisional Back     alignment and domain information
>smart00276 GLECT Galectin Back     alignment and domain information
>cd00070 GLECT Galectin/galactose-binding lectin Back     alignment and domain information
>PF00337 Gal-bind_lectin: Galactoside-binding lectin; InterPro: IPR001079 Galectins (also known as galaptins or S-lectin) are a family of proteins defined by having at least one characteristic carbohydrate recognition domain (CRD) with an affinity for beta-galactosides and sharing certain sequence elements Back     alignment and domain information
>KOG3587|consensus Back     alignment and domain information
>PLN03133 beta-1,3-galactosyltransferase; Provisional Back     alignment and domain information
>KOG1202|consensus Back     alignment and domain information
>PF00550 PP-binding: Phosphopantetheine attachment site; InterPro: IPR006163 Phosphopantetheine (or pantetheine 4' phosphate) is the prosthetic group of acyl carrier proteins (ACP) in some multienzyme complexes where it serves as a 'swinging arm' for the attachment of activated fatty acid and amino-acid groups [] Back     alignment and domain information
>PRK00982 acpP acyl carrier protein; Provisional Back     alignment and domain information
>TIGR00517 acyl_carrier acyl carrier protein Back     alignment and domain information
>PRK05883 acyl carrier protein; Validated Back     alignment and domain information
>CHL00124 acpP acyl carrier protein; Validated Back     alignment and domain information
>PRK05350 acyl carrier protein; Provisional Back     alignment and domain information
>PRK08172 putative acyl carrier protein IacP; Validated Back     alignment and domain information
>PRK12449 acyl carrier protein; Provisional Back     alignment and domain information
>PRK07117 acyl carrier protein; Validated Back     alignment and domain information
>PRK05828 acyl carrier protein; Validated Back     alignment and domain information
>PRK07639 acyl carrier protein; Provisional Back     alignment and domain information
>COG0236 AcpP Acyl carrier protein [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK07081 acyl carrier protein; Provisional Back     alignment and domain information
>PTZ00171 acyl carrier protein; Provisional Back     alignment and domain information
>PRK09184 acyl carrier protein; Provisional Back     alignment and domain information
>PRK06060 acyl-CoA synthetase; Validated Back     alignment and domain information
>smart00823 PKS_PP Phosphopantetheine attachment site Back     alignment and domain information
>PRK06508 acyl carrier protein; Provisional Back     alignment and domain information
>PRK05087 D-alanine--poly(phosphoribitol) ligase subunit 2; Validated Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>KOG1748|consensus Back     alignment and domain information
>TIGR01688 dltC D-alanine--poly(phosphoribitol) ligase, subunit 2 Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>COG3433 Aryl carrier domain [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query539
3i8t_A164 N-Terminal Crd1 Domain Of Mouse Galectin-4 In Compl 3e-13
3i8t_A164 N-Terminal Crd1 Domain Of Mouse Galectin-4 In Compl 2e-07
2dyc_A158 Crystal Structure Of The N-Terminal Domain Of Mouse 4e-13
2dyc_A158 Crystal Structure Of The N-Terminal Domain Of Mouse 3e-07
2yy1_A160 Crystal Sturcture Of N-Terminal Domain Of Human Gal 7e-12
2yy1_A160 Crystal Sturcture Of N-Terminal Domain Of Human Gal 2e-08
2eak_A148 Crystal Structure Of Human Galectin-9 N-Terminal Cr 9e-12
2eak_A148 Crystal Structure Of Human Galectin-9 N-Terminal Cr 3e-08
1x50_A164 Solution Structure Of The C-Terminal Gal-Bind Lecti 1e-11
1x50_A164 Solution Structure Of The C-Terminal Gal-Bind Lecti 6e-07
3lsd_A143 N-Domain Of Human AdhesionGROWTH-Regulatory Galecti 1e-11
3lsd_A143 N-Domain Of Human AdhesionGROWTH-Regulatory Galecti 3e-08
2yro_A155 Solution Structure Of The C-Terminal Gal-Bind Lecti 5e-11
2yro_A155 Solution Structure Of The C-Terminal Gal-Bind Lecti 3e-06
3nv1_A138 Crystal Structure Of Human Galectin-9 C-Terminal Cr 7e-11
3nv1_A138 Crystal Structure Of Human Galectin-9 C-Terminal Cr 4e-07
4hl0_A278 Crystal Structure Of Full-length Toxascaris Leonina 7e-11
4hl0_A278 Crystal Structure Of Full-length Toxascaris Leonina 1e-07
4hl0_A 278 Crystal Structure Of Full-length Toxascaris Leonina 8e-04
4fqz_A291 Crystal Structure Of A Protease-Resistant Mutant Fo 8e-11
4fqz_A291 Crystal Structure Of A Protease-Resistant Mutant Fo 2e-07
4fqz_A291 Crystal Structure Of A Protease-Resistant Mutant Fo 2e-06
3ojb_A139 Crystal Structure Of C-Terminal Domain Of Human Gal 8e-11
3ojb_A139 Crystal Structure Of C-Terminal Domain Of Human Gal 3e-06
3zxe_A133 Crystal Structure Of Human Galectin-7 In Complex Wi 2e-09
3zxe_A133 Crystal Structure Of Human Galectin-7 In Complex Wi 6e-07
3gal_A135 Crystal Structure Of Human Galectin-7 In Complex Wi 3e-09
3gal_A135 Crystal Structure Of Human Galectin-7 In Complex Wi 6e-07
3zxf_A138 High Resolution Structure Of Human Galectin-7 Lengt 3e-09
3zxf_A138 High Resolution Structure Of Human Galectin-7 Lengt 6e-07
2d6k_A159 Crystal Structure Of Mouse Galectin-9 N-Terminal Cr 1e-08
2d6k_A159 Crystal Structure Of Mouse Galectin-9 N-Terminal Cr 3e-05
2d6o_X159 Crystal Structure Of Mouse Galectin-9 N-Terminal Cr 1e-08
2d6o_X159 Crystal Structure Of Mouse Galectin-9 N-Terminal Cr 3e-05
2vz8_A 2512 Crystal Structure Of Mammalian Fatty Acid Synthase 3e-07
3aya_A135 Crystal Structure Of Galectin-3 Crd Domian Complexe 3e-07
3zsk_A138 Crystal Structure Of Human Galectin-3 Crd With Glyc 3e-07
3zsk_A138 Crystal Structure Of Human Galectin-3 Crd With Glyc 9e-04
2xg3_A138 Human Galectin-3 In Complex With A Benzamido-N- Ace 3e-07
1a3k_A137 X-Ray Crystal Structure Of The Human Galectin-3 Car 4e-07
2nmn_A138 Crystal Structure Of Human Galectin-3 Carbohydrate- 4e-07
3t1l_A143 Crystal Structure Of Human Galectin-3 In Complex Wi 4e-07
3ap4_A154 Crystal Structure Of The Galectin-8 N-Terminal Carb 5e-07
3vkn_A153 Galectin-8 N-Terminal Domain In Free Form Length = 5e-07
1kjl_A146 High Resolution X-Ray Structure Of Human Galectin-3 5e-07
2yv8_A164 Crystal Structure Of N-Terminal Domain Of Human Gal 7e-07
2cg5_B91 Structure Of Aminoadipate-Semialdehyde Dehydrogenas 9e-06
2png_A89 Type I Rat Fatty Acid Synthase Acyl Carrier Protein 1e-05
1qmj_A132 Cg-16, A Homodimeric Agglutinin From Chicken Liver 1e-05
1qmj_A132 Cg-16, A Homodimeric Agglutinin From Chicken Liver 3e-04
3dui_A135 Crystal Structure Of The Oxidized Cg-1b: An Adhesio 1e-05
2wsu_A343 Galectin Domain Of Porcine Adenovirus Type 4 Nadc-1 4e-05
3ak0_A135 Crystal Structure Of Ancestral Congerin Con-Anc'-N2 2e-04
3ajz_A135 Crystal Structure Of Ancestral Congerin Con-Anc Len 2e-04
3ajy_A135 Crystal Structure Of Ancestral Congerin Con-Anc Len 5e-04
2zkn_A134 X-Ray Structure Of Mutant Galectin-1LACTOSE COMPLEX 5e-04
2zkn_A134 X-Ray Structure Of Mutant Galectin-1LACTOSE COMPLEX 6e-04
1slt_A134 Structure Of S-Lectin, A Developmentally Regulated 6e-04
>pdb|3I8T|A Chain A, N-Terminal Crd1 Domain Of Mouse Galectin-4 In Complex With Lactose Length = 164 Back     alignment and structure

Iteration: 1

Score = 73.6 bits (179), Expect = 3e-13, Method: Composition-based stats. Identities = 37/96 (38%), Positives = 53/96 (55%), Gaps = 3/96 (3%) Query: 130 RFAVNLVISGHDDDDIALHFNPRFD-VNYCVRNSCRNKVWGEEEKAAYVSNPFKLGENFV 188 RF VN + D D+A HFNPRFD + V N+ ++ WG+EEK S PF+ G++F Sbjct: 57 RFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKK--SMPFQKGKHFE 114 Query: 189 LEIFCAPSEFMFAVNGTHFCSFPYRYPLYTITRLQI 224 L P + VNG F + +R P+ +T LQ+ Sbjct: 115 LVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQV 150
>pdb|3I8T|A Chain A, N-Terminal Crd1 Domain Of Mouse Galectin-4 In Complex With Lactose Length = 164 Back     alignment and structure
>pdb|2DYC|A Chain A, Crystal Structure Of The N-Terminal Domain Of Mouse Galectin-4 Length = 158 Back     alignment and structure
>pdb|2DYC|A Chain A, Crystal Structure Of The N-Terminal Domain Of Mouse Galectin-4 Length = 158 Back     alignment and structure
>pdb|2YY1|A Chain A, Crystal Sturcture Of N-Terminal Domain Of Human Galectin-9 Containing L-Acetyllactosamine Length = 160 Back     alignment and structure
>pdb|2YY1|A Chain A, Crystal Sturcture Of N-Terminal Domain Of Human Galectin-9 Containing L-Acetyllactosamine Length = 160 Back     alignment and structure
>pdb|2EAK|A Chain A, Crystal Structure Of Human Galectin-9 N-Terminal Crd In Complex With Lactose Length = 148 Back     alignment and structure
>pdb|2EAK|A Chain A, Crystal Structure Of Human Galectin-9 N-Terminal Crd In Complex With Lactose Length = 148 Back     alignment and structure
>pdb|1X50|A Chain A, Solution Structure Of The C-Terminal Gal-Bind Lectin Domain From Human Galectin-4 Length = 164 Back     alignment and structure
>pdb|1X50|A Chain A, Solution Structure Of The C-Terminal Gal-Bind Lectin Domain From Human Galectin-4 Length = 164 Back     alignment and structure
>pdb|3LSD|A Chain A, N-Domain Of Human AdhesionGROWTH-Regulatory Galectin-9 Length = 143 Back     alignment and structure
>pdb|3LSD|A Chain A, N-Domain Of Human AdhesionGROWTH-Regulatory Galectin-9 Length = 143 Back     alignment and structure
>pdb|2YRO|A Chain A, Solution Structure Of The C-Terminal Gal-Bind Lectin Protein From Human Galectin-8 Length = 155 Back     alignment and structure
>pdb|2YRO|A Chain A, Solution Structure Of The C-Terminal Gal-Bind Lectin Protein From Human Galectin-8 Length = 155 Back     alignment and structure
>pdb|3NV1|A Chain A, Crystal Structure Of Human Galectin-9 C-Terminal Crd Length = 138 Back     alignment and structure
>pdb|3NV1|A Chain A, Crystal Structure Of Human Galectin-9 C-Terminal Crd Length = 138 Back     alignment and structure
>pdb|4HL0|A Chain A, Crystal Structure Of Full-length Toxascaris Leonina Galectin Length = 278 Back     alignment and structure
>pdb|4HL0|A Chain A, Crystal Structure Of Full-length Toxascaris Leonina Galectin Length = 278 Back     alignment and structure
>pdb|4HL0|A Chain A, Crystal Structure Of Full-length Toxascaris Leonina Galectin Length = 278 Back     alignment and structure
>pdb|4FQZ|A Chain A, Crystal Structure Of A Protease-Resistant Mutant Form Of Human Galectin-8 Length = 291 Back     alignment and structure
>pdb|4FQZ|A Chain A, Crystal Structure Of A Protease-Resistant Mutant Form Of Human Galectin-8 Length = 291 Back     alignment and structure
>pdb|4FQZ|A Chain A, Crystal Structure Of A Protease-Resistant Mutant Form Of Human Galectin-8 Length = 291 Back     alignment and structure
>pdb|3OJB|A Chain A, Crystal Structure Of C-Terminal Domain Of Human Galectin-8 Length = 139 Back     alignment and structure
>pdb|3OJB|A Chain A, Crystal Structure Of C-Terminal Domain Of Human Galectin-8 Length = 139 Back     alignment and structure
>pdb|3ZXE|A Chain A, Crystal Structure Of Human Galectin-7 In Complex With A Galactose-Benzylphosphate Inhibitor Length = 133 Back     alignment and structure
>pdb|3ZXE|A Chain A, Crystal Structure Of Human Galectin-7 In Complex With A Galactose-Benzylphosphate Inhibitor Length = 133 Back     alignment and structure
>pdb|3GAL|A Chain A, Crystal Structure Of Human Galectin-7 In Complex With Galactosamine Length = 135 Back     alignment and structure
>pdb|3GAL|A Chain A, Crystal Structure Of Human Galectin-7 In Complex With Galactosamine Length = 135 Back     alignment and structure
>pdb|3ZXF|A Chain A, High Resolution Structure Of Human Galectin-7 Length = 138 Back     alignment and structure
>pdb|3ZXF|A Chain A, High Resolution Structure Of Human Galectin-7 Length = 138 Back     alignment and structure
>pdb|2D6K|A Chain A, Crystal Structure Of Mouse Galectin-9 N-Terminal Crd (Crystal Form 1) Length = 159 Back     alignment and structure
>pdb|2D6K|A Chain A, Crystal Structure Of Mouse Galectin-9 N-Terminal Crd (Crystal Form 1) Length = 159 Back     alignment and structure
>pdb|2D6O|X Chain X, Crystal Structure Of Mouse Galectin-9 N-Terminal Crd In Complex With N-Acetyllactosamine Dimer Length = 159 Back     alignment and structure
>pdb|2D6O|X Chain X, Crystal Structure Of Mouse Galectin-9 N-Terminal Crd In Complex With N-Acetyllactosamine Dimer Length = 159 Back     alignment and structure
>pdb|2VZ8|A Chain A, Crystal Structure Of Mammalian Fatty Acid Synthase Length = 2512 Back     alignment and structure
>pdb|3AYA|A Chain A, Crystal Structure Of Galectin-3 Crd Domian Complexed With Thomsen- Friedenreich Antigen Length = 135 Back     alignment and structure
>pdb|3ZSK|A Chain A, Crystal Structure Of Human Galectin-3 Crd With Glycerol Bound At 0.90 Angstrom Resolution Length = 138 Back     alignment and structure
>pdb|3ZSK|A Chain A, Crystal Structure Of Human Galectin-3 Crd With Glycerol Bound At 0.90 Angstrom Resolution Length = 138 Back     alignment and structure
>pdb|2XG3|A Chain A, Human Galectin-3 In Complex With A Benzamido-N- Acetyllactoseamine Inhibitor Length = 138 Back     alignment and structure
>pdb|1A3K|A Chain A, X-Ray Crystal Structure Of The Human Galectin-3 Carbohydrate Recognition Domain (Crd) At 2.1 Angstrom Resolution Length = 137 Back     alignment and structure
>pdb|2NMN|A Chain A, Crystal Structure Of Human Galectin-3 Carbohydrate- Recognising Domain At 2.45 Angstrom Resolution Length = 138 Back     alignment and structure
>pdb|3T1L|A Chain A, Crystal Structure Of Human Galectin-3 In Complex With Methyl 2-O- Acetyl-3-O-Toluoyl-Beta-D-Talopyranoside Length = 143 Back     alignment and structure
>pdb|3AP4|A Chain A, Crystal Structure Of The Galectin-8 N-Terminal Carbohydrate Recognition Domain In Complex With Lactose Length = 154 Back     alignment and structure
>pdb|3VKN|A Chain A, Galectin-8 N-Terminal Domain In Free Form Length = 153 Back     alignment and structure
>pdb|1KJL|A Chain A, High Resolution X-Ray Structure Of Human Galectin-3 In Complex With Lacnac Length = 146 Back     alignment and structure
>pdb|2YV8|A Chain A, Crystal Structure Of N-Terminal Domain Of Human Galectin-8 Length = 164 Back     alignment and structure
>pdb|2CG5|B Chain B, Structure Of Aminoadipate-Semialdehyde Dehydrogenase- Phosphopantetheinyl Transferase In Complex With Cytosolic Acyl Carrier Protein And Coenzyme A Length = 91 Back     alignment and structure
>pdb|2PNG|A Chain A, Type I Rat Fatty Acid Synthase Acyl Carrier Protein (Acp) Domain Length = 89 Back     alignment and structure
>pdb|1QMJ|A Chain A, Cg-16, A Homodimeric Agglutinin From Chicken Liver Length = 132 Back     alignment and structure
>pdb|1QMJ|A Chain A, Cg-16, A Homodimeric Agglutinin From Chicken Liver Length = 132 Back     alignment and structure
>pdb|3DUI|A Chain A, Crystal Structure Of The Oxidized Cg-1b: An AdhesionGROWTH- Regulatory Lectin From Chicken Length = 135 Back     alignment and structure
>pdb|2WSU|A Chain A, Galectin Domain Of Porcine Adenovirus Type 4 Nadc-1 Isolate Fibre Length = 343 Back     alignment and structure
>pdb|3AK0|A Chain A, Crystal Structure Of Ancestral Congerin Con-Anc'-N28k Length = 135 Back     alignment and structure
>pdb|3AJZ|A Chain A, Crystal Structure Of Ancestral Congerin Con-Anc Length = 135 Back     alignment and structure
>pdb|3AJY|A Chain A, Crystal Structure Of Ancestral Congerin Con-Anc Length = 135 Back     alignment and structure
>pdb|2ZKN|A Chain A, X-Ray Structure Of Mutant Galectin-1LACTOSE COMPLEX Length = 134 Back     alignment and structure
>pdb|2ZKN|A Chain A, X-Ray Structure Of Mutant Galectin-1LACTOSE COMPLEX Length = 134 Back     alignment and structure
>pdb|1SLT|A Chain A, Structure Of S-Lectin, A Developmentally Regulated Vertebrate Beta-Galactoside Binding Protein Length = 134 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query539
3zxf_A138 Galectin-7; sugar binding protein; 1.38A {Homo sap 2e-28
3zxf_A138 Galectin-7; sugar binding protein; 1.38A {Homo sap 4e-16
1g86_A142 Charcot-leyden crystal protein; beta barrel, hydro 5e-28
1g86_A142 Charcot-leyden crystal protein; beta barrel, hydro 3e-15
2wsu_A343 Putative fiber protein; viral protein, carbohydrat 2e-27
2wsu_A343 Putative fiber protein; viral protein, carbohydrat 9e-22
2wsu_A343 Putative fiber protein; viral protein, carbohydrat 2e-11
2wsu_A 343 Putative fiber protein; viral protein, carbohydrat 2e-10
1a78_A134 Galectin-1; S-lectin, carbohydrate binding, comple 3e-26
1a78_A134 Galectin-1; S-lectin, carbohydrate binding, comple 2e-14
3naj_A291 Galectin-8; sugar binding protein; HET: GAL BGC; 2 4e-26
3naj_A291 Galectin-8; sugar binding protein; HET: GAL BGC; 2 1e-22
3naj_A291 Galectin-8; sugar binding protein; HET: GAL BGC; 2 2e-11
3naj_A 291 Galectin-8; sugar binding protein; HET: GAL BGC; 2 5e-11
3nv1_A138 Galectin-9, galectin 9 short isoform variant; suga 9e-26
3nv1_A138 Galectin-9, galectin 9 short isoform variant; suga 3e-13
2d6m_A159 Galectin-9, lectin, galactose binding, soluble 9; 2e-25
2d6m_A159 Galectin-9, lectin, galactose binding, soluble 9; 3e-13
2zhn_A148 Galectin-9; beta sandwich, carbohydrate binding pr 2e-25
2zhn_A148 Galectin-9; beta sandwich, carbohydrate binding pr 5e-13
1w6n_A134 Galectin-1; carbohydrate-binding proteins, galacto 3e-25
1w6n_A134 Galectin-1; carbohydrate-binding proteins, galacto 5e-13
3i8t_A164 Galectin-4; S-type lectin, carbohydrate binding, m 4e-25
3i8t_A164 Galectin-4; S-type lectin, carbohydrate binding, m 8e-14
2yro_A155 Galectin-8; GAL-BIND lectin, sugar binding, struct 4e-25
2yro_A155 Galectin-8; GAL-BIND lectin, sugar binding, struct 1e-13
1x50_A164 Galectin-4; GAL-BIND lectin, sugar binding, struct 7e-25
1x50_A164 Galectin-4; GAL-BIND lectin, sugar binding, struct 8e-14
1hlc_A129 Human lectin; HET: GAL BGC; 2.90A {Homo sapiens} S 4e-24
1hlc_A129 Human lectin; HET: GAL BGC; 2.90A {Homo sapiens} S 2e-12
1c1l_A137 Protein (congerin I); galectin, lectin, beta-galac 4e-24
1c1l_A137 Protein (congerin I); galectin, lectin, beta-galac 2e-11
3b9c_A144 HSPC159; beta sandwich, unknown function; 1.90A {H 2e-23
3b9c_A144 HSPC159; beta sandwich, unknown function; 1.90A {H 1e-12
2wkk_A150 Galectin-2; sugar-binding protein, secreted, cell 8e-23
2wkk_A150 Galectin-2; sugar-binding protein, secreted, cell 2e-15
3ap9_A154 Galectin-8; beta-sandwich, carbohydrate/sugar bind 9e-23
3ap9_A154 Galectin-8; beta-sandwich, carbohydrate/sugar bind 3e-12
3zsj_A138 Galectin-3; sugar binding protein; HET: LAT; 0.86A 1e-22
3zsj_A138 Galectin-3; sugar binding protein; HET: LAT; 0.86A 5e-11
1qmj_A132 Beta-galactoside-binding lectin; galectin, sugar b 2e-22
1qmj_A132 Beta-galactoside-binding lectin; galectin, sugar b 8e-13
3dui_A135 Beta-galactoside-binding lectin; carbohydrate-bind 4e-22
3dui_A135 Beta-galactoside-binding lectin; carbohydrate-bind 1e-12
1is3_A135 Congerin II; complex with lactose and MES, sugar b 4e-21
1is3_A135 Congerin II; complex with lactose and MES, sugar b 1e-09
2r0h_A164 CGL3 lectin; galectin-related, sugar binding prote 7e-20
2r0h_A164 CGL3 lectin; galectin-related, sugar binding prote 2e-13
1ww7_A160 Galectin; carbohydrate recognition domain,X-RAY cr 7e-16
1ww7_A160 Galectin; carbohydrate recognition domain,X-RAY cr 2e-11
2cg5_B91 Fatty acid synthase; transferase-hydrolase complex 1e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 2e-06
2jq4_A105 AGR_C_4658P, hypothetical protein ATU2571; ATC2521 5e-06
2kr5_A89 PKS, aflatoxin biosynthesis polyketide synthase; a 2e-05
2l22_A212 Mupirocin didomain acyl carrier protein; biosynthe 3e-05
2l22_A212 Mupirocin didomain acyl carrier protein; biosynthe 6e-05
2lte_A103 Specialized acyl carrier protein; APO protein, tra 2e-04
1nq4_A95 Oxytetracycline polyketide synthase acyl carrier p 8e-04
>3zxf_A Galectin-7; sugar binding protein; 1.38A {Homo sapiens} PDB: 1bkz_A 2gal_A* 3gal_A* 4gal_A* 5gal_A* 3zxe_A* Length = 138 Back     alignment and structure
 Score =  109 bits (273), Expect = 2e-28
 Identities = 33/105 (31%), Positives = 49/105 (46%), Gaps = 2/105 (1%)

Query: 130 RFAVNLVISGHDDDDIALHFNPRFDVNYCVRNSCRNKVWGEEEKAAYVSNPFKLGENFVL 189
           RF VNL+       D ALHFNPR D +  V NS     WG EE+      PF+ G+ F +
Sbjct: 34  RFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPG--VPFQRGQPFEV 91

Query: 190 EIFCAPSEFMFAVNGTHFCSFPYRYPLYTITRLQILPRVDIFKIQ 234
            I  +   F   V    +  F +R PL  +  +++   V +  ++
Sbjct: 92  LIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVR 136


>3zxf_A Galectin-7; sugar binding protein; 1.38A {Homo sapiens} PDB: 1bkz_A 2gal_A* 3gal_A* 4gal_A* 5gal_A* 3zxe_A* Length = 138 Back     alignment and structure
>1g86_A Charcot-leyden crystal protein; beta barrel, hydrolase; 1.80A {Homo sapiens} SCOP: b.29.1.3 PDB: 1lcl_A 1qkq_A* 1hdk_A* Length = 142 Back     alignment and structure
>1g86_A Charcot-leyden crystal protein; beta barrel, hydrolase; 1.80A {Homo sapiens} SCOP: b.29.1.3 PDB: 1lcl_A 1qkq_A* 1hdk_A* Length = 142 Back     alignment and structure
>2wsu_A Putative fiber protein; viral protein, carbohydrate recognition domain, tandem-repea; 1.90A {Porcine adenovirus 4} PDB: 2wsv_A* 2wt0_A* 2wt1_A* 2wt2_A* Length = 343 Back     alignment and structure
>2wsu_A Putative fiber protein; viral protein, carbohydrate recognition domain, tandem-repea; 1.90A {Porcine adenovirus 4} PDB: 2wsv_A* 2wt0_A* 2wt1_A* 2wt2_A* Length = 343 Back     alignment and structure
>2wsu_A Putative fiber protein; viral protein, carbohydrate recognition domain, tandem-repea; 1.90A {Porcine adenovirus 4} PDB: 2wsv_A* 2wt0_A* 2wt1_A* 2wt2_A* Length = 343 Back     alignment and structure
>2wsu_A Putative fiber protein; viral protein, carbohydrate recognition domain, tandem-repea; 1.90A {Porcine adenovirus 4} PDB: 2wsv_A* 2wt0_A* 2wt1_A* 2wt2_A* Length = 343 Back     alignment and structure
>1a78_A Galectin-1; S-lectin, carbohydrate binding, complex (lectin/saccharide); HET: TDG; 2.00A {Bufo arenarum} SCOP: b.29.1.3 PDB: 1gan_A* Length = 134 Back     alignment and structure
>1a78_A Galectin-1; S-lectin, carbohydrate binding, complex (lectin/saccharide); HET: TDG; 2.00A {Bufo arenarum} SCOP: b.29.1.3 PDB: 1gan_A* Length = 134 Back     alignment and structure
>3nv1_A Galectin-9, galectin 9 short isoform variant; sugar binding, sugar binding protein; 1.50A {Homo sapiens} PDB: 3nv2_A* 3nv3_A* 3nv4_A* Length = 138 Back     alignment and structure
>3nv1_A Galectin-9, galectin 9 short isoform variant; sugar binding, sugar binding protein; 1.50A {Homo sapiens} PDB: 3nv2_A* 3nv3_A* 3nv4_A* Length = 138 Back     alignment and structure
>2d6m_A Galectin-9, lectin, galactose binding, soluble 9; beta sandwich, carbohydrate binding protein, sugar binding protein; HET: LBT; 1.60A {Mus musculus} PDB: 2d6l_X 2d6k_A* 2d6n_A* 2d6p_A* 2d6o_X* Length = 159 Back     alignment and structure
>2d6m_A Galectin-9, lectin, galactose binding, soluble 9; beta sandwich, carbohydrate binding protein, sugar binding protein; HET: LBT; 1.60A {Mus musculus} PDB: 2d6l_X 2d6k_A* 2d6n_A* 2d6p_A* 2d6o_X* Length = 159 Back     alignment and structure
>2zhn_A Galectin-9; beta sandwich, carbohydrate binding protein, sugar protein; HET: NAG GAL; 1.30A {Homo sapiens} PDB: 2eak_A* 2eal_A* 2zhk_A* 2zhm_A* 2zhl_A* 2yy1_A* 3lsd_A 3lse_A* Length = 148 Back     alignment and structure
>2zhn_A Galectin-9; beta sandwich, carbohydrate binding protein, sugar protein; HET: NAG GAL; 1.30A {Homo sapiens} PDB: 2eak_A* 2eal_A* 2zhk_A* 2zhm_A* 2zhl_A* 2yy1_A* 3lsd_A 3lse_A* Length = 148 Back     alignment and structure
>1w6n_A Galectin-1; carbohydrate-binding proteins, galactosides; 1.65A {Homo sapiens} SCOP: b.29.1.3 PDB: 1w6m_A 1w6o_A* 1w6p_A* 3t2t_A* 1gzw_A* 2km2_A 3oy8_A* 3oyw_A* 1w6q_A 2zkn_A* 3m2m_A* 1slt_A* 1sla_A* 1slb_A* 1slc_A* Length = 134 Back     alignment and structure
>1w6n_A Galectin-1; carbohydrate-binding proteins, galactosides; 1.65A {Homo sapiens} SCOP: b.29.1.3 PDB: 1w6m_A 1w6o_A* 1w6p_A* 3t2t_A* 1gzw_A* 2km2_A 3oy8_A* 3oyw_A* 1w6q_A 2zkn_A* 3m2m_A* 1slt_A* 1sla_A* 1slb_A* 1slc_A* Length = 134 Back     alignment and structure
>3i8t_A Galectin-4; S-type lectin, carbohydrate binding, molecular recognition, sugar binding protein; HET: LBT; 2.10A {Mus musculus} PDB: 2dyc_A Length = 164 Back     alignment and structure
>3i8t_A Galectin-4; S-type lectin, carbohydrate binding, molecular recognition, sugar binding protein; HET: LBT; 2.10A {Mus musculus} PDB: 2dyc_A Length = 164 Back     alignment and structure
>2yro_A Galectin-8; GAL-BIND lectin, sugar binding, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2yro_A Galectin-8; GAL-BIND lectin, sugar binding, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1x50_A Galectin-4; GAL-BIND lectin, sugar binding, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>1x50_A Galectin-4; GAL-BIND lectin, sugar binding, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>1hlc_A Human lectin; HET: GAL BGC; 2.90A {Homo sapiens} SCOP: b.29.1.3 Length = 129 Back     alignment and structure
>1hlc_A Human lectin; HET: GAL BGC; 2.90A {Homo sapiens} SCOP: b.29.1.3 Length = 129 Back     alignment and structure
>1c1l_A Protein (congerin I); galectin, lectin, beta-galactose-binding, sugar binding PROT; HET: GAL BGC; 1.50A {Conger myriaster} SCOP: b.29.1.3 PDB: 1c1f_A* 3ajy_A* Length = 137 Back     alignment and structure
>1c1l_A Protein (congerin I); galectin, lectin, beta-galactose-binding, sugar binding PROT; HET: GAL BGC; 1.50A {Conger myriaster} SCOP: b.29.1.3 PDB: 1c1f_A* 3ajy_A* Length = 137 Back     alignment and structure
>3b9c_A HSPC159; beta sandwich, unknown function; 1.90A {Homo sapiens} PDB: 2jj6_A Length = 144 Back     alignment and structure
>3b9c_A HSPC159; beta sandwich, unknown function; 1.90A {Homo sapiens} PDB: 2jj6_A Length = 144 Back     alignment and structure
>2wkk_A Galectin-2; sugar-binding protein, secreted, cell WALL, sugar binding, sugar binding protein, beta-galactoside binding lectin, fruiting BODY; HET: GAL NAG FUC; 1.50A {Coprinopsis cinerea} PDB: 1ulc_A* 1ul9_A* 1ule_A* 1ulf_A* 1ulg_A* 1uld_A* Length = 150 Back     alignment and structure
>2wkk_A Galectin-2; sugar-binding protein, secreted, cell WALL, sugar binding, sugar binding protein, beta-galactoside binding lectin, fruiting BODY; HET: GAL NAG FUC; 1.50A {Coprinopsis cinerea} PDB: 1ulc_A* 1ul9_A* 1ule_A* 1ulf_A* 1ulg_A* 1uld_A* Length = 150 Back     alignment and structure
>3ap9_A Galectin-8; beta-sandwich, carbohydrate/sugar binding, lacto-N fucopentaose III, sugar binding protein; HET: GAL FUC NAG BGC; 1.33A {Homo sapiens} PDB: 3ap4_A 3ap5_A* 3ap6_A* 3ap7_A* 3apb_A 2yv8_A 2yxs_A* Length = 154 Back     alignment and structure
>3ap9_A Galectin-8; beta-sandwich, carbohydrate/sugar binding, lacto-N fucopentaose III, sugar binding protein; HET: GAL FUC NAG BGC; 1.33A {Homo sapiens} PDB: 3ap4_A 3ap5_A* 3ap6_A* 3ap7_A* 3apb_A 2yv8_A 2yxs_A* Length = 154 Back     alignment and structure
>3zsj_A Galectin-3; sugar binding protein; HET: LAT; 0.86A {Homo sapiens} PDB: 2nmn_A* 2nn8_A* 2nmo_A* 3t1m_A* 3t1l_A* 1kjl_A* 1kjr_A* 1a3k_A* 2xg3_A* 3zsk_A 3zsl_A 3zsm_A 3ayc_A* 3aya_A* 3ayd_A* 3aye_A* Length = 138 Back     alignment and structure
>3zsj_A Galectin-3; sugar binding protein; HET: LAT; 0.86A {Homo sapiens} PDB: 2nmn_A* 2nn8_A* 2nmo_A* 3t1m_A* 3t1l_A* 1kjl_A* 1kjr_A* 1a3k_A* 2xg3_A* 3zsk_A 3zsl_A 3zsm_A 3ayc_A* 3aya_A* 3ayd_A* 3aye_A* Length = 138 Back     alignment and structure
>1qmj_A Beta-galactoside-binding lectin; galectin, sugar binding protein; 2.15A {Gallus gallus} SCOP: b.29.1.3 Length = 132 Back     alignment and structure
>1qmj_A Beta-galactoside-binding lectin; galectin, sugar binding protein; 2.15A {Gallus gallus} SCOP: b.29.1.3 Length = 132 Back     alignment and structure
>3dui_A Beta-galactoside-binding lectin; carbohydrate-binding proteins, galactosides, galectin, acetylation, sugar binding protein; 2.10A {Gallus gallus} Length = 135 Back     alignment and structure
>3dui_A Beta-galactoside-binding lectin; carbohydrate-binding proteins, galactosides, galectin, acetylation, sugar binding protein; 2.10A {Gallus gallus} Length = 135 Back     alignment and structure
>1is3_A Congerin II; complex with lactose and MES, sugar binding protein; HET: LAT MES; 1.45A {Conger myriaster} SCOP: b.29.1.3 PDB: 1is4_A* 1is5_A 1is6_A* 1wld_A* 1wlw_A* 1wlc_A* 3ak0_A* 3ajz_A* Length = 135 Back     alignment and structure
>1is3_A Congerin II; complex with lactose and MES, sugar binding protein; HET: LAT MES; 1.45A {Conger myriaster} SCOP: b.29.1.3 PDB: 1is4_A* 1is5_A 1is6_A* 1wld_A* 1wlw_A* 1wlc_A* 3ak0_A* 3ajz_A* Length = 135 Back     alignment and structure
>2r0h_A CGL3 lectin; galectin-related, sugar binding protein, chitotriose, chitooligosaccharides; HET: CTO; 1.90A {Coprinus cinereus} PDB: 2r0f_A* Length = 164 Back     alignment and structure
>2r0h_A CGL3 lectin; galectin-related, sugar binding protein, chitotriose, chitooligosaccharides; HET: CTO; 1.90A {Coprinus cinereus} PDB: 2r0f_A* Length = 164 Back     alignment and structure
>1ww7_A Galectin; carbohydrate recognition domain,X-RAY crystallographic analysis, sulfate ION, sugar binding protein; 1.90A {Agrocybe cylindracea} PDB: 1ww4_A* 1ww6_A* 1ww5_A 2zgl_A 2zgm_A* 2zgn_A* 3afk_A* 3m3c_A* 3m3q_A* 2zgk_A 2zgs_A 2zgq_A 2zgr_A 3m3e_A* 2zgo_A* 3m3o_A* 2zgp_A 2zgu_A 2zgt_A Length = 160 Back     alignment and structure
>1ww7_A Galectin; carbohydrate recognition domain,X-RAY crystallographic analysis, sulfate ION, sugar binding protein; 1.90A {Agrocybe cylindracea} PDB: 1ww4_A* 1ww6_A* 1ww5_A 2zgl_A 2zgm_A* 2zgn_A* 3afk_A* 3m3c_A* 3m3q_A* 2zgk_A 2zgs_A 2zgq_A 2zgr_A 3m3e_A* 2zgo_A* 3m3o_A* 2zgp_A 2zgu_A 2zgt_A Length = 160 Back     alignment and structure
>2cg5_B Fatty acid synthase; transferase-hydrolase complex, transferase/hydrolase (comple fatty acid biosynthesis, phosphopantetheine transferase; HET: COA; 2.7A {Homo sapiens} PDB: 2png_A Length = 91 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Length = 2512 Back     alignment and structure
>2jq4_A AGR_C_4658P, hypothetical protein ATU2571; ATC2521, unknown function, ATC, S genomics, PSI-2, protein structure initiative; NMR {Agrobacterium tumefaciens} SCOP: a.28.1.1 Length = 105 Back     alignment and structure
>2kr5_A PKS, aflatoxin biosynthesis polyketide synthase; acyl carrrier protein, holo, phosphopantetheine, transport protein; HET: PNS; NMR {Aspergillus parasiticus} Length = 89 Back     alignment and structure
>2l22_A Mupirocin didomain acyl carrier protein; biosynthetic protein; NMR {Pseudomonas fluorescens} Length = 212 Back     alignment and structure
>2l22_A Mupirocin didomain acyl carrier protein; biosynthetic protein; NMR {Pseudomonas fluorescens} Length = 212 Back     alignment and structure
>2lte_A Specialized acyl carrier protein; APO protein, transferase; NMR {Pseudomonas aeruginosa} Length = 103 Back     alignment and structure
>1nq4_A Oxytetracycline polyketide synthase acyl carrier protein; solution structure, dynamics, ACP, biosynthetic protein; NMR {Streptomyces rimosus} SCOP: a.28.1.1 Length = 95 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query539
3vkl_A291 Galectin-8; beta-sandwich, carbohydrate binding, o 100.0
2wsu_A343 Putative fiber protein; viral protein, carbohydrat 100.0
3zxf_A138 Galectin-7; sugar binding protein; 1.38A {Homo sap 100.0
3i8t_A164 Galectin-4; S-type lectin, carbohydrate binding, m 100.0
2d6m_A159 Galectin-9, lectin, galactose binding, soluble 9; 100.0
2zhn_A148 Galectin-9; beta sandwich, carbohydrate binding pr 100.0
3nv1_A138 Galectin-9, galectin 9 short isoform variant; suga 100.0
3ap9_A154 Galectin-8; beta-sandwich, carbohydrate/sugar bind 100.0
3zsj_A138 Galectin-3; sugar binding protein; HET: LAT; 0.86A 100.0
1g86_A142 Charcot-leyden crystal protein; beta barrel, hydro 100.0
2yro_A155 Galectin-8; GAL-BIND lectin, sugar binding, struct 100.0
1x50_A164 Galectin-4; GAL-BIND lectin, sugar binding, struct 100.0
3b9c_A144 HSPC159; beta sandwich, unknown function; 1.90A {H 100.0
1hlc_A129 Human lectin; HET: GAL BGC; 2.90A {Homo sapiens} S 100.0
3dui_A135 Beta-galactoside-binding lectin; carbohydrate-bind 100.0
1w6n_A134 Galectin-1; carbohydrate-binding proteins, galacto 100.0
1is3_A135 Congerin II; complex with lactose and MES, sugar b 99.98
1c1l_A137 Protein (congerin I); galectin, lectin, beta-galac 99.97
1a78_A134 Galectin-1; S-lectin, carbohydrate binding, comple 99.97
1qmj_A132 Beta-galactoside-binding lectin; galectin, sugar b 99.97
2wsu_A343 Putative fiber protein; viral protein, carbohydrat 99.97
3vkl_A291 Galectin-8; beta-sandwich, carbohydrate binding, o 99.97
2wkk_A150 Galectin-2; sugar-binding protein, secreted, cell 99.96
2r0h_A164 CGL3 lectin; galectin-related, sugar binding prote 99.96
1ww7_A160 Galectin; carbohydrate recognition domain,X-RAY cr 99.95
3zxf_A138 Galectin-7; sugar binding protein; 1.38A {Homo sap 99.94
4agr_A146 Galectin; sugar binding protein; 2.10A {Cinachyrel 99.94
3i8t_A164 Galectin-4; S-type lectin, carbohydrate binding, m 99.93
2zhn_A148 Galectin-9; beta sandwich, carbohydrate binding pr 99.93
3nv1_A138 Galectin-9, galectin 9 short isoform variant; suga 99.93
3zsj_A138 Galectin-3; sugar binding protein; HET: LAT; 0.86A 99.93
3ap9_A154 Galectin-8; beta-sandwich, carbohydrate/sugar bind 99.92
2d6m_A159 Galectin-9, lectin, galactose binding, soluble 9; 99.92
3b9c_A144 HSPC159; beta sandwich, unknown function; 1.90A {H 99.92
1x50_A164 Galectin-4; GAL-BIND lectin, sugar binding, struct 99.91
2r0h_A164 CGL3 lectin; galectin-related, sugar binding prote 99.91
3dui_A135 Beta-galactoside-binding lectin; carbohydrate-bind 99.91
1ww7_A160 Galectin; carbohydrate recognition domain,X-RAY cr 99.91
2yro_A155 Galectin-8; GAL-BIND lectin, sugar binding, struct 99.91
1hlc_A129 Human lectin; HET: GAL BGC; 2.90A {Homo sapiens} S 99.9
1a78_A134 Galectin-1; S-lectin, carbohydrate binding, comple 99.9
1qmj_A132 Beta-galactoside-binding lectin; galectin, sugar b 99.9
1is3_A135 Congerin II; complex with lactose and MES, sugar b 99.9
1g86_A142 Charcot-leyden crystal protein; beta barrel, hydro 99.9
1w6n_A134 Galectin-1; carbohydrate-binding proteins, galacto 99.9
2wkk_A150 Galectin-2; sugar-binding protein, secreted, cell 99.9
1c1l_A137 Protein (congerin I); galectin, lectin, beta-galac 99.89
4agr_A146 Galectin; sugar binding protein; 2.10A {Cinachyrel 99.85
2cg5_B91 Fatty acid synthase; transferase-hydrolase complex 99.52
1f80_D81 Acyl carrier protein; transferase; HET: PN2; 2.30A 98.8
1vku_A100 Acyl carrier protein; TM0175, structural genomics, 98.76
2qnw_A82 Acyl carrier protein; malaria, SGC, structural gen 98.75
1l0i_A78 Acyl carrier protein; acyl chain binding, fatty ac 98.74
3ejb_A97 Acyl carrier protein; protein-protein complex, cyt 98.74
3gzm_A81 Acyl carrier protein; helix bundle, phosphopanteth 98.73
4dxe_H101 ACP, acyl carrier protein; acyl-carrier-protein sy 98.73
1x3o_A80 Acyl carrier protein; structural genomics, riken s 98.73
2ava_A82 ACP I, acyl carrier protein I, chloroplast; four-h 98.72
2ehs_A77 ACP, acyl carrier protein; lipid transport, struct 98.72
2lol_A81 ACP, acyl carrier protein; lipid transport; NMR {R 98.69
1or5_A83 Acyl carrier protein; ACP, biosynthesis, frenolici 98.69
2cnr_A82 FAS, ACP, acyl carrier protein; polykdetide, phosp 98.69
2kwl_A84 ACP, acyl carrier protein; structural genomics, se 98.68
2liu_A99 CURA; holo state, transferase; NMR {Lyngbya majusc 98.66
2ju1_A95 Erythronolide synthase; carrier protein domain, mo 98.66
1af8_A86 Actinorhodin polyketide synthase acyl carrier Pro; 98.65
2dnw_A99 Acyl carrier protein; ACP, fatty acid biosynthesis 98.65
2afd_A88 Protein ASL1650; twisted antiparallel helical bund 98.63
2kr5_A89 PKS, aflatoxin biosynthesis polyketide synthase; a 98.62
2kjs_A87 Putative acyl carrier protein; alpha, ACP, PNS, st 98.62
2l4b_A88 Acyl carrier protein; infectious disease, human gr 98.61
2l3v_A79 ACP, acyl carrier protein; structural genomi seatt 98.58
2kw2_A101 Specialized acyl carrier protein; structural genom 98.57
1klp_A115 ACP, ACPM, meromycolate extension acyl carrier pro 98.55
2lte_A103 Specialized acyl carrier protein; APO protein, tra 97.95
1nq4_A95 Oxytetracycline polyketide synthase acyl carrier p 98.46
2l22_A212 Mupirocin didomain acyl carrier protein; biosynthe 98.46
1dny_A91 Non-ribosomal peptide synthetase peptidyl carrier 98.43
2jq4_A105 AGR_C_4658P, hypothetical protein ATU2571; ATC2521 98.37
2kci_A87 Putative acyl carrier protein; alpha, ACP, PCP, st 98.36
4i4d_A93 Peptide synthetase NRPS type II-PCP; structural ge 98.35
1dv5_A80 APO-DCP, APO-D-alanyl carrier protein; 3-helix bun 98.24
2l22_A212 Mupirocin didomain acyl carrier protein; biosynthe 98.23
3ce7_A107 Specific mitochodrial acyl carrier protein; malari 98.22
1fh1_A92 NODF, nodulation protein F; ROOT nodulation factor 98.21
2amw_A83 Hypothetical protein NE2163; all helical protein, 98.17
2lki_A105 Putative uncharacterized protein; helical bundle, 98.12
2cgq_A113 Acyl carrier protein ACPA; RV0033, protein transpo 98.09
3tej_A 329 Enterobactin synthase component F; nonribosomal pe 97.8
2l9f_A102 CALE8, meacp; transferase, acyl carrier protein; N 97.69
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 97.63
2fq1_A287 Isochorismatase; ENTB, NRPS, multi-domain, ACP, hy 97.17
2jgp_A 520 Tyrocidine synthetase 3; multifunctional enzyme, a 96.92
2cq8_A110 10-formyltetrahydrofolate dehydrogenase; 10-FTHFDH 96.79
2vsq_A 1304 Surfactin synthetase subunit 3; ligase, peptidyl c 95.91
3rg2_A617 Enterobactin synthase component E (ENTE), 2,3-DIH 95.65
4f6l_B 508 AUSA reductase domain protein; thioester reductase 95.51
4dg8_A620 PA1221; ANL superfamily, adenylation domain, pepti 95.34
4b1m_A185 Levanase; hydrolase, CBM66; HET: FRU; 1.10A {Bacil 86.17
>3vkl_A Galectin-8; beta-sandwich, carbohydrate binding, oligosaccharide, sugar protein; HET: GAL BGC; 2.55A {Homo sapiens} PDB: 3naj_A* 3vkm_A* 4fqz_A* 3ojb_A Back     alignment and structure
Probab=100.00  E-value=1.3e-53  Score=434.16  Aligned_cols=237  Identities=30%  Similarity=0.429  Sum_probs=213.9

Q ss_pred             ccceeeeeecCCeeEEeeEEe-ecccCCCCceEEEEeccCCC--CCCCeEEEEeeEeCC-CEEEEeceeCCccCcceeec
Q psy11967        100 LCKVWSEQKIRKEWTVEDVIN-TNDLSALVFRFAVNLVISGH--DDDDIALHFNPRFDV-NYCVRNSCRNKVWGEEEKAA  175 (539)
Q Consensus       100 ~~~vP~~~~I~~~ltvgg~I~-~G~V~~~a~rFsINL~~g~~--p~~DIaLHfNpRF~~-~~IVrNS~~~G~WG~EEr~~  175 (539)
                      .++|||..+|+.+|.+|.++. +|++.++|+||+|||++|.+  +++||||||||||++ ++|||||+.+|+||.|||..
T Consensus        14 nP~vP~~~~i~~gl~~G~~i~I~G~v~~~a~rF~Inl~~g~~~~~~~dialHfnpRf~~~~~IV~Ns~~~g~Wg~EEr~~   93 (291)
T 3vkl_A           14 NPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITY   93 (291)
T ss_dssp             CCCSSEEEECSSCCCTTCEEEEEEECCTTCCBEEEEEESSCCBTTBCCEEEEEEEECSSSCEEEEEEEETTEECCCEEEE
T ss_pred             CCCCCEeeECCCCCccCcEEEEEEEECCCCCEEEEEEEeCCCCCCCCCEEEEEEeEcCCCCEEEEeCccCCEecCCcccC
Confidence            458999999999999999986 99999999999999999876  678999999999985 79999999999999999998


Q ss_pred             CCCCCCcCCCeEEEEEEEcCcEEEEEECCEEeEEecCCCCCCCeeEEEEecceEEEEEEEeeCCCCCCCcccchhhcccC
Q psy11967        176 YVSNPFKLGENFVLEIFCAPSEFMFAVNGTHFCSFPYRYPLYTITRLQILPRVDIFKIQTKLLHSYPATTQDDLVAQLKD  255 (539)
Q Consensus       176 ~~~fPF~~G~~F~I~I~~~~~~F~I~VNG~h~~~F~hRlpl~~I~~L~V~GDV~v~sV~~~~~~~yP~~~~~~~~~~~~~  255 (539)
                        .+||++|++|+|+|++++++|+|+|||+|+++|+||+|+++|++|+|+|||+|++|.+....                
T Consensus        94 --~~Pf~~G~~F~l~I~~~~~~f~V~vng~~~~~F~hR~p~~~i~~l~v~Gdv~l~sv~~~~~~----------------  155 (291)
T 3vkl_A           94 --DTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSS----------------  155 (291)
T ss_dssp             --SCSCCTTCEEEEEEEECSSEEEEEETTEEEEEEECSSCGGGCCEEEEEESCEEEEEEEECSS----------------
T ss_pred             --CCCCCCCCeEEEEEEEcCCeEEEEECCeEEEEeeccCChhHeeEEEEeCCEEEEEEeccccc----------------
Confidence              79999999999999999999999999999999999999999999999999999999885200                


Q ss_pred             CCccccccCcceEEEEEEecccEEEecCCCcCcCCCCcceEEEeeecCcceeeeeccccccccceeeeeecccccccccc
Q psy11967        256 QPLYHHHVLGYEKVDVSGKVPKFFINLQHGKLLWPHPNISFHTSVRFKYKAESNVTSGDVKQENVTVQKVIGDILAPAFC  335 (539)
Q Consensus       256 ~p~~~~~~~~~~~i~i~G~vP~F~inLq~g~~~wp~p~I~fhlnprF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~  335 (539)
                                                         ++.+                                         
T Consensus       156 -----------------------------------~~~~-----------------------------------------  159 (291)
T 3vkl_A          156 -----------------------------------HMRL-----------------------------------------  159 (291)
T ss_dssp             -----------------------------------CBCS-----------------------------------------
T ss_pred             -----------------------------------ccCc-----------------------------------------
Confidence                                               0001                                         


Q ss_pred             ccccccccCCCcCCccchHHHHHhHhCccCCCCCCCCCcccccCCchhhHHHHHHHHHhhcCcccCHHHHhhhchhhhhh
Q psy11967        336 KRYKNVTSGDVKQENVTVQKVIGDILGIQNITSISDSATLSDLGLDSLMAADVKNVLQSKFNISLTNEQIKELKFNAVES  415 (539)
Q Consensus       336 ~~~~~~~~~~~~g~~~~~~~~va~Ilgi~~~~~i~~~~~L~dlGmDSLM~vEi~q~ler~~~i~l~~~ei~~lT~~kL~~  415 (539)
                                                                                                      
T Consensus       160 --------------------------------------------------------------------------------  159 (291)
T 3vkl_A          160 --------------------------------------------------------------------------------  159 (291)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhcCCCceEEEEEeecCeeEEecCceeeeeccCCCCcEEEEeeec-CCCCeeEEEEeecCCCCCCeEEEEeeeeCCCeEE
Q psy11967        416 LLKVPKSFVMRILLKEDHFSVSIDDEKFINYKYDRGVSINTNDLS-ALVFRFAVNLVISGHDDDDIALHFNPRFDVNYCV  494 (539)
Q Consensus       416 ~~~~~~~F~~~i~~~~~~F~v~~~g~k~i~~gl~~G~~I~i~G~~-~~~~rF~INl~~g~~~~~DIAlHfNPRF~~~~VV  494 (539)
                                             ++..-|++||.||++|+|+|.+ ++++||+|||++|  +..||||||||||+++.||
T Consensus       160 -----------------------P~~~~i~~gl~pG~~i~I~G~v~~~~~~F~Inl~~g--~~~dialHfnpRf~~~~iV  214 (291)
T 3vkl_A          160 -----------------------PFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAG--KSKDIALHLNPRLNIKAFV  214 (291)
T ss_dssp             -----------------------SEEEECSSCCCTTCEEEEEEEECTTCCBEEEEEEET--TTTEEEEEEEEETTTTEEE
T ss_pred             -----------------------cccccCCCCCCCCCEEEEEEEECCCCCeEEEEeecC--CCCCEEEEEEeecCCCeEE
Confidence                                   1122356789999999999998 5699999999986  4579999999999999999


Q ss_pred             EecccCCccCceeeecCCCCCCCCCCeEEEEEEEeCCeEEEe
Q psy11967        495 RNSCRNKVWGEEEKAAYVSNPFKLGENFVLEIFCAPSEFMPV  536 (539)
Q Consensus       495 ~NS~~~G~Wg~EER~~~~~fPF~~Gq~F~l~I~~~~~~F~~~  536 (539)
                      |||+.+|.||.|||+.. .|||.+|++|+|+|.|+.++|+|.
T Consensus       215 rNs~~~g~Wg~EEr~~~-~fPF~~g~~F~l~I~~~~~~f~V~  255 (291)
T 3vkl_A          215 RNSFLQESWGEEERNIT-SFPFSPGMYFEMIIYCDVREFKVA  255 (291)
T ss_dssp             EEEECSSSBCCCBCCCS-CCCCCTTCEEEEEEEECSSEEEEE
T ss_pred             EECCcCCEecccEeeCC-CCCCCCCCcEEEEEEECCCEEEEE
Confidence            99999999999999853 699999999999999999999985



>2wsu_A Putative fiber protein; viral protein, carbohydrate recognition domain, tandem-repea; 1.90A {Porcine adenovirus 4} PDB: 2wsv_A* 2wt0_A* 2wt1_A* 2wt2_A* Back     alignment and structure
>3zxf_A Galectin-7; sugar binding protein; 1.38A {Homo sapiens} SCOP: b.29.1.3 PDB: 1bkz_A 2gal_A* 3gal_A* 4gal_A* 5gal_A* 3zxe_A* Back     alignment and structure
>3i8t_A Galectin-4; S-type lectin, carbohydrate binding, molecular recognition, sugar binding protein; HET: LBT; 2.10A {Mus musculus} PDB: 2dyc_A Back     alignment and structure
>2d6m_A Galectin-9, lectin, galactose binding, soluble 9; beta sandwich, carbohydrate binding protein, sugar binding protein; HET: LBT; 1.60A {Mus musculus} PDB: 2d6l_X 2d6k_A* 2d6n_A* 2d6p_A* 2d6o_X* Back     alignment and structure
>2zhn_A Galectin-9; beta sandwich, carbohydrate binding protein, sugar protein; HET: NAG GAL; 1.30A {Homo sapiens} PDB: 2eak_A* 2eal_A* 2zhk_A* 2zhm_A* 2zhl_A* 2yy1_A* 3lsd_A 3lse_A* Back     alignment and structure
>3nv1_A Galectin-9, galectin 9 short isoform variant; sugar binding, sugar binding protein; 1.50A {Homo sapiens} SCOP: b.29.1.0 PDB: 3nv2_A* 3nv3_A* 3nv4_A* Back     alignment and structure
>3ap9_A Galectin-8; beta-sandwich, carbohydrate/sugar binding, lacto-N fucopentaose III, sugar binding protein; HET: GAL FUC NAG BGC; 1.33A {Homo sapiens} PDB: 3ap4_A 3ap5_A* 3ap6_A* 3ap7_A* 3apb_A 2yv8_A 2yxs_A* Back     alignment and structure
>3zsj_A Galectin-3; sugar binding protein; HET: LAT; 0.86A {Homo sapiens} SCOP: b.29.1.3 PDB: 2nmn_A* 2nn8_A* 2nmo_A* 3t1m_A* 3t1l_A* 1kjl_A* 1kjr_A* 1a3k_A* 2xg3_A* 3zsk_A 3zsl_A 3zsm_A 3ayc_A* 3aya_A* 3ayd_A* 3aye_A* Back     alignment and structure
>1g86_A Charcot-leyden crystal protein; beta barrel, hydrolase; 1.80A {Homo sapiens} SCOP: b.29.1.3 PDB: 1lcl_A 1qkq_A* 1hdk_A* Back     alignment and structure
>2yro_A Galectin-8; GAL-BIND lectin, sugar binding, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x50_A Galectin-4; GAL-BIND lectin, sugar binding, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3b9c_A HSPC159; beta sandwich, unknown function; 1.90A {Homo sapiens} PDB: 2jj6_A Back     alignment and structure
>1hlc_A Human lectin; HET: GAL BGC; 2.90A {Homo sapiens} SCOP: b.29.1.3 Back     alignment and structure
>3dui_A Beta-galactoside-binding lectin; carbohydrate-binding proteins, galactosides, galectin, acetylation, sugar binding protein; 2.10A {Gallus gallus} SCOP: b.29.1.3 Back     alignment and structure
>1w6n_A Galectin-1; carbohydrate-binding proteins, galactosides; 1.65A {Homo sapiens} SCOP: b.29.1.3 PDB: 1w6m_A 1w6o_A* 1w6p_A* 3t2t_A* 1gzw_A* 2km2_A 3oy8_A* 3oyw_A* 1w6q_A 2zkn_A* 3m2m_A* 1slt_A* 1sla_A* 1slb_A* 1slc_A* Back     alignment and structure
>1is3_A Congerin II; complex with lactose and MES, sugar binding protein; HET: LAT MES; 1.45A {Conger myriaster} SCOP: b.29.1.3 PDB: 1is4_A* 1is5_A 1is6_A* 1wld_A* 1wlw_A* 1wlc_A* 3ak0_A* 3ajz_A* Back     alignment and structure
>1c1l_A Protein (congerin I); galectin, lectin, beta-galactose-binding, sugar binding PROT; HET: GAL BGC; 1.50A {Conger myriaster} SCOP: b.29.1.3 PDB: 1c1f_A* 3ajy_A* Back     alignment and structure
>1a78_A Galectin-1; S-lectin, carbohydrate binding, complex (lectin/saccharide); HET: TDG; 2.00A {Bufo arenarum} SCOP: b.29.1.3 PDB: 1gan_A* Back     alignment and structure
>1qmj_A Beta-galactoside-binding lectin; galectin, sugar binding protein; 2.15A {Gallus gallus} SCOP: b.29.1.3 Back     alignment and structure
>2wsu_A Putative fiber protein; viral protein, carbohydrate recognition domain, tandem-repea; 1.90A {Porcine adenovirus 4} PDB: 2wsv_A* 2wt0_A* 2wt1_A* 2wt2_A* Back     alignment and structure
>3vkl_A Galectin-8; beta-sandwich, carbohydrate binding, oligosaccharide, sugar protein; HET: GAL BGC; 2.55A {Homo sapiens} PDB: 3naj_A* 3vkm_A* 4fqz_A* 3ojb_A Back     alignment and structure
>2wkk_A Galectin-2; sugar-binding protein, secreted, cell WALL, sugar binding, sugar binding protein, beta-galactoside binding lectin, fruiting BODY; HET: GAL NAG FUC; 1.50A {Coprinopsis cinerea} PDB: 1ulc_A* 1ul9_A* 1ule_A* 1ulf_A* 1ulg_A* 1uld_A* Back     alignment and structure
>2r0h_A CGL3 lectin; galectin-related, sugar binding protein, chitotriose, chitooligosaccharides; HET: CTO; 1.90A {Coprinus cinereus} PDB: 2r0f_A* Back     alignment and structure
>1ww7_A Galectin; carbohydrate recognition domain,X-RAY crystallographic analysis, sulfate ION, sugar binding protein; 1.90A {Agrocybe cylindracea} PDB: 1ww4_A* 1ww6_A* 1ww5_A 2zgl_A 2zgm_A* 2zgn_A* 3afk_A* 3m3c_A* 3m3q_A* 2zgk_A 2zgs_A 2zgq_A 2zgr_A 3m3e_A* 2zgo_A* 3m3o_A* 2zgp_A 2zgu_A 2zgt_A Back     alignment and structure
>3zxf_A Galectin-7; sugar binding protein; 1.38A {Homo sapiens} SCOP: b.29.1.3 PDB: 1bkz_A 2gal_A* 3gal_A* 4gal_A* 5gal_A* 3zxe_A* Back     alignment and structure
>4agr_A Galectin; sugar binding protein; 2.10A {Cinachyrella} PDB: 4agg_A 4agv_A Back     alignment and structure
>3i8t_A Galectin-4; S-type lectin, carbohydrate binding, molecular recognition, sugar binding protein; HET: LBT; 2.10A {Mus musculus} PDB: 2dyc_A Back     alignment and structure
>2zhn_A Galectin-9; beta sandwich, carbohydrate binding protein, sugar protein; HET: NAG GAL; 1.30A {Homo sapiens} PDB: 2eak_A* 2eal_A* 2zhk_A* 2zhm_A* 2zhl_A* 2yy1_A* 3lsd_A 3lse_A* Back     alignment and structure
>3nv1_A Galectin-9, galectin 9 short isoform variant; sugar binding, sugar binding protein; 1.50A {Homo sapiens} SCOP: b.29.1.0 PDB: 3nv2_A* 3nv3_A* 3nv4_A* Back     alignment and structure
>3zsj_A Galectin-3; sugar binding protein; HET: LAT; 0.86A {Homo sapiens} SCOP: b.29.1.3 PDB: 2nmn_A* 2nn8_A* 2nmo_A* 3t1m_A* 3t1l_A* 1kjl_A* 1kjr_A* 1a3k_A* 2xg3_A* 3zsk_A 3zsl_A 3zsm_A 3ayc_A* 3aya_A* 3ayd_A* 3aye_A* Back     alignment and structure
>3ap9_A Galectin-8; beta-sandwich, carbohydrate/sugar binding, lacto-N fucopentaose III, sugar binding protein; HET: GAL FUC NAG BGC; 1.33A {Homo sapiens} PDB: 3ap4_A 3ap5_A* 3ap6_A* 3ap7_A* 3apb_A 2yv8_A 2yxs_A* Back     alignment and structure
>2d6m_A Galectin-9, lectin, galactose binding, soluble 9; beta sandwich, carbohydrate binding protein, sugar binding protein; HET: LBT; 1.60A {Mus musculus} PDB: 2d6l_X 2d6k_A* 2d6n_A* 2d6p_A* 2d6o_X* Back     alignment and structure
>3b9c_A HSPC159; beta sandwich, unknown function; 1.90A {Homo sapiens} PDB: 2jj6_A Back     alignment and structure
>1x50_A Galectin-4; GAL-BIND lectin, sugar binding, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2r0h_A CGL3 lectin; galectin-related, sugar binding protein, chitotriose, chitooligosaccharides; HET: CTO; 1.90A {Coprinus cinereus} PDB: 2r0f_A* Back     alignment and structure
>3dui_A Beta-galactoside-binding lectin; carbohydrate-binding proteins, galactosides, galectin, acetylation, sugar binding protein; 2.10A {Gallus gallus} SCOP: b.29.1.3 Back     alignment and structure
>1ww7_A Galectin; carbohydrate recognition domain,X-RAY crystallographic analysis, sulfate ION, sugar binding protein; 1.90A {Agrocybe cylindracea} PDB: 1ww4_A* 1ww6_A* 1ww5_A 2zgl_A 2zgm_A* 2zgn_A* 3afk_A* 3m3c_A* 3m3q_A* 2zgk_A 2zgs_A 2zgq_A 2zgr_A 3m3e_A* 2zgo_A* 3m3o_A* 2zgp_A 2zgu_A 2zgt_A Back     alignment and structure
>2yro_A Galectin-8; GAL-BIND lectin, sugar binding, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1hlc_A Human lectin; HET: GAL BGC; 2.90A {Homo sapiens} SCOP: b.29.1.3 Back     alignment and structure
>1a78_A Galectin-1; S-lectin, carbohydrate binding, complex (lectin/saccharide); HET: TDG; 2.00A {Bufo arenarum} SCOP: b.29.1.3 PDB: 1gan_A* Back     alignment and structure
>1qmj_A Beta-galactoside-binding lectin; galectin, sugar binding protein; 2.15A {Gallus gallus} SCOP: b.29.1.3 Back     alignment and structure
>1is3_A Congerin II; complex with lactose and MES, sugar binding protein; HET: LAT MES; 1.45A {Conger myriaster} SCOP: b.29.1.3 PDB: 1is4_A* 1is5_A 1is6_A* 1wld_A* 1wlw_A* 1wlc_A* 3ak0_A* 3ajz_A* Back     alignment and structure
>1g86_A Charcot-leyden crystal protein; beta barrel, hydrolase; 1.80A {Homo sapiens} SCOP: b.29.1.3 PDB: 1lcl_A 1qkq_A* 1hdk_A* Back     alignment and structure
>1w6n_A Galectin-1; carbohydrate-binding proteins, galactosides; 1.65A {Homo sapiens} SCOP: b.29.1.3 PDB: 1w6m_A 1w6o_A* 1w6p_A* 3t2t_A* 1gzw_A* 2km2_A 3oy8_A* 3oyw_A* 1w6q_A 2zkn_A* 3m2m_A* 1slt_A* 1sla_A* 1slb_A* 1slc_A* Back     alignment and structure
>2wkk_A Galectin-2; sugar-binding protein, secreted, cell WALL, sugar binding, sugar binding protein, beta-galactoside binding lectin, fruiting BODY; HET: GAL NAG FUC; 1.50A {Coprinopsis cinerea} PDB: 1ulc_A* 1ul9_A* 1ule_A* 1ulf_A* 1ulg_A* 1uld_A* Back     alignment and structure
>1c1l_A Protein (congerin I); galectin, lectin, beta-galactose-binding, sugar binding PROT; HET: GAL BGC; 1.50A {Conger myriaster} SCOP: b.29.1.3 PDB: 1c1f_A* 3ajy_A* Back     alignment and structure
>4agr_A Galectin; sugar binding protein; 2.10A {Cinachyrella} PDB: 4agg_A 4agv_A Back     alignment and structure
>2cg5_B Fatty acid synthase; transferase-hydrolase complex, transferase/hydrolase (comple fatty acid biosynthesis, phosphopantetheine transferase; HET: COA; 2.7A {Homo sapiens} PDB: 2png_A Back     alignment and structure
>1f80_D Acyl carrier protein; transferase; HET: PN2; 2.30A {Bacillus subtilis} SCOP: a.28.1.1 PDB: 2x2b_A* 1hy8_A Back     alignment and structure
>1vku_A Acyl carrier protein; TM0175, structural genomics, JCSG, Pro structure initiative, PSI; 2.00A {Thermotoga maritima} SCOP: a.28.1.1 Back     alignment and structure
>2qnw_A Acyl carrier protein; malaria, SGC, structural genomics CONS fatty acid biosynthesis, lipid synthesis, phosphopantethein transit peptide; 1.90A {Toxoplasma gondii} Back     alignment and structure
>1l0i_A Acyl carrier protein; acyl chain binding, fatty acid biosynt lipid transport; HET: PSR; 1.20A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ny7_B* 2fhs_C 1l0h_A* 1acp_A 1t8k_A 2fac_A* 2fad_A* 2fae_A* 2k92_A 2k93_A 2k94_A 2l0q_A Back     alignment and structure
>3ejb_A Acyl carrier protein; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ejd_A* 3eje_A* Back     alignment and structure
>3gzm_A Acyl carrier protein; helix bundle, phosphopantetheine, fatty acid biosynthesis, L synthesis, transit peptide, biosynthetic protein; HET: PNS; 1.80A {Plasmodium falciparum} SCOP: a.28.1.0 PDB: 3gzl_A* 2fq0_A* 2fq2_A* Back     alignment and structure
>4dxe_H ACP, acyl carrier protein; acyl-carrier-protein synthase, type II acid synthesis pathway; 2.51A {Staphylococcus aureus} Back     alignment and structure
>1x3o_A Acyl carrier protein; structural genomics, riken structural genomics/proteomics in RSGI, NPPSFA; 1.50A {Thermus thermophilus} Back     alignment and structure
>2ava_A ACP I, acyl carrier protein I, chloroplast; four-helix-bundle, biosynthetic protein; NMR {Spinacia oleracea} PDB: 2fva_A* 2fve_A 2fvf_A* 2xz0_D* 2xz1_C* Back     alignment and structure
>2ehs_A ACP, acyl carrier protein; lipid transport, structural genomics, NPPSFA, national proje protein structural and functional analyses; 1.30A {Aquifex aeolicus} PDB: 2eht_A Back     alignment and structure
>2lol_A ACP, acyl carrier protein; lipid transport; NMR {Rickettsia prowazekii str} Back     alignment and structure
>1or5_A Acyl carrier protein; ACP, biosynthesis, frenolicin, holo, polyketide synthase, PKS, biosynthetic protein; NMR {Streptomyces roseofulvus} SCOP: a.28.1.1 Back     alignment and structure
>2cnr_A FAS, ACP, acyl carrier protein; polykdetide, phosphopantetheine, lipid transport; NMR {Streptomyces coelicolor} PDB: 2koo_A* 2kop_A* 2koq_A* 2kor_A* 2kos_A* Back     alignment and structure
>2kwl_A ACP, acyl carrier protein; structural genomics, seattle structura genomics center for infectious disease, ssgcid, lipid bindi protein; NMR {Borrelia burgdorferi} Back     alignment and structure
>2liu_A CURA; holo state, transferase; NMR {Lyngbya majuscula} PDB: 2liw_A* Back     alignment and structure
>2ju1_A Erythronolide synthase; carrier protein domain, modular polyketide synthase, alpha- helical bundle, acyltransferase; NMR {Saccharopolyspora erythraea} PDB: 2ju2_A Back     alignment and structure
>1af8_A Actinorhodin polyketide synthase acyl carrier Pro; acyl carrier protein, solution STR antibiotic biosynthesis; NMR {Streptomyces coelicolor} SCOP: a.28.1.1 PDB: 2af8_A 2k0x_A* 2k0y_A 2kg6_A* 2kg8_A* 2kg9_A* 2kga_A* 2kgc_A* 2kgd_A* 2kge_A* Back     alignment and structure
>2dnw_A Acyl carrier protein; ACP, fatty acid biosynthesis, mitochondria, NADH:ubiquinone oxidereductase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2afd_A Protein ASL1650; twisted antiparallel helical bundle, acyl carrier protein FA structural genomics, PSI, protein structure initiative; NMR {Nostoc SP} PDB: 2afe_A Back     alignment and structure
>2kr5_A PKS, aflatoxin biosynthesis polyketide synthase; acyl carrrier protein, holo, phosphopantetheine, transport protein; HET: PNS; NMR {Aspergillus parasiticus} Back     alignment and structure
>2l4b_A Acyl carrier protein; infectious disease, human granulocytic anaplasmosis, ssgcid, structural genomics; NMR {Anaplasma phagocytophilum} Back     alignment and structure
>2l3v_A ACP, acyl carrier protein; structural genomi seattle structural genomics center for infectious disease, lipid binding protein; NMR {Brucella melitensis} Back     alignment and structure
>2kw2_A Specialized acyl carrier protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Rhodopseudomonas palustris} PDB: 2ll8_A* 2lpk_A 3lmo_A Back     alignment and structure
>1klp_A ACP, ACPM, meromycolate extension acyl carrier protein; four-helix bundle, ligand transport; NMR {Mycobacterium tuberculosis} SCOP: a.28.1.1 Back     alignment and structure
>2lte_A Specialized acyl carrier protein; APO protein, transferase; NMR {Pseudomonas aeruginosa} Back     alignment and structure
>1nq4_A Oxytetracycline polyketide synthase acyl carrier protein; solution structure, dynamics, ACP, biosynthetic protein; NMR {Streptomyces rimosus} SCOP: a.28.1.1 Back     alignment and structure
>2l22_A Mupirocin didomain acyl carrier protein; biosynthetic protein; NMR {Pseudomonas fluorescens} Back     alignment and structure
>1dny_A Non-ribosomal peptide synthetase peptidyl carrier protein; four-helix bundle, modular enzyme, domain, flexible region; NMR {Brevibacillus brevis} SCOP: a.28.1.2 PDB: 2gdw_A 2gdx_A 2gdy_A 2k2q_A Back     alignment and structure
>2jq4_A AGR_C_4658P, hypothetical protein ATU2571; ATC2521, unknown function, ATC, S genomics, PSI-2, protein structure initiative; NMR {Agrobacterium tumefaciens} SCOP: a.28.1.1 Back     alignment and structure
>4i4d_A Peptide synthetase NRPS type II-PCP; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MLY; 2.10A {Streptomyces verticillus} Back     alignment and structure
>1dv5_A APO-DCP, APO-D-alanyl carrier protein; 3-helix bundle, transport protein; NMR {Lactobacillus casei} SCOP: a.28.1.3 PDB: 1hqb_A Back     alignment and structure
>2l22_A Mupirocin didomain acyl carrier protein; biosynthetic protein; NMR {Pseudomonas fluorescens} Back     alignment and structure
>3ce7_A Specific mitochodrial acyl carrier protein; malaria, mitochondrial, ACP, fatty acid biosynthesis, lipid synthesis, phosphopantetheine; 1.64A {Toxoplasma} Back     alignment and structure
>1fh1_A NODF, nodulation protein F; ROOT nodulation factor, protein backbone fold, lipid binding protein; NMR {Rhizobium leguminosarum} SCOP: i.11.1.1 Back     alignment and structure
>2lki_A Putative uncharacterized protein; helical bundle, acyl carrier, phosphopantetheine, fatty acid biosynthesis, lipid synthesis, PSI-biology; HET: PNS; NMR {Nitrosomonas europaea} Back     alignment and structure
>2cgq_A Acyl carrier protein ACPA; RV0033, protein transport, phosphopant; 1.83A {Mycobacterium tuberculosis} Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>2l9f_A CALE8, meacp; transferase, acyl carrier protein; NMR {Micromonospora echinospora} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>2fq1_A Isochorismatase; ENTB, NRPS, multi-domain, ACP, hydrolase; 2.30A {Escherichia coli} Back     alignment and structure
>2jgp_A Tyrocidine synthetase 3; multifunctional enzyme, antibiotic biosynthesis, condensatio domain, peptide bond formation, ligase; 1.85A {Brevibacillus brevis} Back     alignment and structure
>2cq8_A 10-formyltetrahydrofolate dehydrogenase; 10-FTHFDH, PP-binding, acyl carrier protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* Back     alignment and structure
>4b1m_A Levanase; hydrolase, CBM66; HET: FRU; 1.10A {Bacillus subtilis} PDB: 4b1l_A* 4azz_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 539
d2gala_133 b.29.1.3 (A:) Galectin-7 {Human (Homo sapiens) [Ta 4e-29
d2gala_133 b.29.1.3 (A:) Galectin-7 {Human (Homo sapiens) [Ta 6e-17
d1hlca_129 b.29.1.3 (A:) S-lac lectin, L-14-II {Human (Homo s 8e-29
d1hlca_129 b.29.1.3 (A:) S-lac lectin, L-14-II {Human (Homo s 5e-17
d1lcla_141 b.29.1.3 (A:) Charcot-Leyden crystal (CLC) protein 7e-27
d1lcla_141 b.29.1.3 (A:) Charcot-Leyden crystal (CLC) protein 4e-15
d2nn8a1137 b.29.1.3 (A:114-250) Galectin-3 CRD {Human (Homo s 3e-26
d2nn8a1137 b.29.1.3 (A:114-250) Galectin-3 CRD {Human (Homo s 1e-15
d1qmja_132 b.29.1.3 (A:) Galectin-1 {Chicken (Gallus gallus) 7e-25
d1qmja_132 b.29.1.3 (A:) Galectin-1 {Chicken (Gallus gallus) 1e-15
d1w6na_134 b.29.1.3 (A:) Galectin-1 {Human (Homo sapiens) [Ta 2e-24
d1w6na_134 b.29.1.3 (A:) Galectin-1 {Human (Homo sapiens) [Ta 8e-13
d1a78a_134 b.29.1.3 (A:) Galectin-1 {Toad (Bufo arenarum) [Ta 2e-24
d1a78a_134 b.29.1.3 (A:) Galectin-1 {Toad (Bufo arenarum) [Ta 7e-14
d1is3a_134 b.29.1.3 (A:) Congerin II {Conger eel (Conger myri 1e-23
d1is3a_134 b.29.1.3 (A:) Congerin II {Conger eel (Conger myri 3e-12
d1ulea_150 b.29.1.3 (A:) Galectin-2 {Inky cap fungus (Coprino 2e-23
d1ulea_150 b.29.1.3 (A:) Galectin-2 {Inky cap fungus (Coprino 5e-15
d1c1la_135 b.29.1.3 (A:) Congerin I {Conger eel (Conger myria 5e-23
d1c1la_135 b.29.1.3 (A:) Congerin I {Conger eel (Conger myria 2e-12
d2pnga176 a.28.1.1 (A:1-76) Type I fatty acid synthase ACP d 4e-07
d1f80d_74 a.28.1.1 (D:) Acyl carrier protein {Bacillus subti 3e-04
d1dv5a_80 a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactob 8e-04
d1klpa_115 a.28.1.1 (A:) Acyl carrier protein {Mycobacterium 0.003
>d2gala_ b.29.1.3 (A:) Galectin-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure

class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Galectin (animal S-lectin)
domain: Galectin-7
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  109 bits (274), Expect = 4e-29
 Identities = 33/105 (31%), Positives = 49/105 (46%), Gaps = 2/105 (1%)

Query: 130 RFAVNLVISGHDDDDIALHFNPRFDVNYCVRNSCRNKVWGEEEKAAYVSNPFKLGENFVL 189
           RF VNL+       D ALHFNPR D +  V NS     WG EE+      PF+ G+ F +
Sbjct: 29  RFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPG--VPFQRGQPFEV 86

Query: 190 EIFCAPSEFMFAVNGTHFCSFPYRYPLYTITRLQILPRVDIFKIQ 234
            I  +   F   V    +  F +R PL  +  +++   V +  ++
Sbjct: 87  LIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVR 131


>d2gala_ b.29.1.3 (A:) Galectin-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1hlca_ b.29.1.3 (A:) S-lac lectin, L-14-II {Human (Homo sapiens) [TaxId: 9606]} Length = 129 Back     information, alignment and structure
>d1hlca_ b.29.1.3 (A:) S-lac lectin, L-14-II {Human (Homo sapiens) [TaxId: 9606]} Length = 129 Back     information, alignment and structure
>d1lcla_ b.29.1.3 (A:) Charcot-Leyden crystal (CLC) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1lcla_ b.29.1.3 (A:) Charcot-Leyden crystal (CLC) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d2nn8a1 b.29.1.3 (A:114-250) Galectin-3 CRD {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d2nn8a1 b.29.1.3 (A:114-250) Galectin-3 CRD {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1qmja_ b.29.1.3 (A:) Galectin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 132 Back     information, alignment and structure
>d1qmja_ b.29.1.3 (A:) Galectin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 132 Back     information, alignment and structure
>d1w6na_ b.29.1.3 (A:) Galectin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 134 Back     information, alignment and structure
>d1w6na_ b.29.1.3 (A:) Galectin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 134 Back     information, alignment and structure
>d1a78a_ b.29.1.3 (A:) Galectin-1 {Toad (Bufo arenarum) [TaxId: 38577]} Length = 134 Back     information, alignment and structure
>d1a78a_ b.29.1.3 (A:) Galectin-1 {Toad (Bufo arenarum) [TaxId: 38577]} Length = 134 Back     information, alignment and structure
>d1is3a_ b.29.1.3 (A:) Congerin II {Conger eel (Conger myriaster) [TaxId: 7943]} Length = 134 Back     information, alignment and structure
>d1is3a_ b.29.1.3 (A:) Congerin II {Conger eel (Conger myriaster) [TaxId: 7943]} Length = 134 Back     information, alignment and structure
>d1ulea_ b.29.1.3 (A:) Galectin-2 {Inky cap fungus (Coprinopsis cinerea) [TaxId: 5346]} Length = 150 Back     information, alignment and structure
>d1ulea_ b.29.1.3 (A:) Galectin-2 {Inky cap fungus (Coprinopsis cinerea) [TaxId: 5346]} Length = 150 Back     information, alignment and structure
>d1c1la_ b.29.1.3 (A:) Congerin I {Conger eel (Conger myriaster) [TaxId: 7943]} Length = 135 Back     information, alignment and structure
>d1c1la_ b.29.1.3 (A:) Congerin I {Conger eel (Conger myriaster) [TaxId: 7943]} Length = 135 Back     information, alignment and structure
>d2pnga1 a.28.1.1 (A:1-76) Type I fatty acid synthase ACP domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 76 Back     information, alignment and structure
>d1f80d_ a.28.1.1 (D:) Acyl carrier protein {Bacillus subtilis [TaxId: 1423]} Length = 74 Back     information, alignment and structure
>d1dv5a_ a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactobacillus casei [TaxId: 1582]} Length = 80 Back     information, alignment and structure
>d1klpa_ a.28.1.1 (A:) Acyl carrier protein {Mycobacterium tuberculosis [TaxId: 1773]} Length = 115 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query539
d2gala_133 Galectin-7 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2nn8a1137 Galectin-3 CRD {Human (Homo sapiens) [TaxId: 9606] 100.0
d1hlca_129 S-lac lectin, L-14-II {Human (Homo sapiens) [TaxId 100.0
d1lcla_141 Charcot-Leyden crystal (CLC) protein {Human (Homo 99.97
d1qmja_132 Galectin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.97
d1is3a_134 Congerin II {Conger eel (Conger myriaster) [TaxId: 99.97
d1w6na_134 Galectin-1 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1c1la_135 Congerin I {Conger eel (Conger myriaster) [TaxId: 99.97
d1a78a_134 Galectin-1 {Toad (Bufo arenarum) [TaxId: 38577]} 99.97
d1ulea_150 Galectin-2 {Inky cap fungus (Coprinopsis cinerea) 99.96
d2gala_133 Galectin-7 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d2nn8a1137 Galectin-3 CRD {Human (Homo sapiens) [TaxId: 9606] 99.9
d1hlca_129 S-lac lectin, L-14-II {Human (Homo sapiens) [TaxId 99.9
d1qmja_132 Galectin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.89
d1a78a_134 Galectin-1 {Toad (Bufo arenarum) [TaxId: 38577]} 99.89
d1w6na_134 Galectin-1 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1lcla_141 Charcot-Leyden crystal (CLC) protein {Human (Homo 99.87
d1is3a_134 Congerin II {Conger eel (Conger myriaster) [TaxId: 99.86
d1ulea_150 Galectin-2 {Inky cap fungus (Coprinopsis cinerea) 99.86
d1c1la_135 Congerin I {Conger eel (Conger myriaster) [TaxId: 99.85
d2pnga176 Type I fatty acid synthase ACP domain {Rat (Rattus 99.42
d1f80d_74 Acyl carrier protein {Bacillus subtilis [TaxId: 14 98.86
d1vkua_85 Acyl carrier protein {Thermotoga maritima [TaxId: 98.85
d2jq4a183 Hypothetical protein Atu2571 {Agrobacterium tumefa 98.76
d1t8ka_77 Acyl carrier protein {Escherichia coli [TaxId: 562 98.75
d1nq4a_95 Oxytetracycline polyketide synthase acyl carrier { 98.67
d1or5a_82 Frenolicin polyketide synthase acyl carrier protei 98.65
d2af8a_86 Actinorhodin polyketide synthase acyl carrier prot 98.63
d1klpa_115 Acyl carrier protein {Mycobacterium tuberculosis [ 98.62
d1dv5a_80 apo-D-alanyl carrier protein {Lactobacillus casei 98.54
d2gdwa176 Peptidyl carrier protein (PCP), thioester domain { 98.46
d1y4wa1164 Exo-inulinase {Aspergillus awamori [TaxId: 105351] 91.82
>d2gala_ b.29.1.3 (A:) Galectin-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Galectin (animal S-lectin)
domain: Galectin-7
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.7e-35  Score=267.04  Aligned_cols=131  Identities=27%  Similarity=0.427  Sum_probs=126.5

Q ss_pred             eeeeeecCCeeEEeeEEe-ecccCCCCceEEEEeccCCCCCCCeEEEEeeEeCCCEEEEeceeCCccCcceeecCCCCCC
Q psy11967        103 VWSEQKIRKEWTVEDVIN-TNDLSALVFRFAVNLVISGHDDDDIALHFNPRFDVNYCVRNSCRNKVWGEEEKAAYVSNPF  181 (539)
Q Consensus       103 vP~~~~I~~~ltvgg~I~-~G~V~~~a~rFsINL~~g~~p~~DIaLHfNpRF~~~~IVrNS~~~G~WG~EEr~~~~~fPF  181 (539)
                      |||+++|++++++|.++. +|++.++++||+|||+++.++.+||+|||||||+++.|||||+.+|.||.|||++  .+||
T Consensus         1 vPf~~~lp~gl~~G~~i~i~G~~~~~~~~F~inl~~~~~~~~di~~Hfn~Rf~~~~IV~Ns~~~g~Wg~Eer~~--~~Pf   78 (133)
T d2gala_           1 VPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGP--GVPF   78 (133)
T ss_dssp             CCEEEECTTCCCTTCEEEEEEECCTTCCBEEEEEESSSSTTCCEEEEEEEETTTTEEEEEEEETTEECCCEECS--SCCC
T ss_pred             CCEeeecCCCCCCCCEEEEEEEECCCCCEEEEEEEeCCCCCCCEEEEEeeEcCCCEEEEECCcCCeECCceEEC--CCCC
Confidence            799999999999999986 9999999999999999987667899999999999999999999999999999998  7999


Q ss_pred             cCCCeEEEEEEEcCcEEEEEECCEEeEEecCCCCCCCeeEEEEecceEEEEEEE
Q psy11967        182 KLGENFVLEIFCAPSEFMFAVNGTHFCSFPYRYPLYTITRLQILPRVDIFKIQT  235 (539)
Q Consensus       182 ~~G~~F~I~I~~~~~~F~I~VNG~h~~~F~hRlpl~~I~~L~V~GDV~v~sV~~  235 (539)
                      .+|+.|+|.|++++++|+|+|||+|+++|+||+|+++|++|+|+|||+|++|++
T Consensus        79 ~~G~~F~l~I~~~~~~f~V~vng~~~~~F~~R~p~~~i~~l~i~Gdv~l~~V~i  132 (133)
T d2gala_          79 QRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRI  132 (133)
T ss_dssp             CTTCEEEEEEEECSSEEEEEETTEEEEEEECSSCGGGCCEEEEEESCEEEEEEE
T ss_pred             CCCCeeEEEEEECCCEEEEEECCeeEEEecCcCChhhccEEEEECCEEEEEEEE
Confidence            999999999999999999999999999999999999999999999999999986



>d2nn8a1 b.29.1.3 (A:114-250) Galectin-3 CRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hlca_ b.29.1.3 (A:) S-lac lectin, L-14-II {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lcla_ b.29.1.3 (A:) Charcot-Leyden crystal (CLC) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qmja_ b.29.1.3 (A:) Galectin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1is3a_ b.29.1.3 (A:) Congerin II {Conger eel (Conger myriaster) [TaxId: 7943]} Back     information, alignment and structure
>d1w6na_ b.29.1.3 (A:) Galectin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1la_ b.29.1.3 (A:) Congerin I {Conger eel (Conger myriaster) [TaxId: 7943]} Back     information, alignment and structure
>d1a78a_ b.29.1.3 (A:) Galectin-1 {Toad (Bufo arenarum) [TaxId: 38577]} Back     information, alignment and structure
>d1ulea_ b.29.1.3 (A:) Galectin-2 {Inky cap fungus (Coprinopsis cinerea) [TaxId: 5346]} Back     information, alignment and structure
>d2gala_ b.29.1.3 (A:) Galectin-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nn8a1 b.29.1.3 (A:114-250) Galectin-3 CRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hlca_ b.29.1.3 (A:) S-lac lectin, L-14-II {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qmja_ b.29.1.3 (A:) Galectin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1a78a_ b.29.1.3 (A:) Galectin-1 {Toad (Bufo arenarum) [TaxId: 38577]} Back     information, alignment and structure
>d1w6na_ b.29.1.3 (A:) Galectin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lcla_ b.29.1.3 (A:) Charcot-Leyden crystal (CLC) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1is3a_ b.29.1.3 (A:) Congerin II {Conger eel (Conger myriaster) [TaxId: 7943]} Back     information, alignment and structure
>d1ulea_ b.29.1.3 (A:) Galectin-2 {Inky cap fungus (Coprinopsis cinerea) [TaxId: 5346]} Back     information, alignment and structure
>d1c1la_ b.29.1.3 (A:) Congerin I {Conger eel (Conger myriaster) [TaxId: 7943]} Back     information, alignment and structure
>d2pnga1 a.28.1.1 (A:1-76) Type I fatty acid synthase ACP domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f80d_ a.28.1.1 (D:) Acyl carrier protein {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vkua_ a.28.1.1 (A:) Acyl carrier protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2jq4a1 a.28.1.1 (A:1-83) Hypothetical protein Atu2571 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1t8ka_ a.28.1.1 (A:) Acyl carrier protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nq4a_ a.28.1.1 (A:) Oxytetracycline polyketide synthase acyl carrier {Streptomyces rimosus [TaxId: 1927]} Back     information, alignment and structure
>d1or5a_ a.28.1.1 (A:) Frenolicin polyketide synthase acyl carrier protein, Fren ACP {Streptomyces roseofulvus [TaxId: 33902]} Back     information, alignment and structure
>d2af8a_ a.28.1.1 (A:) Actinorhodin polyketide synthase acyl carrier protein, ACT ACP {Streptomyces coelicolor, A3(2) [TaxId: 1902]} Back     information, alignment and structure
>d1klpa_ a.28.1.1 (A:) Acyl carrier protein {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dv5a_ a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2gdwa1 a.28.1.2 (A:8-83) Peptidyl carrier protein (PCP), thioester domain {Bacillus brevis [TaxId: 1393]} Back     information, alignment and structure
>d1y4wa1 b.29.1.19 (A:373-536) Exo-inulinase {Aspergillus awamori [TaxId: 105351]} Back     information, alignment and structure