Psyllid ID: psy12016


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
MFFLFFLEYLSVWQNDSGMFTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTKHISSLKKHMALKHGVESQ
ccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccc
cEEEEEEccccccccccccEccccccccHHHHHHHHHHHHHccccccccccccccccccccEEEEccHHHHHHHHcccccccccccccccccccccHHHHHHHHccccccc
MFFLFFLEYLSVwqndsgmftcdvcfkeykykrglvrhkknsckqkpqnldglfscdvcgkhykykkglgrhkryecgqepkyecdqcphrtkhISSLKKHMALKHGVESQ
MFFLFFLEYLSVWQNDSGMFTCDVCFKEYKYKrglvrhkknsckqkpqnldglfscdvCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTKHISSLKKHMALKHGVESQ
MFFLFFLEYLSVWQNDSGMFTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTKHISSLKKHMALKHGVESQ
*FFLFFLEYLSVWQNDSGMFTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYKYKKGLGRHKRYECGQEPKYECD*************************
MFFLFFLEYLSVWQNDSGMFTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTKHISSLKKHM**KH*****
MFFLFFLEYLSVWQNDSGMFTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHR********************
MFFLFFLEYLSVWQNDSGMFTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTKHIS*LKKH**********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFFLFFLEYLSVWQNDSGMFTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTKHISSLKKHMALKHGVESQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query111 2.2.26 [Sep-21-2011]
Q60542 1043 Zinc finger E-box-binding N/A N/A 0.738 0.078 0.337 1e-10
P37275 1124 Zinc finger E-box-binding yes N/A 0.738 0.072 0.337 1e-10
Q64318 1117 Zinc finger E-box-binding yes N/A 0.738 0.073 0.337 2e-10
P36197 1114 Zinc finger E-box-binding yes N/A 0.738 0.073 0.337 2e-10
Q62947 1109 Zinc finger E-box-binding no N/A 0.720 0.072 0.344 3e-10
Q9V5M3 878 Longitudinals lacking pro no N/A 0.540 0.068 0.442 6e-10
G5EBU4596 Zinc finger E-box-binding yes N/A 0.720 0.134 0.367 5e-09
Q7KQZ4787 Longitudinals lacking pro no N/A 0.414 0.058 0.411 2e-08
Q9R0G7 1215 Zinc finger E-box-binding no N/A 0.756 0.069 0.340 3e-08
O60315 1214 Zinc finger E-box-binding no N/A 0.756 0.069 0.340 3e-08
>sp|Q60542|ZEB1_MESAU Zinc finger E-box-binding homeobox 1 OS=Mesocricetus auratus GN=ZEB1 PE=2 SV=1 Back     alignment and function desciption
 Score = 65.5 bits (158), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 30/89 (33%), Positives = 48/89 (53%), Gaps = 7/89 (7%)

Query: 14  QNDSGMFTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYKYKKGLGRHK 73
           + ++GM+ CD+C K ++    L+RHK     ++P        C +C K +K+K  L  H 
Sbjct: 821 KTENGMYACDLCDKIFQKSSSLLRHKYEHTGKRPH------ECGICKKAFKHKHHLIEHM 874

Query: 74  RYECGQEPKYECDQCPHRTKHISSLKKHM 102
           R   G++P Y+CD+C  R  H  S  +HM
Sbjct: 875 RLHSGEKP-YQCDKCGKRFSHSGSYSQHM 902




Acts as a transcriptional repressor. Binds to E-box sequences in the immunoglobulin heavy chain enhancer as well as in the regulatory regions of many other tissue-specific genes. Represses E-cadherin promoter and induces an epithelial-mesenchymal transition (EMT) by recruiting SMARCA4/BRG1. Represses BCL6 transcription in the presence of the corepressor CTBP1. Positively regulates neuronal differentiation. Represses RCOR1 transcription activation during neurogenesis. Represses transcription by binding to the E box (5'-CANNTG-3'). Promotes tumorigenicity by repressing stemness-inhibiting microRNAs.
Mesocricetus auratus (taxid: 10036)
>sp|P37275|ZEB1_HUMAN Zinc finger E-box-binding homeobox 1 OS=Homo sapiens GN=ZEB1 PE=1 SV=2 Back     alignment and function description
>sp|Q64318|ZEB1_MOUSE Zinc finger E-box-binding homeobox 1 OS=Mus musculus GN=Zeb1 PE=1 SV=1 Back     alignment and function description
>sp|P36197|ZEB1_CHICK Zinc finger E-box-binding homeobox 1 OS=Gallus gallus GN=ZEB1 PE=2 SV=1 Back     alignment and function description
>sp|Q62947|ZEB1_RAT Zinc finger E-box-binding homeobox 1 OS=Rattus norvegicus GN=Zeb1 PE=2 SV=2 Back     alignment and function description
>sp|Q9V5M3|LOLA6_DROME Longitudinals lacking protein, isoforms N/O/W/X/Y OS=Drosophila melanogaster GN=lola PE=1 SV=3 Back     alignment and function description
>sp|G5EBU4|ZAG1_CAEEL Zinc finger E-box-binding homebox protein zag-1 OS=Caenorhabditis elegans GN=zag-1 PE=2 SV=1 Back     alignment and function description
>sp|Q7KQZ4|LOLA3_DROME Longitudinals lacking protein, isoforms A/B/D/L OS=Drosophila melanogaster GN=lola PE=1 SV=1 Back     alignment and function description
>sp|Q9R0G7|ZEB2_MOUSE Zinc finger E-box-binding homeobox 2 OS=Mus musculus GN=Zeb2 PE=1 SV=2 Back     alignment and function description
>sp|O60315|ZEB2_HUMAN Zinc finger E-box-binding homeobox 2 OS=Homo sapiens GN=ZEB2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query111
45552567 771 longitudinals lacking, isoform W [Drosop 0.711 0.102 0.433 9e-13
241025813 852 transcription factor, putative [Ixodes s 0.729 0.095 0.375 2e-10
195425431 220 GK19011 [Drosophila willistoni] gi|19415 0.531 0.268 0.566 2e-10
195026424 319 GH20627 [Drosophila grimshawi] gi|193902 0.513 0.178 0.543 3e-10
47225202 1027 unnamed protein product [Tetraodon nigro 0.738 0.079 0.348 3e-10
16648060 331 GH08307p [Drosophila melanogaster] 0.711 0.238 0.433 4e-10
195120832 325 GI20188 [Drosophila mojavensis] gi|19390 0.513 0.175 0.543 5e-10
348525528 1102 PREDICTED: zinc finger E-box-binding hom 0.738 0.074 0.359 5e-10
195153473175 GL17195 [Drosophila persimilis] gi|19411 0.504 0.32 0.571 5e-10
410931906 958 PREDICTED: zinc finger E-box-binding hom 0.738 0.085 0.348 6e-10
>gi|45552567|ref|NP_995806.1| longitudinals lacking, isoform W [Drosophila melanogaster] gi|29539421|dbj|BAC67593.1| Lola protein isoform Q [Drosophila melanogaster] gi|29539461|dbj|BAC67613.1| Lola protein isoform Q [Drosophila melanogaster] gi|29539501|dbj|BAC67633.1| Lola protein isoform Q [Drosophila melanogaster] gi|29539541|dbj|BAC67653.1| Lola protein isoform Q [Drosophila melanogaster] gi|45445597|gb|AAS64876.1| longitudinals lacking, isoform W [Drosophila melanogaster] Back     alignment and taxonomy information
 Score = 77.8 bits (190), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 36/83 (43%), Positives = 48/83 (57%), Gaps = 4/83 (4%)

Query: 27  KEYKYKRGL--VRHKKNSCKQKPQNLDGLFSCDVCGKHYKYKKGLGRHKRYECGQEPKYE 84
           +E  Y  G+  + H   +   +P   D  ++C+VCGK YK K  L RHK YECG EP  +
Sbjct: 682 QEKLYINGMSNIIHTATTMTLQPD--DCKYACNVCGKTYKIKGSLKRHKNYECGVEPNLK 739

Query: 85  CDQCPHRTKHISSLKKHMALKHG 107
           C  CPH+ K+ S L+KHM  KH 
Sbjct: 740 CPHCPHKCKYRSDLRKHMNQKHA 762




Source: Drosophila melanogaster

Species: Drosophila melanogaster

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|241025813|ref|XP_002406198.1| transcription factor, putative [Ixodes scapularis] gi|215491886|gb|EEC01527.1| transcription factor, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|195425431|ref|XP_002061011.1| GK19011 [Drosophila willistoni] gi|194157096|gb|EDW71997.1| GK19011 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195026424|ref|XP_001986253.1| GH20627 [Drosophila grimshawi] gi|193902253|gb|EDW01120.1| GH20627 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|47225202|emb|CAF98829.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information
>gi|16648060|gb|AAL25295.1| GH08307p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195120832|ref|XP_002004925.1| GI20188 [Drosophila mojavensis] gi|193909993|gb|EDW08860.1| GI20188 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|348525528|ref|XP_003450274.1| PREDICTED: zinc finger E-box-binding homeobox 1-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|195153473|ref|XP_002017650.1| GL17195 [Drosophila persimilis] gi|194113446|gb|EDW35489.1| GL17195 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|410931906|ref|XP_003979336.1| PREDICTED: zinc finger E-box-binding homeobox 1-like, partial [Takifugu rubripes] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query111
UNIPROTKB|F1MRQ1560 F1MRQ1 "Uncharacterized protei 0.756 0.15 0.352 9.7e-13
UNIPROTKB|G3MXP4588 G3MXP4 "Uncharacterized protei 0.756 0.142 0.352 1.1e-12
WB|WBGene00006970596 zag-1 [Caenorhabditis elegans 0.738 0.137 0.359 7.8e-12
UNIPROTKB|I3LG89 233 LOC100738577 "Uncharacterized 0.738 0.351 0.337 1.3e-11
UNIPROTKB|E9PT24 1009 Zeb1 "Zinc finger E-box-bindin 0.720 0.079 0.344 1.5e-11
UNIPROTKB|J9NZC3573 ZNF548 "Uncharacterized protei 0.891 0.172 0.314 2.5e-11
ZFIN|ZDB-GENE-050208-649 456 si:ch211-222k6.1 "si:ch211-222 0.729 0.177 0.386 4.6e-11
ZFIN|ZDB-GENE-080219-52 456 zgc:174564 "zgc:174564" [Danio 0.729 0.177 0.386 4.6e-11
UNIPROTKB|F1NE82 1190 ZEB2 "Uncharacterized protein" 0.738 0.068 0.348 7e-11
UNIPROTKB|F1PKS2 1191 ZEB2 "Uncharacterized protein" 0.738 0.068 0.348 7e-11
UNIPROTKB|F1MRQ1 F1MRQ1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 178 (67.7 bits), Expect = 9.7e-13, P = 9.7e-13
 Identities = 31/88 (35%), Positives = 53/88 (60%)

Query:    20 FTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYKYKKGLGRHKRYECGQ 79
             + C+VC K +K++  ++RH+K+  +++P+     FSCD C K ++Y   L RHK+    +
Sbjct:   451 YKCNVCEKTFKHQSNVIRHQKSHSEERPETP---FSCDGCEKTFRYYSDLNRHKKIHTEE 507

Query:    80 EPKYECDQCPHRTKHISSLKKHMALKHG 107
             +P Y+C +C     H S+L KHM +  G
Sbjct:   508 KP-YKCSECQKAFNHSSNLSKHMKIHTG 534


GO:0008270 "zinc ion binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
UNIPROTKB|G3MXP4 G3MXP4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
WB|WBGene00006970 zag-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|I3LG89 LOC100738577 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E9PT24 Zeb1 "Zinc finger E-box-binding homeobox 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9NZC3 ZNF548 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050208-649 si:ch211-222k6.1 "si:ch211-222k6.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080219-52 zgc:174564 "zgc:174564" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NE82 ZEB2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PKS2 ZEB2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
COG5189423 COG5189, SFP1, Putative transcriptional repressor 0.003
>gnl|CDD|227516 COG5189, SFP1, Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
 Score = 35.1 bits (80), Expect = 0.003
 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 15/75 (20%)

Query: 16  DSGMFTCDV--CFKEYKYKRGLVRHKKNS-CKQK------PQNLDGL------FSCDVCG 60
           D   + C V  C K+YK + GL  H  +    QK      P+ ++        + C+VC 
Sbjct: 346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCD 405

Query: 61  KHYKYKKGLGRHKRY 75
           K YK   GL  H+++
Sbjct: 406 KRYKNLNGLKYHRKH 420


Length = 423

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 111
KOG2462|consensus279 99.94
KOG2462|consensus279 99.87
KOG3623|consensus1007 99.69
KOG1074|consensus958 99.68
KOG3576|consensus267 99.66
KOG1074|consensus 958 99.63
KOG3623|consensus 1007 99.56
KOG3608|consensus 467 99.52
KOG3576|consensus267 99.52
PHA00733128 hypothetical protein 99.34
KOG3608|consensus 467 99.23
PHA0276855 hypothetical protein; Provisional 99.05
PHA0276855 hypothetical protein; Provisional 99.05
PHA00733128 hypothetical protein 99.01
PLN03086567 PRLI-interacting factor K; Provisional 98.98
PLN03086567 PRLI-interacting factor K; Provisional 98.93
PHA0061644 hypothetical protein 98.9
KOG3993|consensus 500 98.84
KOG3993|consensus500 98.8
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.79
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.78
PHA0061644 hypothetical protein 98.57
PHA0073279 hypothetical protein 98.49
PHA0073279 hypothetical protein 98.48
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.47
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.35
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 98.25
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.25
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 98.19
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 98.15
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.04
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 98.04
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.92
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.84
COG5189423 SFP1 Putative transcriptional repressor regulating 97.79
smart0035526 ZnF_C2H2 zinc finger. 97.65
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 97.53
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.45
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.41
smart0035526 ZnF_C2H2 zinc finger. 97.4
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.35
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 97.0
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.99
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.87
PRK04860160 hypothetical protein; Provisional 96.82
PRK04860160 hypothetical protein; Provisional 96.76
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 96.5
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 96.35
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 96.18
KOG1146|consensus 1406 95.55
COG404965 Uncharacterized protein containing archaeal-type C 94.9
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 94.7
COG404965 Uncharacterized protein containing archaeal-type C 94.32
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 94.04
KOG4173|consensus253 92.87
COG1592166 Rubrerythrin [Energy production and conversion] 92.73
KOG2893|consensus 341 92.61
KOG2893|consensus 341 92.17
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 92.17
KOG2231|consensus 669 91.95
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 91.79
COG5048 467 FOG: Zn-finger [General function prediction only] 91.61
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 91.2
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 91.13
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 90.82
PF04959 214 ARS2: Arsenite-resistance protein 2; InterPro: IPR 90.77
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 90.72
PRK06266178 transcription initiation factor E subunit alpha; V 90.3
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 90.0
PF1371937 zinc_ribbon_5: zinc-ribbon domain 89.71
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 89.71
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 89.42
COG5048467 FOG: Zn-finger [General function prediction only] 89.38
smart00531147 TFIIE Transcription initiation factor IIE. 89.08
KOG2482|consensus 423 89.05
COG5236 493 Uncharacterized conserved protein, contains RING Z 88.97
PF05443132 ROS_MUCR: ROS/MUCR transcriptional regulator prote 88.93
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 88.74
PF0972342 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 88.36
PF1371736 zinc_ribbon_4: zinc-ribbon domain 88.13
smart0061450 ZnF_BED BED zinc finger. DNA-binding domain in chr 86.89
COG199789 RPL43A Ribosomal protein L37AE/L43A [Translation, 86.69
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 86.68
KOG2186|consensus 276 86.18
PRK00464154 nrdR transcriptional regulator NrdR; Validated 85.39
KOG2186|consensus 276 85.18
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 84.92
KOG4167|consensus907 83.76
COG5189423 SFP1 Putative transcriptional repressor regulating 83.61
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 83.29
KOG2482|consensus 423 83.09
KOG2231|consensus 669 83.04
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 82.67
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 81.01
PF0030147 Rubredoxin: Rubredoxin; InterPro: IPR004039 Rubred 80.63
PF0360432 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa 80.03
>KOG2462|consensus Back     alignment and domain information
Probab=99.94  E-value=4.7e-27  Score=137.52  Aligned_cols=101  Identities=24%  Similarity=0.394  Sum_probs=91.2

Q ss_pred             hHHHHHHhhhhhcC---CCCceecCCCcccccchhHHHHHHhhhcCCCCCCCCCccccCccCcccCCchhhHhhhhhhcC
Q psy12016          2 FFLFFLEYLSVWQN---DSGMFTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYKYKKGLGRHKRYECG   78 (111)
Q Consensus         2 ~~~~~l~~~~~~~~---~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~   78 (111)
                      .+...|..|.++|-   ..+.+.|+.|++.+.+...|.-|+++|+.  +      ..|.+||+.|.+++.|+.|+++|+|
T Consensus       141 sT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~l--~------c~C~iCGKaFSRPWLLQGHiRTHTG  212 (279)
T KOG2462|consen  141 STSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHTL--P------CECGICGKAFSRPWLLQGHIRTHTG  212 (279)
T ss_pred             ccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccCC--C------cccccccccccchHHhhcccccccC
Confidence            45566778888883   36678999999999999999999999984  3      8999999999999999999999999


Q ss_pred             CCCccccCCCCcccccchhHHHHHHHhhCCCCC
Q psy12016         79 QEPKYECDQCPHRTKHISSLKKHMALKHGVESQ  111 (111)
Q Consensus        79 ~~~~~~C~~C~~~f~~~~~l~~H~~~~~~ek~~  111 (111)
                      |+ ||.|..|+++|+.+++|+.|+++|.+.|+|
T Consensus       213 EK-PF~C~hC~kAFADRSNLRAHmQTHS~~K~~  244 (279)
T KOG2462|consen  213 EK-PFSCPHCGKAFADRSNLRAHMQTHSDVKKH  244 (279)
T ss_pred             CC-CccCCcccchhcchHHHHHHHHhhcCCccc
Confidence            88 999999999999999999999999999987



>KOG2462|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PF04959 ARS2: Arsenite-resistance protein 2; InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity [] Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF05443 ROS_MUCR: ROS/MUCR transcriptional regulator protein; InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>smart00614 ZnF_BED BED zinc finger Back     alignment and domain information
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4167|consensus Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF00301 Rubredoxin: Rubredoxin; InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier [] Back     alignment and domain information
>PF03604 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa subunit; InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 4e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 39.7 bits (91), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 24/88 (27%), Positives = 40/88 (45%), Gaps = 7/88 (7%) Query: 20 FTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYKYKKGLGRHKRYECGQ 79 + C C K + K+ L RH++ +KP + C CGK + + L H+R G+ Sbjct: 50 YKCPECGKSFSDKKDLTRHQRTHTGEKP------YKCPECGKSFSQRANLRAHQRTHTGE 103 Query: 80 EPKYECDQCPHRTKHISSLKKHMALKHG 107 +P Y C +C ++ L+ H G Sbjct: 104 KP-YACPECGKSFSQLAHLRAHQRTHTG 130

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 6e-07
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-04
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-05
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-05
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-05
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 5e-05
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 7e-05
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-04
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 5e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 6e-04
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
 Score = 42.5 bits (101), Expect = 6e-07
 Identities = 19/54 (35%), Positives = 24/54 (44%), Gaps = 1/54 (1%)

Query: 54  FSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTKHISSLKKHMALKHG 107
             C  C      K  L  H+R  C   P ++C+ C   TK  S+L KHM   HG
Sbjct: 10  EKCSECSYSCSSKAALRIHERIHCTDRP-FKCNYCSFDTKQPSNLSKHMKKFHG 62


>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query111
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.95
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.94
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.92
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.92
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.92
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.91
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.91
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.91
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.9
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.9
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.9
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.89
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.89
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.89
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.89
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.88
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.88
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.88
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.88
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.87
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.87
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.86
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.85
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.84
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.83
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.83
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.81
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.8
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.8
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.78
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.78
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.77
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.77
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.77
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.73
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.72
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.72
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.72
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.71
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.71
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.7
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.7
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.69
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.69
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.68
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.68
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.68
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.68
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.67
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.67
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.67
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.67
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.66
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.65
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.65
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.65
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.64
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.62
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.61
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.6
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.6
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.6
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.59
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.59
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.59
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.59
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.58
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.58
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.58
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.57
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.57
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.57
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.55
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.53
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.52
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.51
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.5
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.48
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.48
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.47
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.45
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.45
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.43
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.43
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.42
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.42
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.41
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.41
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.41
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.41
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.41
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.41
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.4
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.4
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.4
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.4
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.4
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.4
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.4
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.4
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.4
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.4
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.39
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.39
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.39
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.39
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.39
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.39
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.39
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.39
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.39
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.39
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.39
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.39
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.39
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.39
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.39
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.39
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.38
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.38
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.38
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.38
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.38
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.38
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.38
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.38
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.37
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.37
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.37
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.37
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.37
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.37
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.37
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.37
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.37
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.36
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.36
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.36
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.36
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.36
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.36
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.36
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.36
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.36
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.36
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.36
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.36
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.36
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.35
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.35
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.35
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.35
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.35
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.35
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.35
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.35
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.35
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.35
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.34
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.34
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.34
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.34
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.34
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.34
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.34
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.34
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.34
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.34
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.34
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.34
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.34
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.33
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.33
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.33
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.33
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.33
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.33
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.33
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.33
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.33
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.32
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.32
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.32
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.32
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.32
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.32
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.32
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.32
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.32
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.32
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.32
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.31
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.31
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.31
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.3
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.3
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.3
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.3
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.3
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.3
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.29
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.29
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.29
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.29
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.29
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.29
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.29
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.29
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.29
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.28
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.28
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.28
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.28
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.28
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.28
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.28
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.28
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.28
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.28
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.27
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.27
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.27
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.27
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.27
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.27
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.27
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.27
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.27
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.27
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.27
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.27
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.27
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.26
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.26
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.26
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.26
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.26
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.26
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.26
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.26
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.26
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.25
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.25
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.25
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.25
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.25
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.25
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.25
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.25
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.25
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.24
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.24
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 99.24
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.24
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.24
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.23
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.23
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.23
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.23
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.23
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.23
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.22
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.22
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.22
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.22
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.22
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.22
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.21
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.21
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.21
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.2
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.2
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.2
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.2
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.19
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.19
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.18
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.18
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.17
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 99.15
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.14
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.14
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.14
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 99.14
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.13
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.13
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.13
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 99.12
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 99.12
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.11
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.05
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 99.04
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 99.02
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.02
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 99.02
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.01
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.0
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.99
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.99
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.98
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.98
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.97
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.97
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.97
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.96
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.96
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.95
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.95
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.92
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.92
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.91
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.91
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.9
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.88
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.86
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.86
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.86
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.85
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.85
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.84
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.84
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.84
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.83
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.81
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 98.3
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.79
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.79
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.78
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.76
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.76
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.75
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.73
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.72
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 98.19
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.71
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.66
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.65
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.64
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.64
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.63
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.62
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.62
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.6
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.59
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.59
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.58
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.57
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.56
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.56
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.95
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.52
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.5
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.5
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.5
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.48
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.47
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.46
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.44
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.75
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.75
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.36
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.68
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.28
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.67
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.67
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.38
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.25
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.88
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.78
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.76
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.63
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 94.45
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 94.14
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 93.99
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 93.63
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 92.35
2djr_A76 Zinc finger BED domain-containing protein 2; C2H2 91.79
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 90.98
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 90.72
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 90.45
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 90.33
2i5o_A39 DNA polymerase ETA; zinc finger, DNA polymerase,PO 89.74
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 89.15
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 88.97
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 88.92
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 88.58
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 88.1
3pwf_A170 Rubrerythrin; non heme iron peroxidases, oxidative 86.34
1wir_A121 Protein arginine N-methyltransferase 3; C2H2 zinc 85.64
1twf_L70 ABC10-alpha, DNA-directed RNA polymerases I, II, a 84.05
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 83.6
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 83.14
1lko_A191 Rubrerythrin all-iron(II) form; reduced form, DIIR 82.3
2ct5_A73 Zinc finger BED domain containing protein 1; DREF 81.99
3jyw_972 60S ribosomal protein L43; eukaryotic ribosome, RA 81.21
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
Probab=99.95  E-value=4.7e-29  Score=135.81  Aligned_cols=98  Identities=18%  Similarity=0.377  Sum_probs=92.7

Q ss_pred             HHhhhhhcCCCCceecCCCcccccchhHHHHHHhhhcCCCCCCCCCccccCccCcccCCchhhHhhhhhhcCCCCccccC
Q psy12016          7 LEYLSVWQNDSGMFTCDVCFKEYKYKRGLVRHKKNSCKQKPQNLDGLFSCDVCGKHYKYKKGLGRHKRYECGQEPKYECD   86 (111)
Q Consensus         7 l~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~   86 (111)
                      +++|..++.++++|.|++|++.|.....|..|+++|+++++      |.|+.|++.|.....|..|+++|.+++ ||.|.
T Consensus        10 ~~h~~~~h~Gek~y~C~~C~k~F~~~~~L~~H~~~H~~~k~------~~C~~C~k~F~~~~~L~~H~~~H~~~k-~~~C~   82 (133)
T 2lt7_A           10 DDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKK------YPCRYCEKVFPLAEYRTKHEIHHTGER-RYQCL   82 (133)
T ss_dssp             SSEEEEEETTEEEEEETTTCCEESCHHHHHHHHHHHHCCSC------EECSSSSCEESSHHHHHHHHHHHHTCC-CEEES
T ss_pred             HhhceeecCCCcCeECCCCCCCcCCHHHHHHHHHHcCCCCC------eeCCccCeecccccchhhhccccCCCc-cccCC
Confidence            45677788999999999999999999999999999999998      999999999999999999999999987 99999


Q ss_pred             CCCcccccchhHHHHHHHhhCCCCC
Q psy12016         87 QCPHRTKHISSLKKHMALKHGVESQ  111 (111)
Q Consensus        87 ~C~~~f~~~~~l~~H~~~~~~ek~~  111 (111)
                      +|++.|...+.|..|++++++++|+
T Consensus        83 ~C~k~F~~~~~L~~H~~~hh~~~p~  107 (133)
T 2lt7_A           83 ACGKSFINYQFMSSHIKSVHSQDPS  107 (133)
T ss_dssp             SSCCEESSHHHHHHHHHHHTCCCTT
T ss_pred             CCCCCcCCHHHHHHHhHHhcCCCCC
Confidence            9999999999999999999998874



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2djr_A Zinc finger BED domain-containing protein 2; C2H2 type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Back     alignment and structure
>2i5o_A DNA polymerase ETA; zinc finger, DNA polymerase,POL ETA, UBZ, ubiquitin-binding zinc finger, translesion synthesis, ubiquitin-binding domain; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A Back     alignment and structure
>1wir_A Protein arginine N-methyltransferase 3; C2H2 zinc finger domain, PRMT3, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.37.1.5 Back     alignment and structure
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Back     alignment and structure
>1lko_A Rubrerythrin all-iron(II) form; reduced form, DIIRON, four-helix bundle, rubre like, electron transport; 1.63A {Desulfovibrio vulgaris} SCOP: a.25.1.1 g.41.5.1 PDB: 1dvb_A 1jyb_A 1b71_A 1lkm_A 1lkp_A 1qyb_A 1s2z_A 1s30_A 1ryt_A Back     alignment and structure
>2ct5_A Zinc finger BED domain containing protein 1; DREF homolog, putative C-like transposable element, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.6 Back     alignment and structure
>3jyw_9 60S ribosomal protein L43; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query111
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.74
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.72
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.53
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.5
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.46
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.46
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.44
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.43
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.42
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.38
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.37
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.37
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.34
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.34
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.33
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.33
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.32
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.3
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.28
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.28
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.24
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.22
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.22
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.21
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.19
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.18
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.15
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.15
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.06
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.97
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.94
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.93
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.93
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.88
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.85
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.8
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.77
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.75
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.74
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.7
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.58
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.55
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.53
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.5
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.49
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.44
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.41
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.39
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.28
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 98.22
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.17
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.14
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 98.14
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.13
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.12
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 98.11
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.11
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.03
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.03
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.99
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.99
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.98
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.92
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.89
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.86
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.85
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.84
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.8
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.75
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.75
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.73
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.73
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.72
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.71
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.69
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.67
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.64
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.53
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.27
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.19
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.13
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 97.08
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.06
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 97.04
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.03
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.02
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.98
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.92
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.89
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.87
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.67
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.65
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.65
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.59
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.49
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 96.31
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 96.22
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.96
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.96
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.92
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 95.76
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 95.29
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 95.19
d1y0jb136 U-shaped transcription factor, different fingers { 95.05
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 94.89
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 94.79
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 94.37
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 94.3
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.21
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 93.41
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 92.66
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 91.74
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 90.66
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 90.22
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 89.45
d1lkoa244 Rubrerythrin, C-terminal domain {Desulfovibrio vul 88.93
d1fu9a_36 U-shaped transcription factor, different fingers { 87.59
d6rxna_45 Rubredoxin {Desulfovibrio desulfuricans, strain 27 87.28
d2ghfa236 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 85.65
d2ak3a237 Microbial and mitochondrial ADK, insert "zinc fing 85.18
d2gmga1105 Hypothetical protein PF0610 {Pyrococcus furiosus [ 85.17
d2yrka148 Zinc finger homeobox protein 4, ZFHX4 {Human (Homo 84.56
d1akya238 Microbial and mitochondrial ADK, insert "zinc fing 84.49
d1brfa_53 Rubredoxin {Archaeon Pyrococcus furiosus [TaxId: 2 84.01
d1wira_121 Protein arginine N-methyltransferase 3 {Mouse (Mus 83.67
d1iroa_53 Rubredoxin {Clostridium pasteurianum [TaxId: 1501] 83.64
d2czra1218 TBP-interacting protein {Thermococcus kodakaraensi 83.4
d2dsxa152 Rubredoxin {Desulfovibrio gigas [TaxId: 879]} 81.75
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.74  E-value=8.1e-19  Score=79.84  Aligned_cols=50  Identities=30%  Similarity=0.630  Sum_probs=27.5

Q ss_pred             cccCccCcccCCchhhHhhhhhhcCCCCccccCCCCcccccchhHHHHHHHh
Q psy12016         54 FSCDVCGKHYKYKKGLGRHKRYECGQEPKYECDQCPHRTKHISSLKKHMALK  105 (111)
Q Consensus        54 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~  105 (111)
                      |.| .||+.|.....|..|+++|.+++ ||.|.+|++.|...+.|..|+++|
T Consensus         4 y~C-~Cgk~F~~~~~l~~H~~~Ht~ek-py~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           4 YPC-QCGKSFTHKSQRDRHMSMHLGLR-PYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             EEC-TTSCEESSHHHHHHHHHHHSCCC-SEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CCC-CCCCeECCHHHhHHHhhcccccc-CCcCCCcCCEecCHHHHHHHHhcC
Confidence            555 35555555555555555555544 555555555555555555555443



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1lkoa2 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} Back     information, alignment and structure
>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2gmga1 a.4.5.82 (A:1-105) Hypothetical protein PF0610 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2yrka1 g.37.1.4 (A:8-55) Zinc finger homeobox protein 4, ZFHX4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1brfa_ g.41.5.1 (A:) Rubredoxin {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wira_ g.37.1.5 (A:) Protein arginine N-methyltransferase 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iroa_ g.41.5.1 (A:) Rubredoxin {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d2czra1 c.52.4.1 (A:1-218) TBP-interacting protein {Thermococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d2dsxa1 g.41.5.1 (A:1-52) Rubredoxin {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure