Psyllid ID: psy12044


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------
MMYWIFLIATIIKIVSACPTSCICKWKGGKQTVECVNKSLITVVEGMDPNTQVLDYTGNNLKTLHNEKFQKMGLVNLQKIYLSRCRISVIDSKAFRGLTNLVDLDFSHNVLQTVPSDTFPDYPSLMKLTLSGNPIKQIKTGAFQPLSYLVTLELSKCGIEVIEDAAFVGLDSLEWLKLDNNKITTISGSNILPTGLHGIDLHHNPWTCDCLLIGLRRWLESTKTPMAIDPICSVPPRLSSVTIKQLSIDELACEPQITPSTFYLEIQEGKNVSLLCKVSAIPEAKITWLFDGVPIQNESMSASESHAVYSTEEGTEIKKSELLIYNSNIDDNGTFVCVAENQAGSTSSNYTIRIVLKEENVEVVTVFPLEYVLIVSGIISVCSLVLIFLLVLCFLCFRRKKKKLKKKDESDKNVNGSNENVVKNLRESPKYTSVNATSATCMDKVNGGYIIADGHNDMMLYATDSGILVATNNMNTYPSYSISYQIEQNPDLVNDAESVDKDRRAQGGEDTQDTQDKASEAASVQYSDSGSQCQEWGNVCYNRMQPMQHIVLNNVYNQPADIHLTPEKFMDRDGYPVDFGLPKVPTHFPALVPATAYYRTLPHRRHTAANPNNRYSREAEFLSRSSQPASYEHYAPADVRYNIEGYPSASPTPYSSAPRVTFTEPLHILQGQPMQSNPPTETTTKNEQTWTESSADEQPSTSNPEKSNENKSEGFQAKRHMIDSLLKNRDVKVGSHLHPHRGLMLPPVLTESPDEGYEGEGPETTEM
cHHHHHHHHHHHccccccccccEEEEcccccEEEccccccccccccccccccEEEcccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEccccccccccccccccccccccEEEccccccccccHHHHccccccccccccccccccccccccccccccEEEEcccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEEEcccccEEEEEEEEEccccEEEEEEcccccccccccccccccEEEccccEEEEEcEEEEccccccccEEEEEEEEEccccEEEEEEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cHHHHHHHHHHHHHHccccccEEEEEccccEEEEEccccccEcccccccccEEEEccccccccccHHHHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccEEccccccccccccEEEcccccccEEccccccccccccEEEccccccccccHHHHccccccEEEEcccccccccHHHHHHHHHHHccccccccccccccHHHcccEcccccHHHcccccccccccccEEEEcccEEEEEEEEEcccccEEEEEEcccEEcccccccccccEEEEEccccEEcccEEEEEEEccccccEEEEEEEcccccEEEEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEcccccccccccccccccccccccccEEEccccccEEEEEcccccEcccccccccccccHHHHHcccccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccHHHHHHHHHccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccHHHHHHccHHHHHcccccccccccccccccccccccc
MMYWIFLIATIIKIVSacptscickwkggkqtVECVNKSLITVvegmdpntqvldytgnnlktLHNEKFQKMGLVNLQKIYLSrcrisvidskafrgltnlvdldfshnvlqtvpsdtfpdypslmkltlsgnpikqiktgafqplSYLVTLELSKCGIEVIEDAAFVGLDslewlkldnnkittisgsnilptglhgidlhhnpwtcDCLLIGLRRWlestktpmaidpicsvpprlssvtikqlsidelacepqitpstfYLEIqegknvsllckvsaipeakitwlfdgvpiqnesmsaseshavysteegteikKSELLIYnsniddngTFVCVAenqagstssnyTIRIVLKeenvevvtVFPLEYVLIVSGIISVCSLVLIFLLVLCFLCFRRKKKklkkkdesdknvngsneNVVKNLrespkytsvnatsatcmdkvnggyiiadghndmmLYATDSGILvatnnmntypsysisyqieqnpdlvndaesvdkdrraqggedtqdtqdKASEAasvqysdsgsqcqeWGNVcynrmqpmqHIVLNnvynqpadihltpekfmdrdgypvdfglpkvpthfpalvpatayyrtlphrrhtaanpnnrysreaeflsrssqpasyehyapadvryniegypsasptpyssaprvtfteplhilqgqpmqsnpptetttkneqtwtessadeqpstsnpeksnenksegFQAKRHMIDSLlknrdvkvgshlhphrglmlppvltespdegyegegpettem
MMYWIFLIATIIKIVSACPTSCICKWKGGKQTVECVNKSLITVvegmdpntQVLDYTGNNLKTLHNEKFQKMGLVNLQKIYLSRCRISVIDSKAFRGLTNLVDLDFSHNVLQTVPSDTFPDYPSLMKLTLSGNPIKQIKTGAFQPLSYLVTLELSKCGIEVIEDAAFVGLDSLEWLKLDNNKITTISGSNILPTGLHGIDLHHNPWTCDCLLIGLRRWLESTKTPmaidpicsvppRLSSVTIKQLSIDELACEPQITPSTFYLEIQEGKNVSLLCKVSAIPEAKITWLFDGVPIQNESMSASESHAVYSTEEGTEIKKSELLIYNSNIDDNGTFVCVAENqagstssnytirIVLKEENVEVVTVFPLEYVLIVSGIISVCSLVLIFLLVLCFLCFRRKKkklkkkdesdknvngsnenvvknlrespkytsvnatsatcmdKVNGGYIIADGHNDMMLYATDSGILVATNNMNTYPSYSISYQIEQNPDLVNDAESVDKDRRAqggedtqdtqdkaSEAAsvqysdsgsQCQEWGNVCYNRMQPMQHIVLNNVYNQPADIHLTPEKFMDRDGYPVDFGLPKVPTHFPALVPATAYyrtlphrrhtaanpnnrySREAEFLSRSSQPASYEHYAPADVRYNIEGYPSASPTPYSSAPRVTFTEPLHIlqgqpmqsnpptETTTKNEQTWtessadeqpstsnpeksnenksegFQAKRHMIDSLLKNRDVKVGSHlhphrglmlppvltespdegyegegpettem
MMYWIFLIATIIKIVSACPTSCICKWKGGKQTVECVNKSLITVVEGMDPNTQVLDYTGNNLKTLHNEKFQKMGLVNLQKIYLSRCRISVIDSKAFRGLTNLVDLDFSHNVLQTVPSDTFPDYPSLMKLTLSGNPIKQIKTGAFQPLSYLVTLELSKCGIEVIEDAAFVGLDSLEWLKLDNNKITTISGSNILPTGLHGIDLHHNPWTCDCLLIGLRRWLESTKTPMAIDPICSVPPRLSSVTIKQLSIDELACEPQITPSTFYLEIQEGKNVSLLCKVSAIPEAKITWLFDGVPIQNESMSASESHAVYSTEEGTEIKKSELLIYNSNIDDNGTFVCVAENQAGSTSSNYTIRIVLKEENVEVVTVFPLEYVLIVSGiisvcslvlifllvlcflcfrrkkkklkkkDESDKNVNGSNENVVKNLRESPKYTSVNATSATCMDKVNGGYIIADGHNDMMLYATDSGILVATNNMNTYPSYSISYQIEQNPDLVNDAESVDKDRRAQGGEDTQDTQDKASEAASVQYSDSGSQCQEWGNVCYNRMQPMQHIVLNNVYNQPADIHLTPEKFMDRDGYPVDFGLPKVPTHFPALVPATAYYRTLPHRRHTAANPNNRYSREAEFLSRSSQPASYEHYAPADVRYNIEGypsasptpyssapRVTFTEPLHILQGQPMQSNPPtetttkneqtwteSSADEQPSTSNPEKSNENKSEGFQAKRHMIDSLLKNRDVKVGSHLHPHRGLMLPPVLTespdegyegegpetteM
*MYWIFLIATIIKIVSACPTSCICKWKGGKQTVECVNKSLITVVEGMDPNTQVLDYTGNNLKTLHNEKFQKMGLVNLQKIYLSRCRISVIDSKAFRGLTNLVDLDFSHNVLQTVPSDTFPDYPSLMKLTLSGNPIKQIKTGAFQPLSYLVTLELSKCGIEVIEDAAFVGLDSLEWLKLDNNKITTISGSNILPTGLHGIDLHHNPWTCDCLLIGLRRWLESTKTPMAIDPICSVPPRLSSVTIKQLSIDELACEPQITPSTFYLEIQEGKNVSLLCKVSAIPEAKITWLFDGVPI***********************KSELLIYNSNIDDNGTFVCVAENQAGSTSSNYTIRIVLKEENVEVVTVFPLEYVLIVSGIISVCSLVLIFLLVLCFLCF*************************************NATSATCMDKVNGGYIIADGHNDMMLYATDSGILVATNNMNTYPSYSISYQI**********************************************CQEWGNVCYNRMQPMQHIVLNNVYNQPADIHLTPEKFMDRDGYPVDFGLPKVPTHFPALVPATAYYRTLP*************************************RY******************************************************************************************************************************
MMYWIFLIATIIKIVSACPTSCICKWKGGKQTVECVNKSLITVVEGMDPNTQVLDYTGNNLKTLHNEKFQKMGLVNLQKIYLSRCRISVIDSKAFRGLTNLVDLDFSHNVLQTVPSDTFPDYPSLMKLTLSGNPIKQIKTGAFQPLSYLVTLELSKCGIEVIEDAAFVGLDSLEWLKLDNNKITTISGSNILPTGLHGIDLHHNPWTCDCLLIGLRRWLESTKTPMAIDPICSVPPRLSSVTIKQLSIDELACEPQITPS****EIQEGKNVSLLCKVSAIPEAKITWLFDGVPIQ*****************GTEIKKSELLIYNSNIDDNGTFVCVAENQAGSTSSNYTIRIVLKE*******VFPLEYVLIVSGIISVCSLVLIFLLVLCFLCF**********************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************
MMYWIFLIATIIKIVSACPTSCICKWKGGKQTVECVNKSLITVVEGMDPNTQVLDYTGNNLKTLHNEKFQKMGLVNLQKIYLSRCRISVIDSKAFRGLTNLVDLDFSHNVLQTVPSDTFPDYPSLMKLTLSGNPIKQIKTGAFQPLSYLVTLELSKCGIEVIEDAAFVGLDSLEWLKLDNNKITTISGSNILPTGLHGIDLHHNPWTCDCLLIGLRRWLESTKTPMAIDPICSVPPRLSSVTIKQLSIDELACEPQITPSTFYLEIQEGKNVSLLCKVSAIPEAKITWLFDGVPIQNES***************TEIKKSELLIYNSNIDDNGTFVCVAENQAGSTSSNYTIRIVLKEENVEVVTVFPLEYVLIVSGIISVCSLVLIFLLVLCFLCFRRKK**************GSNENVVKNLRESPKYTSVNATSATCMDKVNGGYIIADGHNDMMLYATDSGILVATNNMNTYPSYSISYQIEQNPDLVNDAESVDK******************************QCQEWGNVCYNRMQPMQHIVLNNVYNQPADIHLTPEKFMDRDGYPVDFGLPKVPTHFPALVPATAYYRTLPHRRHTAANPNNRYS**************YEHYAPADVRYNIEGYPSASPTPYSSAPRVTFTEPLHILQGQ******************************************FQAKRHMIDSLLKNRDVKVGSHLHPHRGLMLPPVLTESP**************
MMYWIFLIATIIKIVSACPTSCICKWKGGKQTVECVNKSLITVVEGMDPNTQVLDYTGNNLKTLHNEKFQKMGLVNLQKIYLSRCRISVIDSKAFRGLTNLVDLDFSHNVLQTVPSDTFPDYPSLMKLTLSGNPIKQIKTGAFQPLSYLVTLELSKCGIEVIEDAAFVGLDSLEWLKLDNNKITTISGSNILPTGLHGIDLHHNPWTCDCLLIGLRRWLESTKTPMAIDPICSVPPRLSSVTIKQLSIDELACEPQITPSTFYLEIQEGKNVSLLCKVSAIPEAKITWLFDGVPIQNESMSASESHAVYSTEEGTEIKKSELLIYNSNIDDNGTFVCVAENQAGSTSSNYTIRIVLKEENVEVVTVFPLEYVLIVSGIISVCSLVLIFLLVLCFLCFRRKKK*****************************************KVNGGYIIADGHNDMMLYATDSGILVATNNMNTYPSYSISYQIEQNPDLVNDAESV****************DKASEAASVQYSDSGSQCQEWGNVCYNRMQPMQHIVLNNVYNQPADIHLTPEKFMDRDGYPVDFGLPKVPTHFPALVPATAYYRTLPHRRHTAANPNNRYSREAEFLSRSSQPASYEHYAPADVRYNIEGYPSASP**********FTEPLHILQGQPMQSNPPT******EQT*TE****EQPS*******************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMYWIFLIATIIKIVSACPTSCICKWKGGKQTVECVNKSLITVVEGMDPNTQVLDYTGNNLKTLHNEKFQKMGLVNLQKIYLSRCRISVIDSKAFRGLTNLVDLDFSHNVLQTVPSDTFPDYPSLMKLTLSGNPIKQIKTGAFQPLSYLVTLELSKCGIEVIEDAAFVGLDSLEWLKLDNNKITTISGSNILPTGLHGIDLHHNPWTCDCLLIGLRRWLESTKTPMAIDPICSVPPRLSSVTIKQLSIDELACEPQITPSTFYLEIQEGKNVSLLCKVSAIPEAKITWLFDGVPIQNESMSASESHAVYSTEEGTEIKKSELLIYNSNIDDNGTFVCVAENQAGSTSSNYTIRIVLKEENVEVVTVFPLEYVLIVSGIISVCSLVLIFLLVLCFLCFRRKKKKLKKKDESDKNVNGSNENVVKNLRESPKYTSVNATSATCMDKVNGGYIIADGHNDMMLYATDSGILVATNNMNTYPSYSISYQIEQNPDLVNDAESVDKDRRAQGGEDTQDTQDKASEAASVQYSDSGSQCQEWGNVCYNRMQPMQHIVLNNVYNQPADIHLTPEKFMDRDGYPVDFGLPKVPTHFPALVPATAYYRTLPHRRHTAANPNNRYSREAEFLSRSSQPASYEHYAPADVRYNIEGYPSASPTPYSSAPRVTFTEPLHILQGQPMQSNPPTETTTKNEQTWTESSADEQPSTSNPEKSNENKSEGFQAKRHMIDSLLKNRDVKVGSHLHPHRGLMLPPVLTESPDEGYEGEGPETTEM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query767 2.2.26 [Sep-21-2011]
Q9HCJ2640 Leucine-rich repeat-conta yes N/A 0.443 0.531 0.248 5e-25
Q8C031640 Leucine-rich repeat-conta yes N/A 0.443 0.531 0.248 5e-25
Q96NI6719 Leucine-rich repeat and f no N/A 0.438 0.467 0.260 1e-24
O75093 1534 Slit homolog 1 protein OS no N/A 0.305 0.152 0.336 2e-24
O88279 1531 Slit homolog 1 protein OS no N/A 0.305 0.152 0.327 2e-24
Q50LG9513 Leucine-rich repeat-conta no N/A 0.430 0.643 0.269 3e-24
Q80TR4 1531 Slit homolog 1 protein OS no N/A 0.305 0.152 0.327 4e-24
Q8BXA0719 Leucine-rich repeat and f no N/A 0.438 0.467 0.255 6e-24
D4A1J9719 Leucine-rich repeat and f no N/A 0.438 0.467 0.255 6e-24
O88280 1523 Slit homolog 3 protein OS no N/A 0.301 0.151 0.331 8e-24
>sp|Q9HCJ2|LRC4C_HUMAN Leucine-rich repeat-containing protein 4C OS=Homo sapiens GN=LRRC4C PE=1 SV=1 Back     alignment and function desciption
 Score =  117 bits (292), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 107/431 (24%), Positives = 169/431 (39%), Gaps = 91/431 (21%)

Query: 18  CPTSCICKWKGGKQTVECVNKSLITVVEGMDPNTQVLDYTGNNLKTLHNEKFQKM----- 72
           CP+ C C  +  K  V CV K+L  V +G+  NT++L+   N ++ +    F+ +     
Sbjct: 47  CPSVCSCSNQFSK--VICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEI 104

Query: 73  -----------------GLVNLQKIYLSRCRISVIDSKAFRGLTNLVDLDFSHNVLQTVP 115
                            GL NL  + L   R++ I + AF  L+ L +L   +N ++++P
Sbjct: 105 LQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIP 164

Query: 116 SDTFPDYPSLMKLTL--------------------------------------------- 130
           S  F   PSL +L L                                             
Sbjct: 165 SYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDEL 224

Query: 131 --SGNPIKQIKTGAFQPLSYLVTLELSKCGIEVIEDAAFVGLDSLEWLKLDNNKITTISG 188
             SGN +  I+ G+FQ L +L  L + +  I+VIE  AF  L SL  + L +N +T +  
Sbjct: 225 DLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPH 284

Query: 189 SNILPT-GLHGIDLHHNPWTCDCLLIGLRRWLESTK-TPMAIDPICSVPPRLSSVTIKQL 246
               P   L  I LHHNPW C+C ++ L  W++    +  A    C+ PP L    I +L
Sbjct: 285 DLFTPLHHLERIHLHHNPWNCNCDILWLSWWIKDMAPSNTACCARCNTPPNLKGRYIGEL 344

Query: 247 SIDELAC-EPQITPSTFYLEIQEGKNVSLLCKVSAIPEAKITWLFDGVPIQNESMSASES 305
             +   C  P I      L + EG    L C+ S      ++W+     +         +
Sbjct: 345 DQNYFTCYAPVIVEPPADLNVTEGMAAELKCRAST-SLTSVSWITPNGTVM--------T 395

Query: 306 HAVYSTEEGTEIKKSELLIYNSNIDDNGTFVCVAENQAGSTSSNYTIRIVLKEENVEVVT 365
           H  Y       +    L   N  + D G + C+  N  G+T+++ T+       NV   T
Sbjct: 396 HGAYKVRIAV-LSDGTLNFTNVTVQDTGMYTCMVSNSVGNTTASATL-------NVTAAT 447

Query: 366 VFPLEYVLIVS 376
             P  Y   V+
Sbjct: 448 TTPFSYFSTVT 458




May promote neurite outgrowth of developing thalamic neurons.
Homo sapiens (taxid: 9606)
>sp|Q8C031|LRC4C_MOUSE Leucine-rich repeat-containing protein 4C OS=Mus musculus GN=Lrrc4c PE=1 SV=2 Back     alignment and function description
>sp|Q96NI6|LRFN5_HUMAN Leucine-rich repeat and fibronectin type-III domain-containing protein 5 OS=Homo sapiens GN=LRFN5 PE=1 SV=2 Back     alignment and function description
>sp|O75093|SLIT1_HUMAN Slit homolog 1 protein OS=Homo sapiens GN=SLIT1 PE=2 SV=4 Back     alignment and function description
>sp|O88279|SLIT1_RAT Slit homolog 1 protein OS=Rattus norvegicus GN=Slit1 PE=1 SV=1 Back     alignment and function description
>sp|Q50LG9|LRC24_HUMAN Leucine-rich repeat-containing protein 24 OS=Homo sapiens GN=LRRC24 PE=2 SV=2 Back     alignment and function description
>sp|Q80TR4|SLIT1_MOUSE Slit homolog 1 protein OS=Mus musculus GN=Slit1 PE=1 SV=2 Back     alignment and function description
>sp|Q8BXA0|LRFN5_MOUSE Leucine-rich repeat and fibronectin type-III domain-containing protein 5 OS=Mus musculus GN=Lrfn5 PE=1 SV=1 Back     alignment and function description
>sp|D4A1J9|LRFN5_RAT Leucine-rich repeat and fibronectin type-III domain-containing protein 5 OS=Rattus norvegicus GN=Lrfn5 PE=1 SV=1 Back     alignment and function description
>sp|O88280|SLIT3_RAT Slit homolog 3 protein OS=Rattus norvegicus GN=Slit3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query767
242013643752 Amphoterin-induced protein 2 precursor, 0.925 0.944 0.423 1e-152
157125045811 kek1 [Aedes aegypti] gi|108882755|gb|EAT 0.853 0.807 0.427 1e-143
170063709829 kek1 [Culex quinquefasciatus] gi|1678812 0.847 0.784 0.408 1e-136
91081769637 PREDICTED: similar to kek1 [Tribolium ca 0.720 0.868 0.421 1e-133
312373578 1059 hypothetical protein AND_17259 [Anophele 0.830 0.601 0.374 1e-131
195437746 909 GK24359 [Drosophila willistoni] gi|19416 0.794 0.669 0.378 1e-128
198473958 901 GA18568 [Drosophila pseudoobscura pseudo 0.827 0.704 0.377 1e-126
195340171 894 GM19128 [Drosophila sechellia] gi|194130 0.833 0.714 0.383 1e-125
77455272 880 CG4977 [Drosophila yakuba] 0.814 0.710 0.382 1e-124
194861653 900 GG23727 [Drosophila erecta] gi|190661693 0.834 0.711 0.378 1e-124
>gi|242013643|ref|XP_002427512.1| Amphoterin-induced protein 2 precursor, putative [Pediculus humanus corporis] gi|212511907|gb|EEB14774.1| Amphoterin-induced protein 2 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  546 bits (1407), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 324/765 (42%), Positives = 452/765 (59%), Gaps = 55/765 (7%)

Query: 15  VSACPTSCICKWKGGKQTVECVNKSLITVVEGMDPNTQVLDYTGNNLKTLHNEKFQKMGL 74
           V +CP+ C CKWKGGKQTVEC +K LIT+  G+D  TQVL+++GNNLK L  E+F++MGL
Sbjct: 31  VVSCPSDCACKWKGGKQTVECPDKGLITIPNGIDAGTQVLEFSGNNLKLLPRERFERMGL 90

Query: 75  VNLQKIYLSRCRISVIDSKAFRGLTNLVDLDFSHNVLQTVPSDTFPDYPSLMKLTLSGNP 134
           +NLQ+IYLSRC+I  ID +AFRGLTNLV+LD S N L TVP++TF DYPSLM+L +SGNP
Sbjct: 91  LNLQRIYLSRCKILQIDDRAFRGLTNLVELDLSLNFLNTVPTETFVDYPSLMRLIVSGNP 150

Query: 135 IKQIKTGAFQPLSYLVTLELSKCGIEVIEDAAFVGLDSLEWLKLDNNKITTISGSNILPT 194
           I+ ++T +F+PLS+L +LELS C IE IED  F+GLD+LEWLKLD N++  I G NILP 
Sbjct: 151 IRALQTASFRPLSFLTSLELSNCQIESIEDGTFLGLDNLEWLKLDGNRLNFIRGENILPD 210

Query: 195 GLHGIDLHHNPWTCDCLLIGLRRWLESTKTPMAIDPICSVPPRLSSVTIKQLSIDELACE 254
            +HG+ L  NPW CDC L+ +  WL + K   + +P C+ P RL    I+ L + +LAC 
Sbjct: 211 AVHGVALDRNPWQCDCRLLEVHNWLLNYKIIHSTEPKCAGPERLVGEPIRNLEVGDLACL 270

Query: 255 PQITPSTFYLEIQEGKNVSLLCKVSAIPEAKITWLFDGVPIQNESMSASESHAVYSTEEG 314
           P ++P+T YLEI EGKN+SLLC+VSAIPEA ++W F G  +QN++  A   H  Y  EEG
Sbjct: 271 PDVSPTTLYLEIAEGKNISLLCRVSAIPEASVSWWFQGRILQNDTTLAPGFHFYYFVEEG 330

Query: 315 TEIKKSELLIYNSNIDDNGTFVCVAENQAGSTSSNYTIRIVLKEENVEVVTVFPLEYVLI 374
            E K+SEL I+N+N DDNGTFVC AEN AG + SNYTIRI++KEE V  + VF  EY++ 
Sbjct: 331 REEKRSELFIFNTNPDDNGTFVCAAENPAGKSLSNYTIRIIVKEEPVVGLIVFSREYLIA 390

Query: 375 VSGIISVCSLVLIFLLVLCFLCFRRKKKKLKKKDESDKNVNGSNENVVKN-LRESPKYTS 433
           +  +++V   +++ +L    +  RR+++K +KK+ S +  + + + +++N +  SP  T+
Sbjct: 391 IFSVLTVFCFIILVILAFLLIRCRRQRRKKRKKERSKEMASQNQKPLLRNEIITSPTETT 450

Query: 434 VNATSATCMD-KVNGGYIIAD--GHNDMMLYATDSGILVATNNMNTYPSYSISYQIEQNP 490
             +     M  + N    I +  G N+    +  SG+ +  N           +  +QNP
Sbjct: 451 GKSNGTVVMSGQSNVSVFIPNIGGSNENESQSITSGVYIPQN----------VFLTDQNP 500

Query: 491 DLVNDAESVDKDRRAQGGEDTQDTQDKASEAASVQYSDSGSQCQEWGNVCYNRMQPMQHI 550
           DL+N  ES     + Q GE   D     S  +S  Y+D+    Q  GN     +   QH 
Sbjct: 501 DLINGTESAGN--KFQIGESQIDGGQNLSLMSS-PYADASRYIQTRGNC---DLFIKQHY 554

Query: 551 VLNNVYNQPADIHLTPEKFMDRDGYPVDFGLPKVP--THFPALVPATAYYRTLPHRR--- 605
                    ADIHL+P +F D DGYPVD+GLPKVP     P       YYRTLP++R   
Sbjct: 555 T--------ADIHLSPGRFFDGDGYPVDYGLPKVPLMVSLPTPDQQINYYRTLPNKRSAK 606

Query: 606 HTAANPNNRY-SREAEFLSRSSQPASYEHYAPADVRYNIEGYPSASPTPYSSAPRVTFTE 664
            +AANP+ ++ SREAEFLS SS    Y+ Y P++VRY +EGYP          P  +   
Sbjct: 607 FSAANPHLKFASREAEFLS-SSHSNPYD-YNPSNVRYTLEGYPCHQQQQQPQPPPPSNYS 664

Query: 665 PLHILQGQPMQSNPPTETTTKNEQTWTESSADEQPSTSNPEKSNEN--KSEGFQAKRHMI 722
           P    +G  + S PP    T          A+ Q    N ++S      ++G   ++   
Sbjct: 665 PSEC-EGTFIPS-PPAAYKTDGISMIPPCDANNQWQCVNAQQSRATDINADGIMQQQQQQ 722

Query: 723 DSLLKNRDVKVGSHLHPHRGLMLPPVLTESPDEGYEGEGPETTEM 767
            S+   +                  VLTESPDEGY G+  E+ ++
Sbjct: 723 CSMSSKKTQA---------------VLTESPDEGYVGDTTESGDI 752




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|157125045|ref|XP_001654226.1| kek1 [Aedes aegypti] gi|108882755|gb|EAT46980.1| AAEL001894-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170063709|ref|XP_001867219.1| kek1 [Culex quinquefasciatus] gi|167881270|gb|EDS44653.1| kek1 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|91081769|ref|XP_973294.1| PREDICTED: similar to kek1 [Tribolium castaneum] gi|270006275|gb|EFA02723.1| hypothetical protein TcasGA2_TC008448 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|312373578|gb|EFR21292.1| hypothetical protein AND_17259 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|195437746|ref|XP_002066801.1| GK24359 [Drosophila willistoni] gi|194162886|gb|EDW77787.1| GK24359 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|198473958|ref|XP_001356502.2| GA18568 [Drosophila pseudoobscura pseudoobscura] gi|198138185|gb|EAL33566.2| GA18568 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195340171|ref|XP_002036690.1| GM19128 [Drosophila sechellia] gi|194130570|gb|EDW52613.1| GM19128 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|77455272|gb|ABA86445.1| CG4977 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|194861653|ref|XP_001969826.1| GG23727 [Drosophila erecta] gi|190661693|gb|EDV58885.1| GG23727 [Drosophila erecta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query767
FB|FBgn0015400 894 kek2 "kekkon-2" [Drosophila me 0.478 0.410 0.528 1.6e-113
FB|FBgn0015399880 kek1 "kekkon-1" [Drosophila me 0.444 0.387 0.439 1.1e-82
FB|FBgn0028370 1021 kek3 "kekkon-3" [Drosophila me 0.461 0.346 0.364 3.3e-64
FB|FBgn0039862836 kek6 "kek6" [Drosophila melano 0.444 0.407 0.310 1.2e-38
FB|FBgn0031016 931 kek5 "kekkon5" [Drosophila mel 0.435 0.358 0.280 1.9e-35
FB|FBgn0032484649 kek4 "kekkon4" [Drosophila mel 0.468 0.553 0.289 5.1e-35
ZFIN|ZDB-GENE-060503-496594 lrrc24 "leucine rich repeat co 0.359 0.464 0.294 8e-29
UNIPROTKB|Q50LG9513 LRRC24 "Leucine-rich repeat-co 0.431 0.645 0.276 5.6e-26
MGI|MGI:3605040521 Lrrc24 "leucine rich repeat co 0.414 0.610 0.291 2.3e-25
UNIPROTKB|F1P2C4423 LRRC4C "Uncharacterized protei 0.401 0.728 0.284 1.1e-24
FB|FBgn0015400 kek2 "kekkon-2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1040 (371.2 bits), Expect = 1.6e-113, Sum P(2) = 1.6e-113
 Identities = 198/375 (52%), Positives = 264/375 (70%)

Query:     4 WIFLIATIIKIVSACPTS-CICKWKGGKQTVECVNKSLITVVEGMDPNTQVLDYTGNNLK 62
             WI L+A ++ I +ACP   C+CKWKGGKQTVEC  + L  + EGMDP TQVL+++GN L+
Sbjct:     7 WIPLLA-LLAITAACPPEVCVCKWKGGKQTVECGGQQLSNLPEGMDPGTQVLNFSGNALQ 65

Query:    63 TLHNEKFQKMGLVNLQKIYLSRCRISVIDSKAFRGLTNLVDLDFSHNVLQTVPSDTFPDY 122
              L +E+F +M L+NLQKIYLSR ++  I  KAFRGLTNLV+LD S N LQ VPS+TF DY
Sbjct:    66 VLQSERFLRMDLLNLQKIYLSRNQLIRIHEKAFRGLTNLVELDLSENALQNVPSETFQDY 125

Query:   123 PSLMKLTLSGNPIKQIKTGAFQPLSYLVTLELSKCGIEVIEDAAFVGLDSLEWLKLDNNK 182
              SLM+L+LSGNPI+++KT AF+ LS+L TLELS C +E IE+ AFVG+D+LEWL+LD N+
Sbjct:   126 SSLMRLSLSGNPIRELKTSAFRHLSFLTTLELSNCQVERIENEAFVGMDNLEWLRLDGNR 185

Query:   183 ITTISGSNILPTGLHGIDLHHNPWTCDCLLIGLRRWLESTKTPMAIDPICSVPPRLSSVT 242
             I  I G++ILP  LHGI LH N W CDC L+ +  WL +  TP+A +P C  P RL    
Sbjct:   186 IGFIQGTHILPKSLHGISLHSNRWNCDCRLLDIHFWLVNYNTPLAEEPKCMEPARLKGQV 245

Query:   243 IKQLSIDELACEPQITPSTFYLEIQEGKNVSLLCKVSAIPEAKITWLFDGVPIQNESMSA 302
             IK L  ++LAC P+++P + Y E+ EG+N+S+ C V AIPE K+ WLF+G  + N+S+  
Sbjct:   246 IKSLQREQLACLPEVSPQSSYTEVSEGRNMSITCLVRAIPEPKVLWLFNGQVMSNDSLM- 304

Query:   303 SESHAVYSTEE-----GTEIKKSELLIYNSNIDDNGTFVCVAENQAGSTSSNYTIRIVLK 357
                H  Y  +E     G E K+SE+ IYN   +DNGTF CV +N AG+T SNYT+R+++K
Sbjct:   305 DNLHMYYYIDETIGVSGAEEKRSEIFIYNVGAEDNGTFSCVGQNIAGTTFSNYTLRVIIK 364

Query:   358 EENVEVVTVFPLEYV 372
             E  V     FP +Y+
Sbjct:   365 EPPVVNEVSFPRDYM 379


GO:0005887 "integral to plasma membrane" evidence=ISM
GO:0042059 "negative regulation of epidermal growth factor receptor signaling pathway" evidence=IMP
FB|FBgn0015399 kek1 "kekkon-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0028370 kek3 "kekkon-3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0039862 kek6 "kek6" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0031016 kek5 "kekkon5" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0032484 kek4 "kekkon4" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-496 lrrc24 "leucine rich repeat containing 24" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q50LG9 LRRC24 "Leucine-rich repeat-containing protein 24" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:3605040 Lrrc24 "leucine rich repeat containing 24" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1P2C4 LRRC4C "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query767
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-13
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-13
pfam0767990 pfam07679, I-set, Immunoglobulin I-set domain 4e-12
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-11
cd0009674 cd00096, Ig, Immunoglobulin domain 2e-10
smart0040863 smart00408, IGc2, Immunoglobulin C-2 Type 3e-10
smart0041085 smart00410, IG_like, Immunoglobulin like 4e-09
smart0040985 smart00409, IG, Immunoglobulin 4e-09
cd0573095 cd05730, Ig3_NCAM-1_like, Third immunoglobulin (Ig 2e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-08
cd0575982 cd05759, Ig2_KIRREL3-like, Second immunoglobulin ( 1e-06
cd0497792 cd04977, Ig1_NCAM-1_like, First immunoglobulin (Ig 1e-06
pfam1389580 pfam13895, Ig_2, Immunoglobulin domain 3e-06
cd0572985 cd05729, Ig2_FGFR_like, Second immunoglobulin (Ig) 4e-06
cd0572885 cd05728, Ig4_Contactin-2-like, Fourth Ig domain of 7e-06
cd0576581 cd05765, Ig_3, Subgroup of the immunoglobulin (Ig) 1e-05
cd0574669 cd05746, Ig4_Peroxidasin, Fourth immunoglobulin (I 3e-05
pfam13306128 pfam13306, LRR_5, Leucine rich repeats (6 copies) 9e-05
cd0574874 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like d 1e-04
cd0572486 cd05724, Ig2_Robo, Second immunoglobulin (Ig)-like 2e-04
cd0574792 cd05747, Ig5_Titin_like, M5, fifth immunoglobulin 2e-04
cd0573792 cd05737, Ig_Myomesin_like_C, C-temrinal immunoglob 4e-04
cd0497876 cd04978, Ig4_L1-NrCAM_like, Fourth immunoglobulin 4e-04
cd0497290 cd04972, Ig_TrkABC_d4, Fourth domain (immunoglobul 4e-04
pfam0004762 pfam00047, ig, Immunoglobulin domain 5e-04
cd0576474 cd05764, Ig_2, Subgroup of the immunoglobulin (Ig) 7e-04
cd0574475 cd05744, Ig_Myotilin_C_like, Immunoglobulin (Ig)-l 8e-04
pfam0820589 pfam08205, C2-set_2, CD80-like C2-set immunoglobul 8e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
cd0573874 cd05738, Ig2_RPTP_IIa_LAR_like, Second immunoglobu 0.001
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.001
cd0496973 cd04969, Ig5_Contactin_like, Fifth Ig domain of co 0.001
cd0586596 cd05865, Ig1_NCAM-1, First immunoglobulin (Ig)-lik 0.001
cd0497085 cd04970, Ig6_Contactin_like, Sixth Ig domain of co 0.001
smart0008251 smart00082, LRRCT, Leucine rich repeat C-terminal 0.001
cd0496791 cd04967, Ig1_Contactin, First Ig domain of contact 0.002
cd0586692 cd05866, Ig1_NCAM-2, First immunoglobulin (Ig)-lik 0.002
cd0576375 cd05763, Ig_1, Subgroup of the immunoglobulin (Ig) 0.002
cd0586776 cd05867, Ig4_L1-CAM_like, Fourth immunoglobulin (I 0.002
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.003
cd0573676 cd05736, Ig2_Follistatin_like, Second immunoglobul 0.003
cd0585682 cd05856, Ig2_FGFRL1-like, Second immunoglobulin (I 0.003
cd0576077 cd05760, Ig2_PTK7, Second immunoglobulin (Ig)-like 0.004
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
 Score = 64.5 bits (158), Expect = 3e-13
 Identities = 27/60 (45%), Positives = 36/60 (60%)

Query: 76  NLQKIYLSRCRISVIDSKAFRGLTNLVDLDFSHNVLQTVPSDTFPDYPSLMKLTLSGNPI 135
           NL+ + LS  R++VI   AF+GL NL  LD S N L ++  + F   PSL  L LSGN +
Sbjct: 1   NLKSLDLSNNRLTVIPDGAFKGLPNLKVLDLSGNNLTSISPEAFSGLPSLRSLDLSGNNL 60


Length = 60

>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|197706 smart00408, IGc2, Immunoglobulin C-2 Type Back     alignment and domain information
>gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like Back     alignment and domain information
>gnl|CDD|214652 smart00409, IG, Immunoglobulin Back     alignment and domain information
>gnl|CDD|143207 cd05730, Ig3_NCAM-1_like, Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|143236 cd05759, Ig2_KIRREL3-like, Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) Back     alignment and domain information
>gnl|CDD|143178 cd04977, Ig1_NCAM-1_like, First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins Back     alignment and domain information
>gnl|CDD|206066 pfam13895, Ig_2, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143206 cd05729, Ig2_FGFR_like, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>gnl|CDD|143205 cd05728, Ig4_Contactin-2-like, Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>gnl|CDD|143242 cd05765, Ig_3, Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>gnl|CDD|143223 cd05746, Ig4_Peroxidasin, Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>gnl|CDD|205486 pfam13306, LRR_5, Leucine rich repeats (6 copies) Back     alignment and domain information
>gnl|CDD|143225 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>gnl|CDD|143201 cd05724, Ig2_Robo, Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>gnl|CDD|143224 cd05747, Ig5_Titin_like, M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>gnl|CDD|143214 cd05737, Ig_Myomesin_like_C, C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>gnl|CDD|143179 cd04978, Ig4_L1-NrCAM_like, Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) Back     alignment and domain information
>gnl|CDD|143173 cd04972, Ig_TrkABC_d4, Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>gnl|CDD|215677 pfam00047, ig, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143241 cd05764, Ig_2, Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>gnl|CDD|143221 cd05744, Ig_Myotilin_C_like, Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin Back     alignment and domain information
>gnl|CDD|219745 pfam08205, C2-set_2, CD80-like C2-set immunoglobulin domain Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|143215 cd05738, Ig2_RPTP_IIa_LAR_like, Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|143170 cd04969, Ig5_Contactin_like, Fifth Ig domain of contactin Back     alignment and domain information
>gnl|CDD|143273 cd05865, Ig1_NCAM-1, First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 Back     alignment and domain information
>gnl|CDD|143171 cd04970, Ig6_Contactin_like, Sixth Ig domain of contactin Back     alignment and domain information
>gnl|CDD|214507 smart00082, LRRCT, Leucine rich repeat C-terminal domain Back     alignment and domain information
>gnl|CDD|143168 cd04967, Ig1_Contactin, First Ig domain of contactin Back     alignment and domain information
>gnl|CDD|143274 cd05866, Ig1_NCAM-2, First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 Back     alignment and domain information
>gnl|CDD|143240 cd05763, Ig_1, Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>gnl|CDD|143275 cd05867, Ig4_L1-CAM_like, Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|143213 cd05736, Ig2_Follistatin_like, Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>gnl|CDD|143264 cd05856, Ig2_FGFRL1-like, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) Back     alignment and domain information
>gnl|CDD|143237 cd05760, Ig2_PTK7, Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 767
KOG4194|consensus873 99.97
KOG4237|consensus498 99.95
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.88
KOG4194|consensus873 99.83
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.57
KOG4237|consensus498 99.49
KOG0444|consensus 1255 99.46
KOG0617|consensus264 99.44
KOG0617|consensus264 99.43
KOG0444|consensus 1255 99.37
KOG0472|consensus565 99.34
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.32
KOG0472|consensus565 99.3
KOG0618|consensus1081 99.29
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.27
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.24
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.23
PLN03150623 hypothetical protein; Provisional 99.2
KOG0618|consensus1081 99.05
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.99
PLN03150623 hypothetical protein; Provisional 98.97
KOG0532|consensus722 98.9
KOG1259|consensus490 98.87
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.86
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.85
KOG0532|consensus722 98.84
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.81
PLN032101153 Resistant to P. syringae 6; Provisional 98.75
PLN032101153 Resistant to P. syringae 6; Provisional 98.75
KOG1259|consensus490 98.73
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.69
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.67
cd0576298 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of 98.57
cd0585188 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig 98.56
KOG1187|consensus361 98.54
KOG3207|consensus505 98.5
cd0574574 Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom 98.49
cd04975101 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma 98.48
cd0586367 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain 98.45
KOG1859|consensus 1096 98.45
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.44
cd0585273 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig 98.42
cd0573588 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down 98.42
cd0589275 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like 98.4
cd0573792 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- 98.4
cd0572885 Ig4_Contactin-2-like Fourth Ig domain of the neura 98.36
cd0585579 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T 98.35
cd05859101 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do 98.35
cd0589486 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card 98.34
cd0586776 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do 98.33
cd0497290 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o 98.33
cd0573095 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom 98.32
cd0497490 Ig3_FGFR Third immunoglobulin (Ig)-like domain of 98.32
cd0496888 Ig3_Contactin_like Third Ig domain of contactin. I 98.3
cd0586997 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o 98.3
cd0585485 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig 98.3
KOG3207|consensus505 98.29
cd0586876 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o 98.29
cd0573296 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom 98.29
cd0574792 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like 98.28
cd0589375 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like 98.28
PF0767990 I-set: Immunoglobulin I-set domain; InterPro: IPR0 98.27
cd0587671 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o 98.26
cd0585785 Ig2_FGFR Second immunoglobulin (Ig)-like domain of 98.25
cd0497671 Ig2_VEGFR Second immunoglobulin (Ig)-like domain o 98.25
cd0572371 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai 98.25
cd0497876 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like 98.24
cd0496973 Ig5_Contactin_like Fifth Ig domain of contactin. I 98.24
cd0587098 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o 98.24
KOG0531|consensus414 98.23
cd0497181 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of 98.22
cd0586470 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain 98.22
KOG4579|consensus177 98.22
cd0574475 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain 98.21
cd0585682 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do 98.2
cd0572569 Ig3_Robo Third immunoglobulin (Ig)-like domain in 98.2
cd0574874 Ig_Titin_like Immunoglobulin (Ig)-like domain of t 98.19
cd0586596 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o 98.18
cd0589192 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like 98.18
cd0574669 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do 98.17
cd0573171 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom 98.15
cd0576077 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of 98.14
cd0574378 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai 98.14
cd07693100 Ig1_Robo First immunoglobulin (Ig)-like domain in 98.13
cd0573969 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li 98.13
cd0575898 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do 98.12
cd0576474 Ig_2 Subgroup of the immunoglobulin (Ig) superfami 98.12
cd0576581 Ig_3 Subgroup of the immunoglobulin (Ig) superfami 98.11
cd0576375 Ig_1 Subgroup of the immunoglobulin (Ig) superfami 98.11
cd0585890 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o 98.11
cd0574091 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai 98.11
KOG0531|consensus414 98.1
cd0572690 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in 98.1
cd0497085 Ig6_Contactin_like Sixth Ig domain of contactin. I 98.1
KOG1909|consensus382 98.1
cd0585385 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig 98.09
KOG1859|consensus 1096 98.05
cd0497379 Ig1_FGFR First immunoglobulin (Ig)-like domain of 98.02
cd0574284 Ig1_VEGFR_like First immunoglobulin (Ig)-like doma 98.01
cd05773109 Ig8_hNephrin_like Eighth immunoglobulin-like domai 98.0
cd0572486 Ig2_Robo Second immunoglobulin (Ig)-like domain in 97.95
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 97.94
KOG1644|consensus233 97.93
cd0573676 Ig2_Follistatin_like Second immunoglobulin (Ig)-li 97.9
cd0573874 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l 97.88
cd0770272 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain 97.88
cd0586184 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like 97.86
cd0589898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain 97.86
cd0497792 Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom 97.86
cd0574981 Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom 97.85
cd0584894 Ig1_Contactin-5 First Ig domain of contactin-5. Ig 97.84
cd0575075 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain 97.83
cd0575694 Ig1_IL1R_like First immunoglobulin (Ig)-like domai 97.83
cd0586692 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o 97.82
cd0585094 Ig1_Contactin-2 First Ig domain of contactin-2. Ig 97.8
cd0572295 Ig1_Neogenin First immunoglobulin (Ig)-like domain 97.79
cd0584993 Ig1_Contactin-1 First Ig domain of contactin-1. Ig 97.77
KOG4579|consensus177 97.77
cd0573479 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain 97.76
cd0572985 Ig2_FGFR_like Second immunoglobulin (Ig)-like doma 97.72
cd0573377 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom 97.69
cd0575485 Ig3_Perlecan_like Third immunoglobulin (Ig)-like d 97.67
cd0587477 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of 97.64
cd0588295 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- 97.62
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.59
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.59
KOG1644|consensus233 97.58
cd0575278 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do 97.55
cd0496791 Ig1_Contactin First Ig domain of contactin. Ig1_Co 97.55
cd0589576 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai 97.54
KOG4658|consensus889 97.52
KOG1026|consensus774 97.52
KOG4658|consensus889 97.52
cd0575792 Ig2_IL1R_like Second immunoglobulin (Ig)-like doma 97.49
cd0770195 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- 97.45
cd0587577 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li 97.44
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.41
cd0586286 Ig1_VEGFR First immunoglobulin (Ig)-like domain of 97.34
KOG1909|consensus382 97.31
KOG3513|consensus 1051 97.3
smart0040863 IGc2 Immunoglobulin C-2 Type. 97.29
cd0587387 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of 97.29
cd0497989 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of 97.29
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.28
cd0571795 Ig1_Necl-1-3_like First (N-terminal) immunoglobuli 97.27
cd05860101 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of 97.22
cd0769094 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I 97.18
KOG3653|consensus534 97.18
PRK15386426 type III secretion protein GogB; Provisional 97.11
cd0575383 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like 97.1
KOG3665|consensus699 97.09
PRK15386426 type III secretion protein GogB; Provisional 97.03
KOG1025|consensus 1177 97.0
KOG2982|consensus418 96.96
cd0584595 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do 96.95
cd0587191 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do 96.87
KOG2739|consensus260 96.87
KOG0196|consensus996 96.85
KOG3513|consensus 1051 96.85
KOG2120|consensus419 96.8
smart0008251 LRRCT Leucine rich repeat C-terminal domain. 96.79
smart0041086 IG_like Immunoglobulin like. IG domains that canno 96.77
smart0040986 IG Immunoglobulin. 96.77
cd0572796 Ig2_Contactin-2-like Second Ig domain of the neura 96.77
PF1389580 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V 96.6
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.58
PF0004764 ig: Immunoglobulin domain The Prosite family only 96.58
KOG2123|consensus388 96.56
cd0575982 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like d 96.54
PF0146228 LRRNT: Leucine rich repeat N-terminal domain; Inte 96.52
PHA02785326 IL-beta-binding protein; Provisional 96.51
KOG4221|consensus 1381 96.5
KOG2982|consensus418 96.46
KOG2739|consensus260 96.45
cd05713100 Ig_MOG_like Immunoglobulin (Ig)-like domain of mye 96.36
smart0001333 LRRNT Leucine rich repeat N-terminal domain. 96.28
cd05879116 Ig_P0 Immunoglobulin (Ig)-like domain of Protein z 96.25
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.22
KOG3665|consensus699 96.13
cd0589795 Ig2_IL1R2_like Second immunoglobulin (Ig)-like dom 96.08
PF1392775 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V 96.08
PHA02826227 IL-1 receptor-like protein; Provisional 96.04
cd0588195 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- 96.02
cd05714106 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho 95.89
KOG2123|consensus388 95.82
cd0588580 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain 95.8
cd05900112 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the 95.77
cd05877106 Ig_LP_like Immunoglobulin (Ig)-like domain of huma 95.75
PHA02826227 IL-1 receptor-like protein; Provisional 95.68
cd0587285 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of 95.67
cd04983109 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V 95.67
KOG2052|consensus513 95.64
cd05880115 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel 95.54
PHA02785326 IL-beta-binding protein; Provisional 95.35
cd05899110 IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma 95.27
cd05878110 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain o 95.21
cd05896104 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like 95.16
cd0575191 Ig1_LILRB1_like First immunoglobulin (Ig)-like dom 95.15
cd05715116 Ig_P0-like Immunoglobulin (Ig)-like domain of Prot 95.11
cd0571898 Ig1_PVR_like First immunoglobulin (Ig) domain of p 95.03
cd0574192 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like d 94.99
cd05888100 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain 94.94
KOG0593|consensus396 94.87
cd0009895 IgC Immunoglobulin Constant domain. IgC: Immunoglo 94.65
cd0577597 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig) 94.64
KOG2120|consensus419 94.35
cd0588699 Ig1_Nectin-1_like First immunoglobulin (Ig) domain 94.33
cd05902110 Ig_Neurocan Immunoglobulin (Ig)-like domain of the 94.26
cd00099105 IgV Immunoglobulin variable domain (IgV). IgV: Imm 94.1
cd05774105 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain 94.08
cd04980106 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa 93.66
cd05901117 Ig_Versican Immunoglobulin (Ig)-like domain of the 93.62
KOG4221|consensus 1381 93.55
cd0498498 IgV_L_lambda Immunoglobulin (Ig) lambda light chai 93.44
cd0584697 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain 93.43
cd04982116 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) dom 93.24
cd0576182 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like 93.11
cd0588796 Ig1_Nectin-3_like First immunoglobulin (Ig) domain 93.09
KOG0663|consensus419 92.74
cd0009674 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) 92.69
PHA02987189 Ig domain OX-2-like protein; Provisional 92.62
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 92.47
cd0571698 Ig_pIgR Immunoglobulin (Ig)-like domain in the pol 92.46
cd07706116 IgV_TCR_delta Immunoglobulin (Ig) variable (V) dom 92.09
PF07686114 V-set: Immunoglobulin V-set domain; InterPro: IPR0 91.78
cd0770583 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain 91.73
PLN03224507 probable serine/threonine protein kinase; Provisio 91.68
PF04478154 Mid2: Mid2 like cell wall stress sensor; InterPro: 91.64
KOG0193|consensus678 91.03
PF01102122 Glycophorin_A: Glycophorin A; InterPro: IPR001195 90.96
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 90.56
KOG0595|consensus429 90.14
cd0571194 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of 90.12
KOG4222|consensus 1281 90.07
KOG0597|consensus 808 89.99
cd0769488 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. 89.95
PF0869340 SKG6: Transmembrane alpha-helix domain; InterPro: 89.94
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 89.64
cd0588483 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain 89.57
KOG0659|consensus318 89.39
PF08374221 Protocadherin: Protocadherin; InterPro: IPR013585 89.37
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 89.34
cd05712119 Ig_Siglec_N Immunoglobulin (Ig) domain at the N te 89.17
PF0820589 C2-set_2: CD80-like C2-set immunoglobulin domain ; 89.04
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 88.88
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 88.77
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 88.76
PTZ0038296 Variant-specific surface protein (VSP); Provisiona 88.72
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 88.66
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 88.48
KOG0658|consensus364 88.47
KOG0574|consensus 502 88.12
cd05720104 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD 88.06
PTZ00284467 protein kinase; Provisional 88.06
KOG0662|consensus292 87.97
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 87.91
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 87.71
KOG0201|consensus 467 87.62
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 87.59
PRK09188365 serine/threonine protein kinase; Provisional 87.54
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 87.43
cd0588382 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain 87.3
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 87.3
cd05771139 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain 87.02
PF15102146 TMEM154: TMEM154 protein family 87.0
KOG0594|consensus323 86.96
cd0588996 Ig1_DNAM-1_like First immunoglobulin (Ig) domain o 86.89
smart0040775 IGc1 Immunoglobulin C-Type. 86.62
KOG0600|consensus 560 86.61
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 86.59
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.55
smart0037026 LRR Leucine-rich repeats, outliers. 86.55
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 86.07
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 86.02
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 85.77
KOG4308|consensus478 85.58
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 85.56
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 85.36
KOG1166|consensus974 85.22
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 85.13
KOG4222|consensus 1281 85.12
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 85.09
KOG0661|consensus 538 84.98
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 84.89
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 84.72
PHA02882294 putative serine/threonine kinase; Provisional 84.71
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 84.6
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 84.51
KOG4236|consensus888 84.22
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 84.19
smart0037026 LRR Leucine-rich repeats, outliers. 83.97
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 83.97
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 83.92
cd04981117 IgV_H Immunoglobulin (Ig) heavy chain (H), variabl 83.72
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 83.65
cd07700107 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD 83.56
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 83.38
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 83.34
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 83.28
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 83.26
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 83.12
PTZ00036440 glycogen synthase kinase; Provisional 83.04
smart0040681 IGv Immunoglobulin V-Type. 82.97
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 82.92
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 82.92
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 82.77
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 82.77
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 82.66
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 82.53
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 82.49
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 82.47
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 82.42
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 82.38
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 82.35
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 82.33
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 82.33
KOG0473|consensus326 82.28
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 82.21
PLN00034353 mitogen-activated protein kinase kinase; Provision 82.2
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 82.18
PTZ00283 496 serine/threonine protein kinase; Provisional 82.16
KOG0577|consensus 948 82.02
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 81.9
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 81.74
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 81.66
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 81.61
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 81.58
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 81.55
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 81.54
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 81.53
PHA03376221 BARF1; Provisional 81.5
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 81.47
cd05755100 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like do 81.46
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 81.43
KOG0591|consensus375 81.42
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 81.4
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 81.25
cd05771139 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain 81.23
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 81.2
KOG1006|consensus361 81.06
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 81.04
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 80.96
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 80.92
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 80.86
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 80.77
cd05772111 IgC_SIRP Signal-regulatory protein (SIRP) immunogl 80.76
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 80.74
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 80.64
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 80.59
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 80.57
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 80.57
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 80.49
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 80.42
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 80.28
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 80.18
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 80.18
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 80.14
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 80.08
>KOG4194|consensus Back     alignment and domain information
Probab=99.97  E-value=1.2e-31  Score=291.40  Aligned_cols=324  Identities=26%  Similarity=0.401  Sum_probs=264.4

Q ss_pred             eeEEEecCCCccccccCC---CCCccEEEeeCCCCCCCCchhhhccCCCCccEEEccCCCCCccCcccccCCCCCCEEEc
Q psy12044         30 KQTVECVNKSLITVVEGM---DPNTQVLDYTGNNLKTLHNEKFQKMGLVNLQKIYLSRCRISVIDSKAFRGLTNLVDLDF  106 (767)
Q Consensus        30 ~~~v~C~~~~L~~iP~~l---~~~L~~L~Ls~N~L~~l~~~~f~~~~L~~L~~L~Ls~N~L~~i~p~~f~~L~~L~~L~L  106 (767)
                      ..+++...+++..+-.+-   +..|+.|+||.|.|..+....+..  .++|+.|+|++|+|+.+.++.|..|..|++|+|
T Consensus       271 me~l~L~~N~l~~vn~g~lfgLt~L~~L~lS~NaI~rih~d~Wsf--tqkL~~LdLs~N~i~~l~~~sf~~L~~Le~LnL  348 (873)
T KOG4194|consen  271 MEHLNLETNRLQAVNEGWLFGLTSLEQLDLSYNAIQRIHIDSWSF--TQKLKELDLSSNRITRLDEGSFRVLSQLEELNL  348 (873)
T ss_pred             cceeecccchhhhhhcccccccchhhhhccchhhhheeecchhhh--cccceeEeccccccccCChhHHHHHHHhhhhcc
Confidence            345666666666665433   467788888888888888777764  678888888888888888888888888888888


Q ss_pred             cCCCCCCCCCCCCCCCCCCcEEECCCCcCccccc---CCcCCCCCccEEeccCCCccccchhhhcCCCCCCeeeccCCcc
Q psy12044        107 SHNVLQTVPSDTFPDYPSLMKLTLSGNPIKQIKT---GAFQPLSYLVTLELSKCGIEVIEDAAFVGLDSLEWLKLDNNKI  183 (767)
Q Consensus       107 s~N~Lt~l~p~~f~~l~~L~~L~Ls~N~l~~l~~---~~~~~l~~L~~L~Ls~N~L~~i~~~~~~~l~~L~~L~Ls~N~L  183 (767)
                      +.|+|+.+-..+|..+.+|+.|+|++|.|+..+.   ..|.+|++|+.|+|.+|+|+.++..+|.++..|+.|||.+|.|
T Consensus       349 s~Nsi~~l~e~af~~lssL~~LdLr~N~ls~~IEDaa~~f~gl~~LrkL~l~gNqlk~I~krAfsgl~~LE~LdL~~Nai  428 (873)
T KOG4194|consen  349 SHNSIDHLAEGAFVGLSSLHKLDLRSNELSWCIEDAAVAFNGLPSLRKLRLTGNQLKSIPKRAFSGLEALEHLDLGDNAI  428 (873)
T ss_pred             cccchHHHHhhHHHHhhhhhhhcCcCCeEEEEEecchhhhccchhhhheeecCceeeecchhhhccCcccceecCCCCcc
Confidence            8888888888888889999999999999887664   3578899999999999999999999999999999999999999


Q ss_pred             ccccCCCCCCCCcccccCCCCCCCchhhhhhhhhhhccCCCCCccCCCCCCCCCCCCCcccccccccccCC----CCCCC
Q psy12044        184 TTISGSNILPTGLHGIDLHHNPWTCDCLLIGLRRWLESTKTPMAIDPICSVPPRLSSVTIKQLSIDELACE----PQITP  259 (767)
Q Consensus       184 t~ip~~~~~~~~L~~L~Ls~N~l~C~c~l~~l~~~l~~~~~~~~~~~~C~~p~~l~g~~i~~l~~~~l~C~----P~i~~  259 (767)
                      .+|.+..|....|+.|.+..-.|.|||.+.|+.+|+.....+......|+.|+.+.++.+..++..++.|.    |.+..
T Consensus       429 aSIq~nAFe~m~Lk~Lv~nSssflCDCql~Wl~qWl~~~~lq~sv~a~CayPe~Lad~~i~svd~~~lvC~DspkpqI~~  508 (873)
T KOG4194|consen  429 ASIQPNAFEPMELKELVMNSSSFLCDCQLKWLAQWLYRRKLQSSVIAKCAYPEPLADQSIVSVDTANLVCDDSPKPQIVT  508 (873)
T ss_pred             eeecccccccchhhhhhhcccceEEeccHHHHHHHHHhcccccceeeeccCCcccccceeEeechhhceecCCCCcceec
Confidence            99998888877999999999999999999999999999988877888999999999999999999999998    55556


Q ss_pred             Cccceeecccccccccccccc--cCCCcEEEeecCeeccCCCcccccccceee----cccCcceeeeEEEEeeeccCCCC
Q psy12044        260 STFYLEIQEGKNVSLLCKVSA--IPEAKITWLFDGVPIQNESMSASESHAVYS----TEEGTEIKKSELLIYNSNIDDNG  333 (767)
Q Consensus       260 ~~~~~~v~~G~~vsL~C~a~g--~P~p~itW~~~g~~l~~~s~~~~~~~~~~~----~~~g~~~~~s~L~I~nvs~sD~G  333 (767)
                      .+..+....|.++++.|.+.+  .....+.|.++......... .+..+....    ...+..++.+.|++.|+...|+|
T Consensus       509 qPe~~~al~g~nirftC~a~sssasplsi~WR~dnevq~rv~v-ed~a~~~~q~r~~~~~e~~~~~~~L~L~nVt~td~g  587 (873)
T KOG4194|consen  509 QPETVSALIGENIRFTCNAYSSSASPLSIEWRKDNEVQPRVDV-EDFATFLSQNRNGTFGEREEYTAILHLDNVTFTDEG  587 (873)
T ss_pred             CchHhhhhhccceEEEEEeccCCCCCceeEeeeccccCcccch-hcchhhhhhhccCccchhhhhhheeeeeeeecccCc
Confidence            666777889999999999987  45668999986653222111 111111111    11334556788999999999999


Q ss_pred             ceeEeeccCCCCccc-ceEEEEEe
Q psy12044        334 TFVCVAENQAGSTSS-NYTIRIVL  356 (767)
Q Consensus       334 tY~CvA~N~~G~s~~-s~sL~V~~  356 (767)
                      .|.|++.|.+|+..+ .+.+.|..
T Consensus       588 rYQCVvtN~FGStysqk~KltV~~  611 (873)
T KOG4194|consen  588 RYQCVVTNHFGSTYSQKAKLTVNQ  611 (873)
T ss_pred             eEEEEEecccCcchhheeEEEeec
Confidence            999999999999987 46666654



>KOG4237|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) Back     alignment and domain information
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 Back     alignment and domain information
>KOG1187|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins Back     alignment and domain information
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 Back     alignment and domain information
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin Back     alignment and domain information
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB Back     alignment and domain information
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha Back     alignment and domain information
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) Back     alignment and domain information
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd04968 Ig3_Contactin_like Third Ig domain of contactin Back     alignment and domain information
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) Back     alignment and domain information
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins Back     alignment and domain information
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin Back     alignment and domain information
>PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) Back     alignment and domain information
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) Back     alignment and domain information
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin Back     alignment and domain information
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin Back     alignment and domain information
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) Back     alignment and domain information
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 Back     alignment and domain information
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) Back     alignment and domain information
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 Back     alignment and domain information
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins Back     alignment and domain information
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) Back     alignment and domain information
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins Back     alignment and domain information
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin Back     alignment and domain information
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) Back     alignment and domain information
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) Back     alignment and domain information
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) Back     alignment and domain information
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins Back     alignment and domain information
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) Back     alignment and domain information
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 Back     alignment and domain information
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) Back     alignment and domain information
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 Back     alignment and domain information
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 Back     alignment and domain information
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins Back     alignment and domain information
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) Back     alignment and domain information
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd04967 Ig1_Contactin First Ig domain of contactin Back     alignment and domain information
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG1026|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG3513|consensus Back     alignment and domain information
>smart00408 IGc2 Immunoglobulin C-2 Type Back     alignment and domain information
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D Back     alignment and domain information
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) Back     alignment and domain information
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) Back     alignment and domain information
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>KOG3653|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1025|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>KOG3513|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>smart00082 LRRCT Leucine rich repeat C-terminal domain Back     alignment and domain information
>smart00410 IG_like Immunoglobulin like Back     alignment and domain information
>smart00409 IG Immunoglobulin Back     alignment and domain information
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) Back     alignment and domain information
>PF01462 LRRNT: Leucine rich repeat N-terminal domain; InterPro: IPR000372 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) Back     alignment and domain information
>smart00013 LRRNT Leucine rich repeat N-terminal domain Back     alignment and domain information
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2) Back     alignment and domain information
>PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) Back     alignment and domain information
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan Back     alignment and domain information
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B Back     alignment and domain information
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins Back     alignment and domain information
>KOG2052|consensus Back     alignment and domain information
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain Back     alignment and domain information
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG) Back     alignment and domain information
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) Back     alignment and domain information
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins Back     alignment and domain information
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins Back     alignment and domain information
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins Back     alignment and domain information
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>cd00098 IgC Immunoglobulin Constant domain Back     alignment and domain information
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins Back     alignment and domain information
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan Back     alignment and domain information
>cd00099 IgV Immunoglobulin variable domain (IgV) Back     alignment and domain information
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain Back     alignment and domain information
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain Back     alignment and domain information
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins Back     alignment and domain information
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain Back     alignment and domain information
>cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively) Back     alignment and domain information
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins Back     alignment and domain information
>KOG0663|consensus Back     alignment and domain information
>cd00096 Ig Immunoglobulin domain Back     alignment and domain information
>PHA02987 Ig domain OX-2-like protein; Provisional Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) Back     alignment and domain information
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain Back     alignment and domain information
>PF07686 V-set: Immunoglobulin V-set domain; InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region Back     alignment and domain information
>KOG0193|consensus Back     alignment and domain information
>PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>KOG0595|consensus Back     alignment and domain information
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ] Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>PF08374 Protocadherin: Protocadherin; InterPro: IPR013585 The structure of protocadherins is similar to that of classic cadherins (IPR002126 from INTERPRO), but they also have some unique features associated with the cytoplasmic domains Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins) Back     alignment and domain information
>PF08205 C2-set_2: CD80-like C2-set immunoglobulin domain ; InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>PTZ00382 Variant-specific surface protein (VSP); Provisional Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0658|consensus Back     alignment and domain information
>KOG0574|consensus Back     alignment and domain information
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>KOG0662|consensus Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain Back     alignment and domain information
>PF15102 TMEM154: TMEM154 protein family Back     alignment and domain information
>KOG0594|consensus Back     alignment and domain information
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins Back     alignment and domain information
>smart00407 IGc1 Immunoglobulin C-Type Back     alignment and domain information
>KOG0600|consensus Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>KOG1166|consensus Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>smart00406 IGv Immunoglobulin V-Type Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0577|consensus Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>PHA03376 BARF1; Provisional Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>KOG1006|consensus Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query767
3zyj_A440 Netring1 In Complex With Ngl1 Length = 440 6e-25
3zyi_A452 Netring2 In Complex With Ngl2 Length = 452 6e-23
3zyo_A411 Crystal Structure Of The N-Terminal Leucine Rich Re 3e-21
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 2e-18
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 2e-18
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 1e-17
2xot_A361 Crystal Structure Of Neuronal Leucine Rich Repeat P 2e-17
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 2e-16
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 5e-16
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 8e-16
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 6e-13
3zyn_A321 Crystal Structure Of The N-Terminal Leucine Rich Re 9e-16
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 1e-15
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 4e-15
2v70_A220 Third Lrr Domain Of Human Slit2 Length = 220 5e-14
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 5e-13
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 9e-13
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 9e-13
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 1e-11
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 1e-11
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 2e-11
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 7e-11
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 7e-11
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 7e-11
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 7e-11
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 8e-11
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 9e-11
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 1e-10
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 1e-10
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 1e-10
1w8a_A192 Third Lrr Domain Of Drosophila Slit Length = 192 1e-10
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 3e-10
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 3e-10
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 3e-10
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 9e-05
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 3e-10
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 4e-10
2v9s_A220 Second Lrr Domain Of Human Slit2 Length = 220 7e-10
2v9t_B220 Complex Between The Second Lrr Domain Of Slit2 And 7e-10
2z80_A353 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 7e-10
2z7x_A549 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 8e-10
3t6q_A606 Crystal Structure Of Mouse Rp105MD-1 Complex Length 1e-09
3g3a_A178 Structure Of A Lamprey Variable Lymphocyte Receptor 1e-08
2r9u_A174 Crystal Structure Of Lamprey Variable Lymphocyte Re 1e-08
3rg1_A612 Crystal Structure Of The Rp105MD-1 Complex Length = 2e-08
3rg1_A612 Crystal Structure Of The Rp105MD-1 Complex Length = 1e-04
3g39_A170 Structure Of A Lamprey Variable Lymphocyte Receptor 3e-08
1qz1_A291 Crystal Structure Of The Ig 1-2-3 Fragment Of Ncam 4e-08
3oja_B597 Crystal Structure Of Lrim1APL1C COMPLEX Length = 59 4e-08
3o6n_A390 Crystal Structure Of Apl1 Leucine-Rich Repeat Domai 5e-08
3g3b_A170 Structure Of A Lamprey Variable Lymphocyte Receptor 5e-08
2dm3_A110 Solution Structure Of The Second Ig Domain Of Human 2e-07
3ul8_A279 Crystal Structure Of The Tv3 Mutant V134l Length = 2e-07
3ula_A279 Crystal Structure Of The Tv3 Mutant F63w-Md-2-Erito 2e-07
3ul7_A278 Crystal Structure Of The Tv3 Mutant F63w Length = 2 2e-07
2z62_A276 Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 A 2e-07
3b2d_A603 Crystal Structure Of Human Rp105MD-1 Complex Length 5e-07
3b2d_A603 Crystal Structure Of Human Rp105MD-1 Complex Length 9e-06
3ul9_A278 Structure Of The Tv3 Mutant M41e Length = 278 6e-07
3cig_A697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 4e-06
4arn_A279 Crystal Structure Of The N-terminal Domain Of Droso 4e-06
3j0a_A844 Homology Model Of Human Toll-Like Receptor 5 Fitted 5e-06
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 5e-06
2yr3_A99 Solution Structure Of The Fourth Ig-Like Domain Fro 6e-06
2a0z_A705 The Molecular Structure Of Toll-like Receptor 3 Lig 7e-06
3ulu_A694 Structure Of Quaternary Complex Of Human Tlr3ecd Wi 7e-06
3v44_A407 Crystal Structure Of The N-Terminal Fragment Of Zeb 8e-06
1ziw_A680 Human Toll-Like Receptor 3 Extracellular Domain Str 8e-06
3vq1_A606 Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLE 1e-05
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 1e-05
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 2e-04
2z64_A599 Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Comp 1e-05
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 1e-05
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 3e-04
3twi_D179 Variable Lymphocyte Receptor Recognition Of The Imm 2e-05
1ie5_A107 Nmr Structure Of The Third Immunoglobulin Domain Fr 2e-05
2vra_A208 Drosophila Robo Ig1-2 (Monoclinic Form) Length = 20 2e-05
2vr9_A217 Drosophila Robo Ig1-2 (Tetragonal Form) Length = 21 2e-05
2y25_A317 Crystal Structure Of The Myomesin Domains My11-My13 8e-05
2kdg_A100 Solution Structure Of The 1st Ig Domain Of Myotilin 1e-04
3rfe_A130 Crystal Structure Of Glycoprotein Gpib Ectodomain L 4e-04
2r15_A212 Crystal Structure Of The Myomesin Domains 12 And 13 4e-04
3sb4_A329 Crystal Structure Of A Hypothetical Leucine Rich Re 5e-04
3rez_A129 Glycoprotein Gpib Variant Length = 129 6e-04
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure

Iteration: 1

Score = 112 bits (281), Expect = 6e-25, Method: Compositional matrix adjust. Identities = 101/409 (24%), Positives = 163/409 (39%), Gaps = 84/409 (20%) Query: 18 CPTSCICKWKGGKQTVECVNKSLITVVEGMDPNTQVLDYTGNNLKTLHNEKFQKM----- 72 CP+ C C + K V CV K+L V +G+ NT++L+ N ++ + F+ + Sbjct: 35 CPSVCSCSNQFSK--VICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEI 92 Query: 73 -----------------GLVNLQKIYLSRCRISVIDSKAFRGLTNLVDLDFSHNVLQTVP 115 GL NL + L R++ I + AF L+ L +L +N ++++P Sbjct: 93 LQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIP 152 Query: 116 SDTFPDYPSLMKLTL--------------------------------------------- 130 S F PSL +L L Sbjct: 153 SYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDEL 212 Query: 131 --SGNPIKQIKTGAFQPLSYLVTLELSKCGIEVIEDAAFVGLDSLEWLKLDNNKITTISG 188 SGN + I+ G+FQ L +L L + + I+VIE AF L SL + L +N +T + Sbjct: 213 DLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPH 272 Query: 189 SNILPT-GLHGIDLHHNPWTCDCLLIGLRRWLESTK-TPMAIDPICSVPPRLSSVTIKQL 246 P L I LHHNPW C+C ++ L W++ + A C+ PP L I +L Sbjct: 273 DLFTPLHHLERIHLHHNPWNCNCDILWLSWWIKDMAPSNTACCARCNTPPNLKGRYIGEL 332 Query: 247 SIDELAC-EPQITPSTFYLEIQEGKNVSLLCKVSAIPEAKITWLFDGVPIQNESMSASES 305 + C P I L + EG L C+ S ++W+ + + Sbjct: 333 DQNYFTCYAPVIVEPPADLNVTEGMAAELKCRAST-SLTSVSWITPNGTVM--------T 383 Query: 306 HAVYSTEEGTEIKKSELLIYNSNIDDNGTFVCVAENQAGSTSSNYTIRI 354 H Y + L N + D G + C+ N G+T+++ T+ + Sbjct: 384 HGAYKVRIAV-LSDGTLNFTNVTVQDTGMYTCMVSNSVGNTTASATLNV 431
>pdb|3ZYI|A Chain A, Netring2 In Complex With Ngl2 Length = 452 Back     alignment and structure
>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|2XOT|A Chain A, Crystal Structure Of Neuronal Leucine Rich Repeat Protein Amigo-1 Length = 361 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2V70|A Chain A, Third Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|1W8A|A Chain A, Third Lrr Domain Of Drosophila Slit Length = 192 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|2V9S|A Chain A, Second Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|2V9T|B Chain B, Complex Between The Second Lrr Domain Of Slit2 And The First Ig Domain From Robo1 Length = 220 Back     alignment and structure
>pdb|2Z80|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 353 Back     alignment and structure
>pdb|2Z7X|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 549 Back     alignment and structure
>pdb|3T6Q|A Chain A, Crystal Structure Of Mouse Rp105MD-1 Complex Length = 606 Back     alignment and structure
>pdb|3G3A|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor In Complex With A Protein Antigen Length = 178 Back     alignment and structure
>pdb|2R9U|A Chain A, Crystal Structure Of Lamprey Variable Lymphocyte Receptor 2913 Ectodomain Length = 174 Back     alignment and structure
>pdb|3RG1|A Chain A, Crystal Structure Of The Rp105MD-1 Complex Length = 612 Back     alignment and structure
>pdb|3RG1|A Chain A, Crystal Structure Of The Rp105MD-1 Complex Length = 612 Back     alignment and structure
>pdb|3G39|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor Length = 170 Back     alignment and structure
>pdb|1QZ1|A Chain A, Crystal Structure Of The Ig 1-2-3 Fragment Of Ncam Length = 291 Back     alignment and structure
>pdb|3OJA|B Chain B, Crystal Structure Of Lrim1APL1C COMPLEX Length = 597 Back     alignment and structure
>pdb|3O6N|A Chain A, Crystal Structure Of Apl1 Leucine-Rich Repeat Domain Length = 390 Back     alignment and structure
>pdb|3G3B|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor Mutant In Complex With A Protein Antigen Length = 170 Back     alignment and structure
>pdb|2DM3|A Chain A, Solution Structure Of The Second Ig Domain Of Human Palladin Length = 110 Back     alignment and structure
>pdb|3UL8|A Chain A, Crystal Structure Of The Tv3 Mutant V134l Length = 279 Back     alignment and structure
>pdb|3ULA|A Chain A, Crystal Structure Of The Tv3 Mutant F63w-Md-2-Eritoran Complex Length = 279 Back     alignment and structure
>pdb|3UL7|A Chain A, Crystal Structure Of The Tv3 Mutant F63w Length = 278 Back     alignment and structure
>pdb|2Z62|A Chain A, Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 276 Back     alignment and structure
>pdb|3B2D|A Chain A, Crystal Structure Of Human Rp105MD-1 Complex Length = 603 Back     alignment and structure
>pdb|3B2D|A Chain A, Crystal Structure Of Human Rp105MD-1 Complex Length = 603 Back     alignment and structure
>pdb|3UL9|A Chain A, Structure Of The Tv3 Mutant M41e Length = 278 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|4ARN|A Chain A, Crystal Structure Of The N-terminal Domain Of Drosophila Toll Receptor Length = 279 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|2YR3|A Chain A, Solution Structure Of The Fourth Ig-Like Domain From Myosin Light Chain Kinase, Smooth Muscle Length = 99 Back     alignment and structure
>pdb|2A0Z|A Chain A, The Molecular Structure Of Toll-like Receptor 3 Ligand Binding Domain Length = 705 Back     alignment and structure
>pdb|3ULU|A Chain A, Structure Of Quaternary Complex Of Human Tlr3ecd With Three Fabs (Form1) Length = 694 Back     alignment and structure
>pdb|3V44|A Chain A, Crystal Structure Of The N-Terminal Fragment Of Zebrafish Tlr5 Length = 407 Back     alignment and structure
>pdb|1ZIW|A Chain A, Human Toll-Like Receptor 3 Extracellular Domain Structure Length = 680 Back     alignment and structure
>pdb|3VQ1|A Chain A, Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLEX Length = 606 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|2Z64|A Chain A, Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Complex Length = 599 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|3TWI|D Chain D, Variable Lymphocyte Receptor Recognition Of The Immunodominant Glycoprotein Of Bacillus Anthracis Spores Length = 179 Back     alignment and structure
>pdb|1IE5|A Chain A, Nmr Structure Of The Third Immunoglobulin Domain From The Neural Cell Adhesion Molecule Length = 107 Back     alignment and structure
>pdb|2VRA|A Chain A, Drosophila Robo Ig1-2 (Monoclinic Form) Length = 208 Back     alignment and structure
>pdb|2VR9|A Chain A, Drosophila Robo Ig1-2 (Tetragonal Form) Length = 217 Back     alignment and structure
>pdb|2Y25|A Chain A, Crystal Structure Of The Myomesin Domains My11-My13 Length = 317 Back     alignment and structure
>pdb|2KDG|A Chain A, Solution Structure Of The 1st Ig Domain Of Myotilin Length = 100 Back     alignment and structure
>pdb|3RFE|A Chain A, Crystal Structure Of Glycoprotein Gpib Ectodomain Length = 130 Back     alignment and structure
>pdb|2R15|A Chain A, Crystal Structure Of The Myomesin Domains 12 And 13 Length = 212 Back     alignment and structure
>pdb|3SB4|A Chain A, Crystal Structure Of A Hypothetical Leucine Rich Repeat Protein (Bt_1240) From Bacteroides Thetaiotaomicron Vpi-5482 At 1.99 A Resolution Length = 329 Back     alignment and structure
>pdb|3REZ|A Chain A, Glycoprotein Gpib Variant Length = 129 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query767
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-90
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-62
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-49
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-34
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-62
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-34
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-60
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-48
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-55
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-50
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-28
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-47
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-46
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-41
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-40
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-39
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-35
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-27
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-26
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-26
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-26
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-21
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-39
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-39
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-37
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-30
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-39
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-29
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-38
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-27
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-37
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-37
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-30
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-37
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-34
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-36
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-28
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-18
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-09
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 8e-36
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-29
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-29
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-35
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-32
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-23
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-23
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-18
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-34
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-33
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-33
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-32
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-28
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-18
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-33
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-31
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-29
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-23
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-22
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-32
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-29
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-28
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-22
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-30
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-28
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-27
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-26
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-29
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-27
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-29
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-26
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-26
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-23
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-22
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-19
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-16
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-22
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-22
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-19
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-19
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-17
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-21
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-19
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 9e-21
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-20
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-19
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-20
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-20
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-20
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-07
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-19
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 8e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-17
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-17
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-15
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-19
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-19
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-18
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-15
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 5e-18
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-11
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 4e-17
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-17
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 1e-16
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 2e-16
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 2e-16
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 3e-12
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 5e-12
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 1e-11
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 4e-11
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 2e-10
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 8e-08
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 1e-07
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 2e-16
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 1e-09
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 2e-16
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 1e-14
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 4e-16
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 4e-16
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 5e-16
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 6e-06
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 8e-16
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 8e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-12
1wwb_X103 Protein (brain derived neurotrophic factor recepto 1e-15
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 2e-15
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 7e-11
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 2e-15
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 2e-15
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 2e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-06
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 3e-15
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 8e-13
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 2e-08
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 3e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-05
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 6e-15
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 6e-15
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 9e-15
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 7e-15
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 7e-15
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 8e-15
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 8e-15
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 1e-14
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 1e-14
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 2e-13
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 1e-14
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 4e-14
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 7e-13
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 2e-14
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 4e-14
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 2e-14
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 2e-14
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 2e-14
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 1e-13
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 4e-13
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 5e-13
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 6e-13
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 2e-14
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 2e-11
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 2e-14
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 2e-13
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 2e-14
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 7e-12
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 4e-14
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 6e-13
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 4e-14
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 1e-13
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 4e-14
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 4e-14
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 7e-11
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 5e-14
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 6e-14
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 7e-14
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 5e-13
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 8e-14
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 1e-11
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 8e-14
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 6e-11
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 9e-14
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 4e-12
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 9e-14
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 2e-12
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 2e-10
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 2e-09
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 3e-09
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 1e-08
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 8e-08
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 1e-13
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 1e-12
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 3e-09
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 1e-13
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 2e-13
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 3e-12
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 1e-11
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 2e-13
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 2e-09
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 2e-13
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 8e-11
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 3e-08
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 2e-13
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-13
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-13
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-10
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 3e-13
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 6e-12
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 4e-13
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 1e-12
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 4e-11
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 4e-13
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 2e-11
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 4e-13
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 4e-13
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 2e-10
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 5e-13
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 8e-11
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 1e-10
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 1e-07
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 5e-13
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 3e-11
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 4e-11
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 3e-08
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 7e-08
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 2e-07
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 2e-07
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 5e-13
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 9e-12
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 3e-10
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 4e-10
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 3e-06
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-13
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-09
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-05
2ens_A96 Advanced glycosylation END product-specific recept 6e-13
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 6e-13
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 7e-13
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 7e-13
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 9e-13
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 2e-11
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 4e-11
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 5e-08
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 9e-13
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 2e-11
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 4e-11
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 2e-08
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 1e-12
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 3e-12
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 5e-12
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 9e-08
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 1e-05
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 1e-12
1nn8_R302 CD155 antigen, poliovirus receptor; icosahedral vi 1e-12
1nn8_R302 CD155 antigen, poliovirus receptor; icosahedral vi 3e-10
1nn8_R302 CD155 antigen, poliovirus receptor; icosahedral vi 3e-05
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 2e-12
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 2e-10
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 5e-08
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 2e-07
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 2e-12
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 2e-12
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 1e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-09
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 3e-12
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 9e-11
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 3e-09
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 9e-08
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 4e-12
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 6e-11
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 2e-10
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 2e-05
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 4e-12
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 4e-12
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 2e-11
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 4e-12
2eo1_A102 OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 5e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-10
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 6e-12
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 9e-12
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 7e-12
1waa_A93 Titin; metal binding protein, calmodulin-binding, 7e-12
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 9e-12
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 2e-07
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 5e-07
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 1e-11
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 1e-07
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 1e-11
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 1e-08
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 2e-11
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 2e-11
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 3e-11
1he7_A126 High affinity nerve growth factor receptor; transf 2e-11
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 2e-11
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 2e-08
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 2e-11
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 2e-11
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 8e-11
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 2e-11
3s35_X122 Vascular endothelial growth factor receptor 2; ant 2e-11
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 2e-11
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 2e-08
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 5e-07
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 2e-11
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 3e-11
3mjg_X289 Beta-type platelet-derived growth factor receptor; 3e-11
3mjg_X289 Beta-type platelet-derived growth factor receptor; 2e-08
3mjg_X289 Beta-type platelet-derived growth factor receptor; 4e-06
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 3e-11
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 7e-07
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 3e-11
3so5_A112 LIG-3, leucine-rich repeats and immunoglobulin-lik 3e-11
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 3e-11
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 4e-04
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 4e-11
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 3e-09
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 4e-07
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 3e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-08
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 4e-11
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 8e-10
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 3e-08
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 4e-11
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 5e-11
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 6e-11
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 8e-11
2v9t_A117 Roundabout homolog 1; structural protein-receptor 1e-10
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 1e-10
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 2e-10
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 2e-10
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 4e-08
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 2e-07
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 4e-10
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 4e-10
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 4e-10
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 6e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-09
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 7e-10
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 2e-04
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 3e-04
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 8e-10
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 2e-06
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-10
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-09
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 2e-09
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 2e-09
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 2e-08
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 3e-09
1gl4_B98 Basement membrane-specific heparan sulfate proteog 4e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-08
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 5e-09
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 4e-06
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 6e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-09
2ch8_A201 BARF1, P33, 33 kDa early protein; viral protein, i 1e-08
2ch8_A201 BARF1, P33, 33 kDa early protein; viral protein, i 4e-05
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 1e-08
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 2e-04
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 2e-08
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 2e-08
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 4e-04
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 2e-08
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 4e-08
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 4e-08
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 3e-06
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 5e-08
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 1e-05
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 7e-08
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 8e-08
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 1e-06
2fbo_J250 V1V2;, variable region-containing chitin-binding p 9e-08
2edn_A118 Myosin-binding protein C, fast-type; beta-sandwich 1e-07
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 2e-07
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 7e-04
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 9e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-06
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 2e-07
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 3e-04
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 2e-07
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 3e-07
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 4e-07
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 5e-07
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 7e-05
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 2e-04
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 2e-04
3eow_R221 Poliovirus receptor; immunoglobulin super family, 5e-07
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 7e-07
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 8e-06
2pet_A231 Lutheran blood group glycoprotein; immunoglobulin 8e-07
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 1e-06
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 2e-06
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 7e-05
3shs_A304 HOC head outer capsid protein; immunoglobulin-like 3e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-04
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 7e-06
2e6q_A112 Obscurin-like protein 1; IG-like domain, structura 1e-05
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 1e-05
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 2e-05
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 2e-05
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 3e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-04
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 8e-05
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 7e-04
2zg1_A214 Sialic acid-binding IG-like lectin 5; siglec-5 inh 1e-04
3nvq_A590 Semaphorin-7A; beta-propeller, signaling, signalin 1e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 1e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-04
3rbg_A124 Cytotoxic and regulatory T-cell molecule; IGV, crt 2e-04
1gsm_A210 Madcam-1, mucosal addressin cell adhesion molecule 2e-04
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 3e-04
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 3e-04
1olz_A663 Semaphorin 4D; developmental protein, CD100, beta- 3e-04
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 4e-04
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 9e-04
1xiw_A105 T-cell surface glycoprotein CD3 epsilon chain; CD3 5e-04
2wng_A327 Tyrosine-protein phosphatase non-receptor type sub 6e-04
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
 Score =  287 bits (735), Expect = 2e-90
 Identities = 80/351 (22%), Positives = 136/351 (38%), Gaps = 33/351 (9%)

Query: 15  VSACPTSCICKWKGGKQTVECVNKSLITVVEGMDPNTQVLDYTGNNLKTLHNEKFQKMGL 74
           V +CP +C+C        + C  + L  V + +   T +LD + NNL  L  E      L
Sbjct: 9   VVSCPANCLC----ASNILSCSKQQLPNVPQSLPSYTALLDLSHNNLSRLRAEWTPT-RL 63

Query: 75  VNLQKIYLSRCRISVIDSKAFRGLTNLVDLDFSHNVLQTVPSDTFPDYPSLMKLTLSGNP 134
            NL  + LS   ++ I S+AF  + NL  LD S N L T+    F D  +L  L L  N 
Sbjct: 64  TNLHSLLLSHNHLNFISSEAFVPVPNLRYLDLSSNHLHTLDEFLFSDLQALEVLLLYNNH 123

Query: 135 IKQIKTGAFQPLSYLVTLELSKCGIEVIEDAAFVGLD---SLEWLKLDNNKITTISGSNI 191
           I  +   AF+ ++ L  L LS+  I           +    L  L L +NK+  +  +++
Sbjct: 124 IVVVDRNAFEDMAQLQKLYLSQNQISRFPVELIKDGNKLPKLMLLDLSSNKLKKLPLTDL 183

Query: 192 LPT---GLHGIDLHHNPWTCDCLLIGLRRWLESTKTPMAID----PICSVPPRLSSVTIK 244
                   +G+ LH+NP  CDC L  L    +  +    +D      C    +L ++   
Sbjct: 184 QKLPAWVKNGLYLHNNPLECDCKLYQLFSHWQYRQLSSVMDFQEDLYCMHSKKLHNIF-- 241

Query: 245 QLSIDELACEPQITPSTFYLEIQEGKNVSLLCKVSAIPEAKITWLFDGVPIQNESMSASE 304
             S+D   C           E   G  +++ C        K+        + ++      
Sbjct: 242 --SLDFFNCSE---YKESAWEAHLGDTLTIRCDTKQQGMTKVWVSPSNEQVLSQG----- 291

Query: 305 SHAVYSTEEGTEIKKSELLIYNSNIDDNGTFVCVAENQAGSTSSNYTIRIV 355
           S+   S   G       L      ++D G + C A  +  + + +  +++ 
Sbjct: 292 SNGSVSVRNGD------LFFKKVQVEDGGVYTCYAMGETFNETLSVELKVY 336


>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 Back     alignment and structure
>1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 Back     alignment and structure
>1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 104 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 Back     alignment and structure
>2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Length = 112 Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 Back     alignment and structure
>2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Length = 222 Back     alignment and structure
>3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Length = 202 Back     alignment and structure
>3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Length = 202 Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 Back     alignment and structure
>2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Length = 180 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Length = 231 Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 Back     alignment and structure
>2e6q_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Length = 171 Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Length = 201 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Length = 329 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Length = 329 Back     alignment and structure
>2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A Length = 214 Back     alignment and structure
>3nvq_A Semaphorin-7A; beta-propeller, signaling, signaling protein-protein binding; HET: NAG NDG; 2.40A {Homo sapiens} Length = 590 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Length = 124 Back     alignment and structure
>1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* Length = 210 Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>1olz_A Semaphorin 4D; developmental protein, CD100, beta-propeller, PSI domain, IG-like domain, extracellular receptor, neurogenesis; 2.0A {Homo sapiens} SCOP: b.1.1.4 b.69.12.1 g.16.2.1 PDB: 3ol2_A* Length = 663 Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Length = 193 Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Length = 193 Back     alignment and structure
>1xiw_A T-cell surface glycoprotein CD3 epsilon chain; CD3-epsilon, CD3-delta, UCHT1-SCFV, immunoglobulin fold, antibody-antigen complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 105 Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Length = 327 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query767
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 100.0
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 100.0
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.96
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.95
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.91
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.91
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.91
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.9
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.89
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.87
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.87
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.85
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.84
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.83
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.83
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.83
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.82
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.82
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.82
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.82
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.81
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.8
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.8
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 99.8
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.79
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.79
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.77
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.77
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.77
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.76
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.75
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.75
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.73
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.73
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.73
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 99.73
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.72
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.72
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.72
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.71
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.71
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.71
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.7
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.7
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.7
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.7
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.69
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.69
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.69
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.69
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.68
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.68
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.68
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.68
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.67
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.67
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.67
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.67
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.66
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.66
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.65
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.65
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.65
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.64
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.64
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.63
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.63
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.63
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.62
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.61
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.61
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.6
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.6
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.6
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.6
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.6
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.6
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.59
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.59
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.59
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.59
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.59
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.59
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.59
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.58
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.58
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.57
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.57
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.55
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.53
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.53
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.52
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.51
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.51
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.5
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.5
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.49
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.48
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.47
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.46
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.46
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.45
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.43
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.42
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.41
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.41
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 99.38
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.38
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.38
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.36
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.35
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.33
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.3
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.29
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.29
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.29
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.28
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.26
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.25
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.17
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.16
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.14
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.05
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.94
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.87
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.83
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.63
3knb_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, AT 98.54
3knb_A100 Titin; IG-like, titin, OBSL1, ATP-binding, calmodu 98.53
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.5
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.46
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 98.38
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 98.38
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 98.37
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 98.36
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.36
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 98.33
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 98.32
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 98.32
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 98.31
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 98.31
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 98.3
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 98.3
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 98.27
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 98.26
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 98.25
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.24
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 98.23
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 98.22
1wwb_X103 Protein (brain derived neurotrophic factor recepto 98.22
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 98.22
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 98.18
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 98.16
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 98.14
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 98.13
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.13
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 98.12
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 98.1
1he7_A126 High affinity nerve growth factor receptor; transf 98.09
2ens_A96 Advanced glycosylation END product-specific recept 98.07
3m45_A108 Cell adhesion molecule 2; IG fold, dimer, disulfid 98.07
2edn_A118 Myosin-binding protein C, fast-type; beta-sandwich 98.07
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 98.06
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 98.05
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 98.04
3so5_A112 LIG-3, leucine-rich repeats and immunoglobulin-lik 98.04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.03
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.02
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 98.01
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.99
3s35_X122 Vascular endothelial growth factor receptor 2; ant 97.99
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 97.95
4hwu_A95 Fibroblast growth factor receptor 2; FGFR2, KGFR, 97.91
1gl4_B98 Basement membrane-specific heparan sulfate proteog 97.9
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.87
3rbg_A124 Cytotoxic and regulatory T-cell molecule; IGV, crt 97.87
2lu7_A84 Obscurin-like protein 1; structural genomics, nort 97.87
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.87
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 97.86
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 97.86
2v9t_A117 Roundabout homolog 1; structural protein-receptor 97.84
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 97.83
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.81
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.8
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 97.8
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 97.77
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 97.76
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 97.75
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 97.73
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.7
1waa_A93 Titin; metal binding protein, calmodulin-binding, 97.69
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.69
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 97.68
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 97.67
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.67
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 97.66
2lvc_A91 Obscurin-like protein 1; structural genomics, nort 97.66
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 97.64
3mjg_X289 Beta-type platelet-derived growth factor receptor; 97.61
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 97.6
1eaj_A126 Coxsackie virus and adenovirus receptor; virus/vir 97.6
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 97.59
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 97.55
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 97.55
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 97.55
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 97.54
1z9m_A145 GAPA225; nectin-like, IG-like domain, V domain, ce 97.52
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 97.52
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 97.52
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 97.51
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 97.51
4fqp_A313 Poliovirus receptor; immunoglobulin-like domain, I 97.5
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 97.49
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 97.48
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 97.47
4frw_A218 Poliovirus receptor-related protein 4; immunoglobu 97.47
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 97.47
4fa8_A203 Secreted protein BARF1; immunoglobulin-like domain 97.47
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 97.46
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 97.46
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 97.45
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 97.45
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 97.43
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 97.43
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 97.42
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 97.42
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 97.42
4gos_A125 V-SET domain-containing T-cell activation inhibit; 97.42
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 97.42
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 97.4
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 97.39
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 97.39
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 97.38
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 97.37
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 97.37
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 97.36
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 97.36
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 97.35
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 97.35
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 97.34
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 97.33
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 97.33
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 97.33
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 97.32
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 97.31
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 97.31
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 97.31
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 97.3
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 97.3
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 97.29
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 97.29
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 97.29
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 97.29
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 97.28
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 97.28
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 97.28
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 97.28
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 97.27
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 97.26
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 97.26
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 97.25
2eo1_A102 OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 97.25
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 97.25
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 97.23
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 97.22
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 97.21
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 97.2
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 97.2
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 97.2
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.19
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 97.18
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 97.17
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 97.17
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 97.15
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 97.15
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 97.14
4fa8_A203 Secreted protein BARF1; immunoglobulin-like domain 97.13
3r08_E82 T-cell surface glycoprotein CD3 epsilon chain; ant 97.13
2oyp_A109 Hepatitis A virus cellular receptor 2; TIM-3, T-ce 97.13
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 97.11
4fom_A308 Poliovirus receptor-related protein 3; immunoglobu 97.09
1pko_A139 Myelin oligodendrocyte glycoprotein; IGV-domain, i 97.09
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 97.07
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 97.06
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 97.05
2fbo_J250 V1V2;, variable region-containing chitin-binding p 97.04
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 97.04
3p2t_A196 Leukocyte immunoglobulin-like receptor subfamily 4 97.03
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 97.03
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 97.01
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 97.0
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 96.99
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 96.99
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 96.98
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 96.97
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 96.96
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 96.95
3udw_C118 Poliovirus receptor; PVR tigit IGSF signal transdu 96.94
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 96.94
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 96.93
4gjt_B123 Poliovirus receptor-related protein 4; six-bladed 96.92
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 96.91
2e6q_A112 Obscurin-like protein 1; IG-like domain, structura 96.91
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 96.9
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 96.89
1jhl_L108 IGG1-kappa D11.15 FV (light chain); complex(antibo 96.89
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 96.89
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 96.89
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 96.89
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 96.89
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 96.88
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 96.87
2or8_A116 Hepatitis A virus cellular receptor 1 homolog; bet 96.87
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 96.86
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 96.86
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 96.85
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 96.83
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 96.83
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 96.83
2gi7_A184 GPVI protein; IG-like domains, blood clotting, cel 96.82
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 96.82
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 96.81
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 96.8
2d3v_A196 Leukocyte immunoglobulin-like receptor subfamily A 96.8
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 96.79
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 96.78
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 96.78
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 96.78
3mj8_L213 Stimulatory hamster antibody HL4E10 FAB light CHA; 96.77
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 96.75
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 96.74
4i0k_A222 CD276 antigen; immunoglobulin domain, glycoprotein 96.73
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 96.7
1nfd_E212 H57 FAB; complex (immunoreceptor-immunoglobulin), 96.69
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 96.68
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 96.67
1ugn_A198 LIR1, leukocyte immunoglobulin-like receptor 1; im 96.66
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 96.66
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 96.65
3nl4_L213 Antigen binding fragment, immunoglobulin IGG - LI; 96.61
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 96.61
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 96.61
3q0h_A117 T cell immunoreceptor with IG and ITIM domains; im 96.6
2zg1_A214 Sialic acid-binding IG-like lectin 5; siglec-5 inh 96.59
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 96.59
1qfw_M108 FV, antibody (anti beta subunit) (light chain); gl 96.57
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 96.55
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 96.54
1xau_A122 B- and T-lymphocyte attenuator; IG domain, beta sa 96.54
2pet_A231 Lutheran blood group glycoprotein; immunoglobulin 96.54
2vsd_A105 CHIR AB1; immune system receptor, FC receptor; HET 96.53
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 96.53
1gsm_A210 Madcam-1, mucosal addressin cell adhesion molecule 96.53
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 96.53
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 96.53
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 96.53
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 96.52
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 96.52
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 96.52
2wng_A327 Tyrosine-protein phosphatase non-receptor type sub 96.52
1h5b_A113 Murine T cell receptor (TCR) valpha domain; immune 96.52
2gi7_A184 GPVI protein; IG-like domains, blood clotting, cel 96.49
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 96.48
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 96.48
1zox_A113 CLM-1; IG-superfamily, IG-V, NKP44-like, myeloid I 96.48
3mjg_X289 Beta-type platelet-derived growth factor receptor; 96.47
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.47
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 96.46
2j6e_L234 IGM, FAB light chain; autoimmune complex human IGM 96.44
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 96.44
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 96.44
2pet_A231 Lutheran blood group glycoprotein; immunoglobulin 96.42
1ncn_A110 T lymphocyte activation antigen CD86; IG V, beta s 96.42
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 96.4
3s96_B218 3B5H10 FAB light chain; huntingtin, immune system; 96.4
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 96.4
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 96.39
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 96.37
2d3v_A196 Leukocyte immunoglobulin-like receptor subfamily A 96.37
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 96.37
2q20_A109 VK1 O18/O8 germline light chain variable domain; A 96.36
3p2t_A196 Leukocyte immunoglobulin-like receptor subfamily 4 96.35
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 96.35
2d9c_A136 Signal-regulatory protein beta-1; beta-sandwich, S 96.34
3pv7_A248 B7-H6, IG-like domain-containing protein DKFZP686O 96.33
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 96.33
3r06_A213 Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; 96.33
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 96.33
3mj8_L213 Stimulatory hamster antibody HL4E10 FAB light CHA; 96.33
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 96.32
1neu_A124 Myelin P0 protein; structural protein, glycoprotei 96.3
1i3g_L111 Antibody FV fragment; antibiotic; 2.44A {Mus muscu 96.29
4hwn_A108 FC receptor-like A; FCRLA, FCRL, IG-C2 domain, IG 96.28
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 96.27
3rrq_A129 Protein PD-1, programmed cell death protein 1; pro 96.26
1xt5_A135 Variable region-containing chitin-binding protein 96.26
3khq_A133 B-cell antigen receptor complex-associated protei 96.26
3d9a_L213 Light chain of hyhel10 antibody fragment (FAB); ly 96.25
2q87_A110 CMRF35-H antigen; all-beta, immunoglobulin, IG-sup 96.23
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 96.23
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 96.22
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 96.22
1oll_A188 NK receptor; immune system/receptor, NK cell trigg 96.2
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 96.19
4frw_A218 Poliovirus receptor-related protein 4; immunoglobu 96.19
1oll_A188 NK receptor; immune system/receptor, NK cell trigg 96.18
1q0x_L212 FAB 9B1, light chain; anti-morphine antibody, FAB 96.18
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 96.18
3omz_A259 Human vdelta1 gamma delta T cell receptor delta1A; 96.17
2wng_A327 Tyrosine-protein phosphatase non-receptor type sub 96.17
2fbo_J250 V1V2;, variable region-containing chitin-binding p 96.17
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 96.15
1ugn_A198 LIR1, leukocyte immunoglobulin-like receptor 1; im 96.15
4fmk_A225 Poliovirus receptor-related protein 2; immunoglobu 96.14
3d9a_L213 Light chain of hyhel10 antibody fragment (FAB); ly 96.14
1c1e_H219 Catalytic antibody 1E9 (heavy chain); diels-alder, 96.14
2or7_A115 T-cell immunoglobulin and mucin domain- containing 96.13
3tv3_L211 PGT128 light chain, IG lambda-2 chain C regions; F 96.13
3pv7_A248 B7-H6, IG-like domain-containing protein DKFZP686O 96.13
1lk3_L210 9D7 light chain; antigen-antibody complex, immune 96.12
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 96.11
2e27_L119 Anti-ciguatoxin antibody, light chain; immunoglobu 96.11
3r0n_A128 Poliovirus receptor-related protein 2; IG-domain, 96.11
1q9r_B222 S25-2 FAB (IGG1K) heavy chain; antigen-binding fra 96.1
1mqk_L120 Antibody 7E2 FV fragment, light chain; membrane pr 96.1
1i8k_A107 Epidermal growth factor receptor antibody MR1SCFV 96.02
2rcj_C523 Light chain; immunoglobulin M, polymeric antibodie 96.02
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 96.0
1lk3_L210 9D7 light chain; antigen-antibody complex, immune 95.99
2qsq_A111 Carcinoembryonic antigen-related cell adhesion MO; 95.97
2ywz_A111 NEW antigen receptor variable domain; IG VNAR, imm 95.95
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 95.95
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 95.94
4fmk_A225 Poliovirus receptor-related protein 2; immunoglobu 95.94
3moq_A126 NEW antigen receptor variable domain, P3(40) PEPT 95.94
4dzb_B246 Vbeta2 (MAIT T cell receptor); immune system; 1.70 95.91
3tf7_C256 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; 95.9
3sob_L237 Antibody light chain; beta propeller, protein bind 95.89
2p1y_A238 Bispecific alpha/beta TCR; autoimmunity, immunoglo 95.88
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 95.88
2ptt_A110 CD48 antigen; CD244, CD48, NK cell receptor, X-RAY 95.88
2yz1_A120 Tyrosine-protein phosphatase non-receptor type sub 95.88
2ghw_B247 Anti-SARS SCFV antibody, 80R; S protein, neutraliz 95.87
3esu_F250 Antibody 14B7* light chain and antibody 14B7* heav 95.87
2jju_A127 Signal regulatory protein beta-1; immunoglobulin d 95.86
3tv3_L211 PGT128 light chain, IG lambda-2 chain C regions; F 95.86
3sob_L237 Antibody light chain; beta propeller, protein bind 95.84
3nl4_L213 Antigen binding fragment, immunoglobulin IGG - LI; 95.83
3eow_R221 Poliovirus receptor; immunoglobulin super family, 95.81
2edo_A121 CD48 antigen; beta-sandwich, IG-fold, B-lymphocyte 95.8
2xzc_L216 FAB A.17 light chain; immune system; HET: XOP; 1.3 95.8
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 95.77
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 95.77
1pz5_B220 Heavy chain of FAB (SYA/J6); antibody-antigen stru 95.77
2rcj_C523 Light chain; immunoglobulin M, polymeric antibodie 95.76
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.75
3d9a_H210 Heavy chain of hyhel10 antibody fragment (FAB); ly 95.75
3auv_A276 SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid 95.74
4fom_A308 Poliovirus receptor-related protein 3; immunoglobu 95.72
1u3h_A110 T-cell receptor alpha-chain; complex, immune syste 94.7
2yc1_B146 Single chain antibody fragment 9004G; immune syste 95.71
3eow_R221 Poliovirus receptor; immunoglobulin super family, 95.7
1moe_A240 Anti-CEA MAB T84.66; anti carcinoembryonic antigen 95.7
4i0k_A222 CD276 antigen; immunoglobulin domain, glycoprotein 95.69
1nkr_A201 P58-CL42 KIR; inhibitory receptor, natural killer 95.68
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 95.68
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 95.68
2rgs_A218 I, IG gamma-2B heavy chain; FC-fragment, immunoglo 95.65
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 95.65
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 95.64
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 95.64
2vol_A207 Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, 95.61
1sq2_N113 Novel antigen receptor; immunoglobulin fold, prote 95.61
3bia_X116 T-cell immunoglobulin and mucin domain- containing 95.61
4ffy_L126 DENV1-E111 single chain variable fragment (light; 95.6
2c1o_A254 IGK-C protein; FAB fragment, enantioselective, fin 95.58
2fbj_H220 IGA-kappa J539 FAB (heavy chain); immunoglobulin; 95.57
3umt_A256 SCFV heavy chain and light chain; stability engine 95.52
1pew_A109 JTO2, A lambda-6 type immunoglobulin light chain, 95.5
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 95.49
3o3u_N581 Maltose-binding periplasmic protein, advanced Gly 95.49
1p6f_A242 NKP46, natural cytotoxicity triggering receptor 1; 95.47
3s96_B218 3B5H10 FAB light chain; huntingtin, immune system; 95.46
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=3e-38  Score=356.33  Aligned_cols=329  Identities=29%  Similarity=0.530  Sum_probs=244.4

Q ss_pred             ccCCCCCceecccCCeeEEEecCCCccccccCCCCCccEEEeeCCCCCCCCchhhhccCCCCccEEEccCCCCCccCccc
Q psy12044         15 VSACPTSCICKWKGGKQTVECVNKSLITVVEGMDPNTQVLDYTGNNLKTLHNEKFQKMGLVNLQKIYLSRCRISVIDSKA   94 (767)
Q Consensus        15 ~~~CP~~C~C~~~g~~~~v~C~~~~L~~iP~~l~~~L~~L~Ls~N~L~~l~~~~f~~~~L~~L~~L~Ls~N~L~~i~p~~   94 (767)
                      +..||..|.|...  ...|+|.+.++..+|.+++++++.|+|++|.|+.+.+..|..  +++|+.|+|++|.|+.+.+.+
T Consensus        32 ~~~Cp~~C~C~~~--~~~v~c~~~~l~~iP~~~~~~l~~L~L~~n~i~~~~~~~~~~--l~~L~~L~Ls~n~i~~i~~~~  107 (440)
T 3zyj_A           32 AQTCPSVCSCSNQ--FSKVICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKH--LRHLEILQLSRNHIRTIEIGA  107 (440)
T ss_dssp             -CCCCSSSEECTT--SCEEECCSCCCSSCCSCCCTTCSEEECCSCCCCEECTTTTSS--CSSCCEEECCSSCCCEECGGG
T ss_pred             cccCCCCCEeCCC--CCEEEeCCCCcCcCCCCCCCCCcEEEccCCcCCeeCHHHhhC--CCCCCEEECCCCcCCccChhh
Confidence            4689999999753  357999999999999999999999999999999988888874  788888888888888887777


Q ss_pred             ccCCCCCCEEEccCCCCCCCCCCCCCCCCCCcEEECCCCcCccccc----------------------------------
Q psy12044         95 FRGLTNLVDLDFSHNVLQTVPSDTFPDYPSLMKLTLSGNPIKQIKT----------------------------------  140 (767)
Q Consensus        95 f~~L~~L~~L~Ls~N~Lt~l~p~~f~~l~~L~~L~Ls~N~l~~l~~----------------------------------  140 (767)
                      |.++++|++|+|++|+|+.+++..|..+++|+.|+|++|.|+.+++                                  
T Consensus       108 ~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~N~i~~~~~~~~~~l~~L~~L~l~~~~~l~~i~~~~~~~l~~L  187 (440)
T 3zyj_A          108 FNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNL  187 (440)
T ss_dssp             GTTCSSCCEEECCSSCCSSCCTTTSCSCSSCCEEECCSCCCCEECTTTTTTCTTCCEEECCCCTTCCEECTTTTTTCSSC
T ss_pred             ccCCccCCEEECCCCcCCeeCHhHhhccccCceeeCCCCcccccCHHHhhhCcccCEeCCCCCCCcceeCcchhhccccc
Confidence            8888888888888887777776666666666666666665554433                                  


Q ss_pred             -------------------------------------CCcCCCCCccEEeccCCCccccchhhhcCCCCCCeeeccCCcc
Q psy12044        141 -------------------------------------GAFQPLSYLVTLELSKCGIEVIEDAAFVGLDSLEWLKLDNNKI  183 (767)
Q Consensus       141 -------------------------------------~~~~~l~~L~~L~Ls~N~L~~i~~~~~~~l~~L~~L~Ls~N~L  183 (767)
                                                           ..|..+++|+.|+|++|.|+++.+..|..+++|+.|+|++|+|
T Consensus       188 ~~L~L~~n~l~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~N~l  267 (440)
T 3zyj_A          188 RYLNLAMCNLREIPNLTPLIKLDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNL  267 (440)
T ss_dssp             CEEECTTSCCSSCCCCTTCSSCCEEECTTSCCCEECTTTTTTCTTCCEEECTTCCCCEECTTSSTTCTTCCEEECTTSCC
T ss_pred             CeecCCCCcCccccccCCCcccCEEECCCCccCccChhhhccCccCCEEECCCCceeEEChhhhcCCCCCCEEECCCCCC
Confidence                                                 2333334444444444444444455566677777888888888


Q ss_pred             ccccCCCC-CCCCcccccCCCCCCCchhhhhhhhhhhccCCCCC-ccCCCCCCCCCCCCCcccccccccccCC-CCCCCC
Q psy12044        184 TTISGSNI-LPTGLHGIDLHHNPWTCDCLLIGLRRWLESTKTPM-AIDPICSVPPRLSSVTIKQLSIDELACE-PQITPS  260 (767)
Q Consensus       184 t~ip~~~~-~~~~L~~L~Ls~N~l~C~c~l~~l~~~l~~~~~~~-~~~~~C~~p~~l~g~~i~~l~~~~l~C~-P~i~~~  260 (767)
                      +.++...+ .+++|+.|+|++|+|.|||.+.|+..|++...... .....|..|..+.|..+..++...+.|. |.+...
T Consensus       268 ~~~~~~~~~~l~~L~~L~L~~Np~~CdC~l~~l~~~~~~~~~~~~~~~~~C~~P~~l~g~~l~~l~~~~~~C~~P~i~~~  347 (440)
T 3zyj_A          268 TLLPHDLFTPLHHLERIHLHHNPWNCNCDILWLSWWIKDMAPSNTACCARCNTPPNLKGRYIGELDQNYFTCYAPVIVEP  347 (440)
T ss_dssp             CCCCTTTTSSCTTCCEEECCSSCEECSSTTHHHHHHHHTTSCSSCSCCCBEEESTTTTTCBCC----CCSCCCCCCEEEC
T ss_pred             CccChhHhccccCCCEEEcCCCCccCCCCchHHHHHHHhccccCCccccCCCChhHhcCccHhHhhhhhccCCCCccccc
Confidence            87776654 46889999999999999999999999998764332 2457899999999999999999999997 555556


Q ss_pred             ccceeecccccccccccccccCCCcEEEeecCeec-cCCCcccccccceeecccCcceeeeEEEEeeeccCCCCceeEee
Q psy12044        261 TFYLEIQEGKNVSLLCKVSAIPEAKITWLFDGVPI-QNESMSASESHAVYSTEEGTEIKKSELLIYNSNIDDNGTFVCVA  339 (767)
Q Consensus       261 ~~~~~v~~G~~vsL~C~a~g~P~p~itW~~~g~~l-~~~s~~~~~~~~~~~~~~g~~~~~s~L~I~nvs~sD~GtY~CvA  339 (767)
                      +....+.+|+.+++.|.+ +.|.|.+.|.++++.+ ......    ..+...      ..++|.|.+++.+|.|.|+|+|
T Consensus       348 ~~~~~v~~G~~v~L~C~~-~~p~p~i~W~~~~~~~~~~~~~~----~~~~~~------~~~~L~I~~v~~~D~G~Y~C~a  416 (440)
T 3zyj_A          348 PADLNVTEGMAAELKCRA-STSLTSVSWITPNGTVMTHGAYK----VRIAVL------SDGTLNFTNVTVQDTGMYTCMV  416 (440)
T ss_dssp             CCCEEECTTSCCEECCEE-SSTTSEEEEECTTSCEEESSSCC----SSEEEC------TTCCEEESSCCSTTCEEEEEEE
T ss_pred             ccceeeccCceEEEEeec-CCCCCceEEEeCCCceeeccCCC----ceEEEc------cCCeEEEccCChhhCEEEEEEE
Confidence            667889999999999999 5789999999854333 221110    011111      1246999999999999999999


Q ss_pred             ccCCCCcccceEEEEEeec
Q psy12044        340 ENQAGSTSSNYTIRIVLKE  358 (767)
Q Consensus       340 ~N~~G~s~~s~sL~V~~~~  358 (767)
                      .|..|.+.+.+.+.|....
T Consensus       417 ~N~~G~~~~~~~~~v~~~~  435 (440)
T 3zyj_A          417 SNSVGNTTASATLNVTGTH  435 (440)
T ss_dssp             ECSSCEEEEEEEEEEC---
T ss_pred             EcCCCcEEEEEEEEEeccc
Confidence            9999999888888776644



>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3knb_B Obscurin-like protein 1; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2wp3_O* 2wwm_C 2wwk_O Back     alignment and structure
>3knb_A Titin; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 3q5o_A 2wp3_T* 2wwk_T 2wwm_D 2y9r_T* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} SCOP: b.1.1.0 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3m45_A Cell adhesion molecule 2; IG fold, dimer, disulfide bond, glycoprotein, immunoglobulin membrane, transmembrane; HET: NAG; 2.21A {Mus musculus} Back     alignment and structure
>2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Back     alignment and structure
>3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4hwu_A Fibroblast growth factor receptor 2; FGFR2, KGFR, CD332, IG-C2 type 1 domain, IG superfamily, IMM system, structural genomics, PSI-biology; 2.90A {Mus musculus} Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Back     alignment and structure
>2lu7_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Back     alignment and structure
>2lvc_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1eaj_A Coxsackie virus and adenovirus receptor; virus/viral protein receptor, immunoglobulin V domain fold, symmetric dimer; 1.35A {Homo sapiens} SCOP: b.1.1.1 PDB: 1f5w_A 2j12_B 2j1k_A 2wbw_B* 2w9l_A* 1rsf_A 1jew_R 1kac_B 1p69_B 1p6a_B Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>1z9m_A GAPA225; nectin-like, IG-like domain, V domain, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Back     alignment and structure
>4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Back     alignment and structure
>4gos_A V-SET domain-containing T-cell activation inhibit; immunoglobulin domain, glycoprotein, disulfide bond, immunit adaptive immunity; HET: NAG BMA MAN; 1.59A {Homo sapiens} Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* Back     alignment and structure
>3r08_E T-cell surface glycoprotein CD3 epsilon chain; antibody, T-cell receptor, signalling, immune SY; 4.10A {Cricetulus migratorius} Back     alignment and structure
>2oyp_A Hepatitis A virus cellular receptor 2; TIM-3, T-cell immunoglobulin mucin, signaling protein; 1.95A {Mus musculus} PDB: 3kaa_A* Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Back     alignment and structure
>4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} Back     alignment and structure
>1pko_A Myelin oligodendrocyte glycoprotein; IGV-domain, immune system; 1.45A {Rattus norvegicus} SCOP: b.1.1.1 PDB: 1pkq_E 3csp_A 1py9_A Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>3udw_C Poliovirus receptor; PVR tigit IGSF signal transduction immunology, IGSF, cell SU receptor signalling, glycosylation, membrane protein; HET: NAG; 2.90A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>4gjt_B Poliovirus receptor-related protein 4; six-bladed -propeller, IGV-like fold, viral entry, MV-H, NEC BETA4/BETA5 groove; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A Back     alignment and structure
>2e6q_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
>1jhl_L IGG1-kappa D11.15 FV (light chain); complex(antibody-antigen); 2.40A {Mus musculus} SCOP: b.1.1.1 Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Back     alignment and structure
>2or8_A Hepatitis A virus cellular receptor 1 homolog; beta barrel, immunoglobulin fold, IGV domain, TIM, immune system; 2.50A {Mus musculus} Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Back     alignment and structure
>3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Back     alignment and structure
>4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Back     alignment and structure
>1nfd_E H57 FAB; complex (immunoreceptor-immunoglobulin), complex (immunorece immunoglobulin) complex; HET: NAG NDG; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>3q0h_A T cell immunoreceptor with IG and ITIM domains; immune receptor, adhesion, structural genomics, NEW YORK STR genomics research consortium, nysgrc; 1.70A {Homo sapiens} PDB: 3rq3_A 3udw_A* 3ucr_A Back     alignment and structure
>2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>1qfw_M FV, antibody (anti beta subunit) (light chain); glycoprotein hormone; HET: NAG; 3.50A {Mus musculus} SCOP: b.1.1.1 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>1xau_A B- and T-lymphocyte attenuator; IG domain, beta sandwich, structural genomics, PSI, protein structure initiative; 1.80A {Mus musculus} SCOP: b.1.1.4 Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Back     alignment and structure
>2vsd_A CHIR AB1; immune system receptor, FC receptor; HET: NAG NDG MAN; 1.82A {Gallus gallus} Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Back     alignment and structure
>1h5b_A Murine T cell receptor (TCR) valpha domain; immune response, immunoglobulin fold; 1.85A {Mus musculus} SCOP: b.1.1.1 PDB: 1h5b_C 1h5b_B Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>1zox_A CLM-1; IG-superfamily, IG-V, NKP44-like, myeloid IG-like receptor, structural genomics, PSI, protein structure initiative; 2.10A {Mus musculus} Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>2j6e_L IGM, FAB light chain; autoimmune complex human IGM rheumatoid factor IGG1-FC, immunoglobulin C region, membrane, glycoprotein, transmembrane; HET: NAG FUL BMA MAN NDG GAL; 3.0A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Back     alignment and structure
>1ncn_A T lymphocyte activation antigen CD86; IG V, beta strands, immune system; 2.70A {Homo sapiens} SCOP: b.1.1.1 PDB: 1i85_A Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Back     alignment and structure
>3s96_B 3B5H10 FAB light chain; huntingtin, immune system; 1.90A {Mus musculus} PDB: 2qhr_L 3ffd_B 4dcq_A Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>2q20_A VK1 O18/O8 germline light chain variable domain; Al, light chain amyloidosis, amyloid, immunoglobulin, protein fibril; 1.30A {Homo sapiens} PDB: 2kqm_A 3cdf_A 3cdc_A 2kqn_A 3cdy_A 2q1e_A 3dvi_A 1igm_L 1bww_A 1b0w_A 1bre_A 1qp1_A 3dvf_A 1rei_A 1wtl_A 1ar2_A 1fgv_L 2bx5_A 2uzi_L* 1bvk_A ... Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Back     alignment and structure
>2d9c_A Signal-regulatory protein beta-1; beta-sandwich, SIRP-beta-1, CD172B antigen, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>3r06_A Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; anti-CD3epsilon, T-cell receptor, signalling, IMMU; 2.50A {Cricetulus migratorius} PDB: 3r08_L 3ld8_B 3ldb_B* Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Back     alignment and structure
>3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Back     alignment and structure
>1neu_A Myelin P0 protein; structural protein, glycoprotein, transmembrane, phosphorylation, immunoglobulin fold, signal; 1.90A {Rattus norvegicus} SCOP: b.1.1.1 Back     alignment and structure
>1i3g_L Antibody FV fragment; antibiotic; 2.44A {Mus musculus} SCOP: b.1.1.1 PDB: 3iy6_A Back     alignment and structure
>4hwn_A FC receptor-like A; FCRLA, FCRL, IG-C2 domain, IG superfamily, immune system, ST genomics, PSI-biology; 2.01A {Homo sapiens} Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Back     alignment and structure
>3rrq_A Protein PD-1, programmed cell death protein 1; programmed death-1, costimulatory, immune system; 2.10A {Homo sapiens} Back     alignment and structure
>1xt5_A Variable region-containing chitin-binding protein 3; innate immunity, VCBP, primordial antigen receptor, florida lancelet, amphioxus; 1.15A {Branchiostoma floridae} Back     alignment and structure
>3khq_A B-cell antigen receptor complex-associated protei chain; CD79B, CD79A, IG-beta, BCR, IG domain, V-SET, immunoglobulin protein binding; HET: FLC GSH; 1.70A {Mus musculus} PDB: 3kho_A* Back     alignment and structure
>3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... Back     alignment and structure
>2q87_A CMRF35-H antigen; all-beta, immunoglobulin, IG-superfamily, IG-V, NKP44-like, natural killer cell IG-like receptor, inhibitory receptor; 1.70A {Homo sapiens} Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Back     alignment and structure
>1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Back     alignment and structure
>4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} Back     alignment and structure
>1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1q0x_L FAB 9B1, light chain; anti-morphine antibody, FAB fragment, immune system; HET: PG4; 1.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q0y_L* 1ngp_L* 1ngq_L 3ks0_L* 1gig_L 2vir_A 2vis_A* 2vit_A 1sm3_L 4a6y_L 1ind_L* 1ine_L* 1yuh_L* 2zpk_L 3rhw_K* 3ri5_K* 3ria_K* 3rif_K* 1mfe_L* 1mfb_L* ... Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Back     alignment and structure
>3omz_A Human vdelta1 gamma delta T cell receptor delta1A; immunoglobulin fold, immune surveillance of cell stress PROT A/B, MIC-A/B binding, epithelium; 3.04A {Homo sapiens} Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Back     alignment and structure
>4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* Back     alignment and structure
>3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... Back     alignment and structure
>1c1e_H Catalytic antibody 1E9 (heavy chain); diels-alder, immunoglobulin, immune system; HET: ENH; 1.90A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1dbb_H* 1dba_H* 1dbj_H* 1dbk_H* 1dbm_H* 2dbl_H* 3ojd_B 1jgl_H* 1jhk_H 1ghf_H 1tet_H* 3e8u_H 1fj1_B 1cl7_H Back     alignment and structure
>2or7_A T-cell immunoglobulin and mucin domain- containing protein 2; beta barrel, immunoglobulin fold, IGV domain, TIM, immune system; 1.50A {Mus musculus} Back     alignment and structure
>3tv3_L PGT128 light chain, IG lambda-2 chain C regions; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_L* 3twc_L* 3tnm_L 2mcg_1 1mcw_M 1a8j_L 3mcg_1 1dcl_A 1mcb_A* 1mcc_A* 1mcd_A* 1mce_A* 1mcf_A* 1mch_A 1mci_A* 1mcj_A* 1mck_A 1mcl_A* 1mcn_A* 1mcq_A ... Back     alignment and structure
>3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* Back     alignment and structure
>1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>2e27_L Anti-ciguatoxin antibody, light chain; immunoglobulin fold, immune system; HET: AB0; 1.70A {Mus musculus} PDB: 3iy1_A Back     alignment and structure
>3r0n_A Poliovirus receptor-related protein 2; IG-domain, cell-adhesion molecule, virus entry receptor, STR genomics, PSI-biology; 1.30A {Homo sapiens} PDB: 4dfh_A 4dfi_A Back     alignment and structure
>1q9r_B S25-2 FAB (IGG1K) heavy chain; antigen-binding fragment, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, KDO, complex, immune system; HET: KDA KDO; 1.45A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q9l_B 1q9k_B* 1q9q_B* 1q9v_B* 2r1w_B* 2r1x_B* 2r1y_B* 2r2b_B* 2r2e_B* 2r2h_B* 3bpc_B* 3sy0_B* 3t4y_B* 3t65_B* 2r23_B* 1q9t_B* 3t77_B* 3okl_B* 3okk_B* 3okm_B ... Back     alignment and structure
>1mqk_L Antibody 7E2 FV fragment, light chain; membrane protein, cytochrome C oxidase, high- resolution structure, immune system; 1.28A {Mus musculus} SCOP: b.1.1.1 PDB: 1ar1_D 3ehb_D* 3hb3_D* 1qle_L* 1f6l_L 3iy2_A 1vfa_A 1dvf_A 1kir_A 1g7i_A 1g7j_A 1a2y_A 1kip_A 1kiq_A 1vfb_A 1g7h_A 1a7o_L 1g7l_A 1g7m_A 1a7n_L ... Back     alignment and structure
>1i8k_A Epidermal growth factor receptor antibody MR1SCFV light chain; antibody-peptide complex, immunoglobulin fold, type II' beta turn., immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 PDB: 1i8i_A Back     alignment and structure
>2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Back     alignment and structure
>1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* Back     alignment and structure
>2qsq_A Carcinoembryonic antigen-related cell adhesion MO; glycoprotein, GPI-anchor, immunoglobulin DOMA lipoprotein, membrane; 1.95A {Homo sapiens} PDB: 2qst_A 2ver_N* 2gk2_A Back     alignment and structure
>2ywz_A NEW antigen receptor variable domain; IG VNAR, immune system; 2.21A {Orectolobus maculatus} PDB: 2ywy_A Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* Back     alignment and structure
>3moq_A NEW antigen receptor variable domain, P3(40) PEPT amyloid beta A4 protein; AB-ignar, AB-12Y-2, glycoprotein, membran protease inhibitor; 2.05A {Orectolobus maculatus} PDB: 2z8w_C 2z8v_C 1ves_A 1ver_A Back     alignment and structure
>4dzb_B Vbeta2 (MAIT T cell receptor); immune system; 1.70A {Homo sapiens} PDB: 1ymm_E* 3o4l_E* 3o6f_D 3t0e_D 1ktk_E 3mfg_B 2ij0_E Back     alignment and structure
>3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} Back     alignment and structure
>3sob_L Antibody light chain; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_A 3u1s_L* Back     alignment and structure
>2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>2ptt_A CD48 antigen; CD244, CD48, NK cell receptor, X-RAY, immune system; 1.63A {Mus musculus} PDB: 2ptv_A Back     alignment and structure
>2yz1_A Tyrosine-protein phosphatase non-receptor type substrate 1; beta-sandwich, structural genomics, NPPSFA; 1.40A {Mus musculus} Back     alignment and structure
>2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* Back     alignment and structure
>2jju_A Signal regulatory protein beta-1; immunoglobulin domain, immunoglobulin superfamily, immune system, transmembrane, paired receptor; 1.19A {Homo sapiens} PDB: 2jjv_A 2uv3_A* 2jjt_A* 2jjs_A* 2jjw_A Back     alignment and structure
>3tv3_L PGT128 light chain, IG lambda-2 chain C regions; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_L* 3twc_L* 3tnm_L 2mcg_1 1mcw_M 1a8j_L 3mcg_1 1dcl_A 1mcb_A* 1mcc_A* 1mcd_A* 1mce_A* 1mcf_A* 1mch_A 1mci_A* 1mcj_A* 1mck_A 1mcl_A* 1mcn_A* 1mcq_A ... Back     alignment and structure
>3sob_L Antibody light chain; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_A 3u1s_L* Back     alignment and structure
>2edo_A CD48 antigen; beta-sandwich, IG-fold, B-lymphocyte activation marker blast-1, BCM1 surface antigen, leukocyte antigen MEM-102, TCT.1; NMR {Homo sapiens} Back     alignment and structure
>2xzc_L FAB A.17 light chain; immune system; HET: XOP; 1.36A {Homo sapiens} PDB: 2xza_L* 3kdm_L* 3nps_C 1dn0_A 1qlr_A* 2v7n_A 3eo0_A 3eo1_A 2agj_L* 2fx7_L 1tzg_L 2fx8_L 2fx9_L* 1u6a_L 3hi1_L* 3kym_A 3kyk_L 3qwo_L* 3ixt_L* 3qeg_L ... Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>1pz5_B Heavy chain of FAB (SYA/J6); antibody-antigen structure, peptide-carbohydrate mimicry, VA design, immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1m7d_B* 1m71_B* 1m7i_B* 1r24_B 1uz6_F 1uz8_B* 1clz_H* Back     alignment and structure
>2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3d9a_H Heavy chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_H 1gpo_H 3ks0_H* 1dqd_H 1ndm_B 1nak_H 1dqq_B 1dqm_H 1dqj_B 1nby_B 1nbz_B 1xgu_B 1ndg_B 1xgt_B 1xgp_B 1xgq_B 1xgr_B 1s5i_H 1f8t_H 1f90_H ... Back     alignment and structure
>3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L Back     alignment and structure
>4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} Back     alignment and structure
>1u3h_A T-cell receptor alpha-chain; complex, immune system; 2.42A {Mus musculus} SCOP: b.1.1.1 PDB: 1b88_A 1kj2_A* 1kb5_A 1d9k_A* Back     alignment and structure
>2yc1_B Single chain antibody fragment 9004G; immune system-toxin complex, scorpion toxin; 1.90A {Homo sapiens} PDB: 2ybr_B 3lh2_L 3h3p_L 3lhp_L Back     alignment and structure
>1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} Back     alignment and structure
>1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Back     alignment and structure
>2rgs_A I, IG gamma-2B heavy chain; FC-fragment, immunoglobulin, glycosylation, immune system; HET: NAG FUC MAN GAL; 2.13A {Mus musculus} Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2vol_A Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, cytoplasm, mouse IGG, zinc-finger, DNA-binding, RNA-binding, tripartite motif (TRIM) protein; HET: NAG MAN GAL FUC; 1.95A {Mus musculus} PDB: 3hkf_A 1i1a_C* 1cqk_A Back     alignment and structure
>1sq2_N Novel antigen receptor; immunoglobulin fold, protein-protein complex, hydrolase/immune system complex; 1.45A {Ginglymostoma cirratum} SCOP: b.1.1.1 PDB: 1t6v_N Back     alignment and structure
>3bia_X T-cell immunoglobulin and mucin domain- containing protein 4; beta barrel, immunoglobulin fold, IGV domain, TIM, glycoprotein; HET: TLA; 2.20A {Mus musculus} PDB: 3bi9_X* 3bib_X* Back     alignment and structure
>4ffy_L DENV1-E111 single chain variable fragment (light; viral envelope proteins, structural genomics, antibody epito flavivirus, niaid; 2.50A {Mus musculus} Back     alignment and structure
>2c1o_A IGK-C protein; FAB fragment, enantioselective, finrozole, immune system, antibody, ENA11His antibody, immunoglobulin domain; 2.75A {Mus musculus} Back     alignment and structure
>2fbj_H IGA-kappa J539 FAB (heavy chain); immunoglobulin; HET: NAG FUC; 1.95A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mcp_H 2mcp_H* Back     alignment and structure
>3umt_A SCFV heavy chain and light chain; stability engineering, anthrax, anti-BCLA antibody, immunoglobulin fold (VH and VL domains), antibody, immune S; HET: NHE; 1.80A {Mus musculus} PDB: 1xiw_D Back     alignment and structure
>1pew_A JTO2, A lambda-6 type immunoglobulin light chain, domain; beta sheet, immune system; 1.60A {Homo sapiens} SCOP: b.1.1.1 PDB: 1cd0_A 1pw3_A 2cd0_A 2w0k_A 3b5g_A 3bdx_A* 2w0l_A Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>3o3u_N Maltose-binding periplasmic protein, advanced Gly END product-specific receptor; RAGE, AGER, scavenger receptor; HET: MLR; 1.50A {Escherichia coli} PDB: 3s59_A 3s58_A 3cjj_A 2l7u_A* 2e5e_A Back     alignment and structure
>1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3s96_B 3B5H10 FAB light chain; huntingtin, immune system; 1.90A {Mus musculus} PDB: 2qhr_L 3ffd_B 4dcq_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 767
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-28
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-23
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-18
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 5e-13
d3dara197 b.1.1.4 (A:153-249) Fibroblast growth factor recep 3e-12
d1f97a2110 b.1.1.4 (A:129-238) Junction adhesion molecule, JA 1e-11
d2cqva1101 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T 3e-11
d1qz1a3100 b.1.1.4 (A:190-289) Neural cell adhesion molecule 4e-11
d2fdbp2109 b.1.1.4 (P:2252-2360) Fibroblast growth factor rec 1e-10
d1biha489 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr 2e-10
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 2e-10
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 1e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-05
d3b5ha1101 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo 2e-09
d1nbqa2104 b.1.1.4 (A:130-233) Junction adhesion molecule, JA 3e-09
d1he7a_107 b.1.1.4 (A:) High affinity nerve growth factor rec 3e-09
d1tnna_91 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 4e-09
d1gxea_130 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 7e-09
d1epfa292 b.1.1.4 (A:98-189) Neural cell adhesion molecule ( 2e-08
d1koaa197 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha 3e-08
d1g1ca_98 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 4e-08
d1cs6a391 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall 5e-08
d1wwbx_103 b.1.1.4 (X:) Ligand binding domain of trkB recepto 1e-07
d1cs6a489 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall 2e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-05
d1iray3107 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor 2e-07
d1rhfa191 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor 3e-07
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 4e-07
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 7e-04
d1cs6a197 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus 4e-07
d1fhga_102 b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) 4e-07
d1biha397 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecr 1e-06
d2avga1110 b.1.1.4 (A:1-110) Cardiac myosin binding protein C 1e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1wwca_105 b.1.1.4 (A:) NT3 binding domain of trkC receptor { 3e-06
d1biha194 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropi 3e-06
d2aw2a1104 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator 4e-06
d1ccza193 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-ter 4e-06
d1pd6a_94 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 5e-06
d1nbqa1105 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM 1e-05
d1f97a1102 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM 1e-05
d2c9aa196 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein 1e-05
d1wiua_93 b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis el 2e-05
d1zxqa1106 b.1.1.3 (A:87-192) Intercellular cell adhesion mol 3e-05
d2oz4a384 b.1.1.4 (A:367-450) Intercellular adhesion molecul 3e-05
d1gl4b_89 b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus muscu 3e-05
d1x44a190 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-ty 7e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 8e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 8e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d2dava1113 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-t 8e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 3e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d2ifga192 b.1.1.4 (A:192-283) High affinity nerve growth fac 6e-04
d2crya1115 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRR 7e-04
d1epfa197 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NC 0.001
d1iray1101 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {H 0.001
d1mjul2107 b.1.1.2 (L:108-214) Immunoglobulin light chain kap 0.001
d1pkoa_126 b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein ( 0.002
d1n26a193 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chai 0.003
d1tiua_89 b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig re 0.004
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Reticulon 4 receptor (Nogo-66 receptor, Ngr)
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  113 bits (283), Expect = 2e-28
 Identities = 64/284 (22%), Positives = 103/284 (36%), Gaps = 54/284 (19%)

Query: 18  CPTSCICKWKGGKQTVECVNKSLITVVEGMDPNTQVLDYTGNNLKTLHNEKFQKMGLVNL 77
           CP +C+C +   K T  C  + L  V  G+   +Q +   GN +  +    F+     NL
Sbjct: 2   CPGACVC-YNEPKVTTSCPQQGLQAVPVGIPAASQRIFLHGNRISHVPAASFR--ACRNL 58

Query: 78  QKIYLSRCR-------------------------ISVIDSKAFRGLTNLVDLDFSHNVLQ 112
             ++L                             +  +D   F GL  L  L      LQ
Sbjct: 59  TILWLHSNVLARIDAAAFTGLALLEQLDLSDNAQLRSVDPATFHGLGRLHTLHLDRCGLQ 118

Query: 113 TVPSDTFPDYPSLMKLTLSGNPIKQIKTGAFQPLSYLVTLELSKCGIEVIEDAAFVGLDS 172
            +    F    +L  L L  N ++ +    F+ L  L  L L    I  + + AF GL S
Sbjct: 119 ELGPGLFRGLAALQYLYLQDNALQALPDDTFRDLGNLTHLFLHGNRISSVPERAFRGLHS 178

Query: 173 LEWLKLDNNKITTISGSNI-------------------------LPTGLHGIDLHHNPWT 207
           L+ L L  N++  +                                  L  + L+ NPW 
Sbjct: 179 LDRLLLHQNRVAHVHPHAFRDLGRLMTLYLFANNLSALPTEALAPLRALQYLRLNDNPWV 238

Query: 208 CDCLLIGLRRWLESTKTPMAIDPICSVPPRLSSVTIKQLSIDEL 251
           CDC    L  WL+  +   + +  CS+P RL+   +K+L+ ++L
Sbjct: 239 CDCRARPLWAWLQKFRGSSS-EVPCSLPQRLAGRDLKRLAANDL 281


>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 97 Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 97 Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 94 Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 93 Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 97 Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1mjul2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 126 Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Length = 89 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query767
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.96
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.95
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.86
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.72
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.71
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.71
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.59
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.56
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.54
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.53
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.51
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.51
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.49
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.49
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.47
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.46
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.42
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.41
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.39
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.39
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.39
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.36
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.34
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.32
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.26
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.16
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.07
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.97
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.64
d1cs6a489 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 98.57
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.55
d1koaa197 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 98.54
d1tnna_91 Titin {Human (Homo sapiens), different modules [Ta 98.53
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 98.53
d1fhga_102 Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 98.48
d1qz1a3100 Neural cell adhesion molecule (NCAM) {Rat (Rattus 98.46
d1wiua_93 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 98.45
d1g1ca_98 Titin {Human (Homo sapiens), different modules [Ta 98.45
d2fdbp2109 Fibroblast growth factor receptor, FGFR {Human (Ho 98.43
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.41
d1cs6a391 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 98.41
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.4
d1biha489 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 98.4
d3dara197 Fibroblast growth factor receptor, FGFR {Human (Ho 98.37
d1rhfa191 Tyrosine-protein kinase receptor tyro3, N-terminal 98.36
d1nbqa2104 Junction adhesion molecule, JAM, C-terminal domain 98.34
d2ifga192 High affinity nerve growth factor receptor TrkA, d 98.33
d1vcaa290 Vascular cell adhesion molecule-1 (VCAM-1) {Human 98.32
d1gxea_130 Cardiac myosin binding protein C, different domain 98.31
d2avga1110 Cardiac myosin binding protein C, different domain 98.3
d2dava1113 Myosin-binding protein C, slow-type {Human (Homo s 98.29
d2nxyb284 CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 98.28
d1iray3107 Type-1 interleukin-1 receptor {Human (Homo sapiens 98.27
d3b5ha1101 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 98.26
d1biha397 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 98.26
d1epfa292 Neural cell adhesion molecule (NCAM) {Rat (Rattus 98.23
d1gl4b_89 Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 98.22
d1nbqa1105 Junction adhesion molecule, JAM, N-terminal domain 98.22
d1f97a2110 Junction adhesion molecule, JAM, C-terminal domain 98.22
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.21
d1rhfa285 Tyrosine-protein kinase receptor tyro3, second dom 98.21
d1f97a1102 Junction adhesion molecule, JAM, N-terminal domain 98.2
d1biha194 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 98.19
d2oz4a384 Intercellular adhesion molecule-1, ICAM-1 {Human ( 98.18
d2aw2a1104 B- and T-lymphocyte attenuator CD272 {Human (Homo 98.16
d1wwca_105 NT3 binding domain of trkC receptor {Human (Homo s 98.15
d1gsma190 Mucosal addressin cell adhesion molecule-1 (MADCAM 98.14
d1wwbx_103 Ligand binding domain of trkB receptor {Human (Hom 98.12
d1he7a_107 High affinity nerve growth factor receptor TrkA, d 98.08
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.07
d2c9aa196 Receptor-type tyrosine-protein phosphatase mu {Hum 98.02
d1epfa197 Neural cell adhesion molecule (NCAM) {Rat (Rattus 98.01
d1olza192 Semaphorin 4d Ig-like domain {Human (Homo sapiens) 97.98
d1cs6a197 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 97.98
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.98
d1l6za296 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t 97.93
d1n26a193 Interleukin-6 receptor alpha chain, N-terminal dom 97.93
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.93
d1biha2111 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 97.9
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.86
d1x44a190 Myosin-binding protein C, slow-type {Human (Homo s 97.83
d2crya1115 Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s 97.82
d1iray2103 Type-1 interleukin-1 receptor {Human (Homo sapiens 97.77
d1cs6a2105 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 97.76
d2fcba288 Fc gamma receptor ectodomain (CD32) {Human (Homo s 97.76
d1iray1101 Type-1 interleukin-1 receptor {Human (Homo sapiens 97.75
d1fnla289 Fc gamma receptor ectodomain (CD32) {Human (Homo s 97.71
d1f2qa289 IgE high affinity receptor alpha subunit {Human (H 97.61
d1f2qa182 IgE high affinity receptor alpha subunit {Human (H 97.57
d2fcba185 Fc gamma receptor ectodomain (CD32) {Human (Homo s 97.55
d1tiua_89 Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI 97.55
d1iama1103 Intercellular cell adhesion molecule-1 (ICAM-1) {H 97.52
d1fnla184 Fc gamma receptor ectodomain (CD32) {Human (Homo s 97.47
d1pd6a_94 Cardiac myosin binding protein C, different domain 97.47
d1ccza193 CD2-binding domain of CD58, N-terminal domain {Hum 97.47
d1zxqa1106 Intercellular cell adhesion molecule-2 (ICAM-2) {H 97.26
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.12
d1eaja_124 Coxsackie virus and adenovirus receptor (Car), dom 97.04
d1pkoa_126 Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra 96.99
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.7
d1hnga198 CD2, first domain {Rat (Rattus norvegicus) [TaxId: 96.4
d2nxyb197 CD4 V-set domains {Human (Homo sapiens) [TaxId: 96 95.93
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 95.9
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.81
d2cdea1114 T-cell antigen receptor {Human (Homo sapiens), bet 95.51
d1l6za1107 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t 95.26
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 95.03
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 94.94
d1lp9e1115 T-cell antigen receptor {Mouse (Mus musculus), alp 94.82
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 94.76
d1xeda_116 Polymeric-immunoglobulin receptor, PIGR {Human (Ho 94.73
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 94.51
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.49
d1nezg_122 CD8 {Mouse (Mus musculus) [TaxId: 10090]} 94.49
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 94.44
d1neua_119 Myelin membrane adhesion molecule P0 {Rat (Rattus 94.18
d1a0ql1106 Immunoglobulin light chain kappa variable domain, 94.16
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 94.09
d1j8hd1115 T-cell antigen receptor {Human (Homo sapiens), alp 93.97
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 93.96
d2bnqd1113 T-cell antigen receptor {Human (Homo sapiens), alp 93.92
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 93.85
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 93.8
d1hkfa_108 NK cell activating receptor NKP44 {Human (Homo sap 93.71
d1dr9a1105 CD80, N-terminal domain {Human (Homo sapiens) [Tax 93.71
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 93.7
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 93.67
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 93.64
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 93.61
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 93.59
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 93.56
d1ospl1107 Immunoglobulin light chain kappa variable domain, 93.51
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 93.35
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 93.33
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 93.31
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 93.26
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 93.23
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 93.2
d1c5cl1107 Immunoglobulin light chain kappa variable domain, 93.19
d1u3ha1110 T-cell antigen receptor {Mouse (Mus musculus), alp 93.15
d1s9ja_322 Dual specificity mitogen-activated protein kinase 93.12
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 93.08
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 93.02
d8faba1103 Immunoglobulin light chain lambda variable domain, 93.01
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 93.0
d1i8ka_106 Immunoglobulin light chain kappa variable domain, 93.0
d1kcvl1107 Immunoglobulin light chain kappa variable domain, 92.98
d1i9ea_115 T-cell antigen receptor {Mouse (Mus musculus), alp 92.97
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 92.93
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 92.87
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 92.84
d3bp5a1114 Programmed cell death protein 1, PD1, extracellula 92.83
d1mexl1107 Immunoglobulin light chain kappa variable domain, 92.76
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 92.72
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 92.71
d2gj6d194 T-cell antigen receptor {Mouse (Mus musculus), bet 92.67
d1bd2d1111 T-cell antigen receptor {Human (Homo sapiens), alp 92.63
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 92.63
d1jhll_108 Immunoglobulin light chain kappa variable domain, 92.62
d1ymmd196 T-cell antigen receptor {Human (Homo sapiens), alp 92.55
d1tjgl1107 Immunoglobulin light chain kappa variable domain, 92.4
d1ucta199 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 92.4
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 92.4
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 92.37
d3cx5k1107 Immunoglobulin light chain kappa variable domain, 92.37
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 92.35
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 92.34
d2ij0c1118 T-cell antigen receptor {Human (Homo sapiens), bet 92.33
d1j1pl_107 Immunoglobulin light chain kappa variable domain, 92.32
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 92.31
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 92.27
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 92.21
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 92.17
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 92.15
d1op3k1106 Immunoglobulin light chain kappa variable domain, 92.15
d1lk3l1106 Immunoglobulin light chain kappa variable domain, 92.11
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 92.09
d1h5ba_113 T-cell antigen receptor {Mouse (Mus musculus), alp 92.09
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 91.96
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 91.95
d2g5ra1121 N-terminal domain of sialic acid binding Ig-like l 91.92
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 91.85
d1f3rb2119 Immunoglobulin light chain kappa variable domain, 91.84
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 91.84
d1tvda_116 T-cell antigen receptor {Human (Homo sapiens), del 91.79
d1olla195 Ligand binding domain of NK receptor NKp46 {Human 91.78
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 91.69
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 91.67
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 91.55
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 91.44
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 91.38
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 91.35
d1qfoa_118 N-terminal domain of sialoadhesin {Mouse (Mus musc 91.35
d2esvd1110 T-cell antigen receptor {Human (Homo sapiens), alp 91.33
d1mqkl_109 Immunoglobulin light chain kappa variable domain, 91.2
d2atpb1115 CD8 {Mouse (Mus musculus), beta-chain [TaxId: 1009 91.17
d1vcaa1109 Vascular cell adhesion molecule-1 (VCAM-1) {Human 91.09
d2fx7l1108 Immunoglobulin light chain kappa variable domain, 91.09
d1akjd_114 CD8 {Human (Homo sapiens) [TaxId: 9606]} 91.03
d1ncna_110 CD86 (b7-2), N-terminal domain {Human (Homo sapien 90.96
d1rzfl1111 Immunoglobulin light chain lambda variable domain, 90.95
d2ak4d1114 T-cell antigen receptor {Human (Homo sapiens), alp 90.93
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 90.92
d1vesa_113 Novel antigen receptor 12Y-2 {Spotted wobbegong (O 90.91
d1ogad1115 T-cell antigen receptor {Human (Homo sapiens), alp 90.83
d1bwwa_109 Immunoglobulin light chain kappa variable domain, 90.73
d1w72l1109 Immunoglobulin light chain lambda variable domain, 90.68
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 90.66
d1fo0a_115 T-cell antigen receptor {Mouse (Mus musculus), alp 90.65
d1kgcd1112 T-cell antigen receptor {Human (Homo sapiens), alp 90.59
d1ac6a_110 T-cell antigen receptor {Mouse (Mus musculus), alp 90.51
d1lgva1112 Immunoglobulin light chain lambda variable domain, 90.4
d1d5il1107 Immunoglobulin light chain kappa variable domain, 90.34
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 90.28
d1sq2n_112 Novel antigen receptor (against lysozyme) {Nurse s 90.13
d1hxma1120 T-cell antigen receptor {Human (Homo sapiens), gam 90.0
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 89.88
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 89.73
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 89.56
d2rhea_114 Immunoglobulin light chain lambda variable domain, 88.81
d1yqvl1104 Immunoglobulin light chain kappa variable domain, 88.78
d1ypzf1120 T-cell antigen receptor {Human (Homo sapiens), gam 88.36
d1cd0a_111 Immunoglobulin light chain lambda variable domain, 88.15
d1dr9a295 CD80, second domain {Human (Homo sapiens) [TaxId: 87.87
d1ogae1114 T-cell antigen receptor {Human (Homo sapiens), bet 87.8
d2aq2a1110 T-cell antigen receptor {Mouse (Mus musculus), bet 87.77
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 87.71
d1j05a_111 Immunoglobulin light chain kappa variable domain, 87.66
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 87.45
d1mjul1112 Immunoglobulin light chain kappa variable domain, 87.3
d1ucta296 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 87.26
d2cdeb1112 T-cell antigen receptor {Human (Homo sapiens), bet 87.17
d1q9ra1113 Immunoglobulin light chain kappa variable domain, 86.95
d2esve1111 T-cell antigen receptor {Human (Homo sapiens), bet 86.9
d1smoa_113 TREM-1 (triggering receptor expressed on myeloid c 86.52
d1nfdb1113 T-cell antigen receptor {Mouse (Mus musculus), bet 86.34
d1kgce1112 T-cell antigen receptor {Human (Homo sapiens), bet 86.25
d1nfde1108 Immunoglobulin light chain lambda variable domain, 85.99
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 85.93
d1i8lc_118 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 85.12
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 84.89
d2ntsp1113 T-cell antigen receptor {Human (Homo sapiens), bet 84.86
d1n4xl_113 Immunoglobulin light chain kappa variable domain, 84.29
d1xaua_104 B and T lymphocyte attenuator, Btla {Mouse (Mus mu 83.98
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 83.64
d1oaql_110 Immunoglobulin light chain lambda variable domain, 83.48
d1ncwl1112 Immunoglobulin light chain kappa variable domain, 83.48
d1hxmb1123 T-cell antigen receptor {Human (Homo sapiens), del 83.42
d1fp5a2105 Immunoglobulin heavy chain epsilon constant domain 82.84
d1dqta_117 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 82.76
d1j8he1113 T-cell antigen receptor {Human (Homo sapiens), bet 82.51
d1muja1100 Class II MHC alpha chain, C-terminal domain {Mouse 82.08
d1ow0a2108 Immunoglobulin heavy chain alpha constant domain 3 81.69
d2gsia1111 Immunoglobulin light chain kappa variable domain, 81.59
d2bnub1112 T-cell antigen receptor {Human (Homo sapiens), bet 81.27
d1k5nb_100 beta2-microglobulin {Human (Homo sapiens) [TaxId: 80.14
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Reticulon 4 receptor (Nogo-66 receptor, Ngr)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.96  E-value=1.2e-28  Score=258.92  Aligned_cols=231  Identities=30%  Similarity=0.523  Sum_probs=175.5

Q ss_pred             CCCCCceecccCCeeEEEecCCCccccccCCCCCccEEEeeCCCCCCCCchhhhccCCCCccEEEccCCCCCcc------
Q psy12044         17 ACPTSCICKWKGGKQTVECVNKSLITVVEGMDPNTQVLDYTGNNLKTLHNEKFQKMGLVNLQKIYLSRCRISVI------   90 (767)
Q Consensus        17 ~CP~~C~C~~~g~~~~v~C~~~~L~~iP~~l~~~L~~L~Ls~N~L~~l~~~~f~~~~L~~L~~L~Ls~N~L~~i------   90 (767)
                      .||..|.|. ......|.|++.+|+.+|..++.++++|+|++|+|+.+++..|..  +++|+.|++++|+|..+      
T Consensus         1 ~cp~~C~C~-~~~~~~v~c~~~~L~~iP~~ip~~~~~L~Ls~N~i~~i~~~~f~~--l~~L~~L~ls~n~l~~i~~~~~~   77 (284)
T d1ozna_           1 PCPGACVCY-NEPKVTTSCPQQGLQAVPVGIPAASQRIFLHGNRISHVPAASFRA--CRNLTILWLHSNVLARIDAAAFT   77 (284)
T ss_dssp             CCCTTCEEE-CSSSCEEECCSSCCSSCCTTCCTTCSEEECTTSCCCEECTTTTTT--CTTCCEEECCSSCCCEECTTTTT
T ss_pred             CcCCCCEEc-CCCCeEEEcCCCCCCccCCCCCCCCCEEECcCCcCCCCCHHHhhc--ccccccccccccccccccccccc
Confidence            599999994 344678999999999999999999999999999999999888874  67777777777655422      


Q ss_pred             -------------------CcccccCCCCCCEEEccCC------------------------CCCCCCCCCCCCCCCCcE
Q psy12044         91 -------------------DSKAFRGLTNLVDLDFSHN------------------------VLQTVPSDTFPDYPSLMK  127 (767)
Q Consensus        91 -------------------~p~~f~~L~~L~~L~Ls~N------------------------~Lt~l~p~~f~~l~~L~~  127 (767)
                                         .+.+|.++++|++|+|++|                        .|+++++..|..+++|+.
T Consensus        78 ~~~~~~~l~~~~~~~~~~l~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~~L~~l~l~~N~l~~i~~~~f~~~~~L~~  157 (284)
T d1ozna_          78 GLALLEQLDLSDNAQLRSVDPATFHGLGRLHTLHLDRCGLQELGPGLFRGLAALQYLYLQDNALQALPDDTFRDLGNLTH  157 (284)
T ss_dssp             TCTTCCEEECCSCTTCCCCCTTTTTTCTTCCEEECTTSCCCCCCTTTTTTCTTCCEEECCSSCCCCCCTTTTTTCTTCCE
T ss_pred             ccccccccccccccccccccchhhcccccCCEEecCCcccccccccccchhcccchhhhccccccccChhHhccccchhh
Confidence                               1334555566666666555                        444554555555666666


Q ss_pred             EECCCCcCcccccCCcCCCCCccEEeccCCCccccchhhhcCCCCCCeeeccCCccccccCCCC-CCCCcccccCCCCCC
Q psy12044        128 LTLSGNPIKQIKTGAFQPLSYLVTLELSKCGIEVIEDAAFVGLDSLEWLKLDNNKITTISGSNI-LPTGLHGIDLHHNPW  206 (767)
Q Consensus       128 L~Ls~N~l~~l~~~~~~~l~~L~~L~Ls~N~L~~i~~~~~~~l~~L~~L~Ls~N~Lt~ip~~~~-~~~~L~~L~Ls~N~l  206 (767)
                      |+|++|.|+.+++.+|.++++|+.|++++|.++++.+..|..+++|+.|++++|.++.+++..+ ...+|+.|+|++|+|
T Consensus       158 L~l~~N~l~~l~~~~f~~l~~L~~l~l~~N~l~~i~~~~f~~l~~L~~L~l~~N~i~~~~~~~~~~~~~L~~L~l~~N~l  237 (284)
T d1ozna_         158 LFLHGNRISSVPERAFRGLHSLDRLLLHQNRVAHVHPHAFRDLGRLMTLYLFANNLSALPTEALAPLRALQYLRLNDNPW  237 (284)
T ss_dssp             EECCSSCCCEECTTTTTTCTTCCEEECCSSCCCEECTTTTTTCTTCCEEECCSSCCSCCCHHHHTTCTTCCEEECCSSCE
T ss_pred             cccccCcccccchhhhccccccchhhhhhccccccChhHhhhhhhcccccccccccccccccccccccccCEEEecCCCC
Confidence            6666666666666666667777777777777777777777777777777777777776665433 557899999999999


Q ss_pred             CchhhhhhhhhhhccCCCCCccCCCCCCCCCCCCCcccccccccc
Q psy12044        207 TCDCLLIGLRRWLESTKTPMAIDPICSVPPRLSSVTIKQLSIDEL  251 (767)
Q Consensus       207 ~C~c~l~~l~~~l~~~~~~~~~~~~C~~p~~l~g~~i~~l~~~~l  251 (767)
                      .|+|.+.|+..|++..... ..+..|+.|..++|..+.+++.+++
T Consensus       238 ~C~C~~~~l~~~l~~~~~~-~~~~~C~~p~~l~g~~l~~l~~~~l  281 (284)
T d1ozna_         238 VCDCRARPLWAWLQKFRGS-SSEVPCSLPQRLAGRDLKRLAANDL  281 (284)
T ss_dssp             ECSGGGHHHHHHHHHCCSE-ECCCBEEESGGGTTCBGGGSCGGGS
T ss_pred             CCCccchHHHHHHHhCcCC-CCceEeCCchHHcCCccccCCHHHC
Confidence            9999999999999876443 3678899999999999999988876



>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2cdea1 b.1.1.1 (A:2-115) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lp9e1 b.1.1.1 (E:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1j8hd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnqd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ospl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1c5cl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1u3ha1 b.1.1.1 (A:2-116) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d8faba1 b.1.1.1 (A:3-105) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i8ka_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1kcvl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1i9ea_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bp5a1 b.1.1.1 (A:1-114) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mexl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gj6d1 b.1.1.1 (D:15-114) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1bd2d1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jhll_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1ymmd1 b.1.1.1 (D:9-104) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1tjgl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cx5k1 b.1.1.1 (K:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ij0c1 b.1.1.1 (C:1-117) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1j1pl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1op3k1 b.1.1.1 (K:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1lk3l1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h5ba_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2g5ra1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1tvda_ b.1.1.1 (A:) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1qfoa_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2esvd1 b.1.1.1 (D:4-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1mqkl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2atpb1 b.1.1.1 (B:1-115) CD8 {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1vcaa1 b.1.1.3 (A:91-199) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fx7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]} Back     information, alignment and structure
>d1akjd_ b.1.1.1 (D:) CD8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncna_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzfl1 b.1.1.1 (L:2-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d2ak4d1 b.1.1.1 (D:1-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vesa_ b.1.1.1 (A:) Novel antigen receptor 12Y-2 {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]} Back     information, alignment and structure
>d1ogad1 b.1.1.1 (D:3-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1bwwa_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1w72l1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fo0a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1kgcd1 b.1.1.1 (D:2-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ac6a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1lgva1 b.1.1.1 (A:1-112) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]} Back     information, alignment and structure
>d1d5il1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq2n_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} Back     information, alignment and structure
>d1hxma1 b.1.1.1 (A:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rhea_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d1yqvl1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1ypzf1 b.1.1.1 (F:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1cd0a_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1dr9a2 b.1.1.3 (A:106-200) CD80, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogae1 b.1.1.1 (E:5-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2aq2a1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j05a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mjul1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1ucta2 b.1.1.4 (A:101-196) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cdeb1 b.1.1.1 (B:5-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1q9ra1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]} Back     information, alignment and structure
>d2esve1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1smoa_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nfdb1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1kgce1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1nfde1 b.1.1.1 (E:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i8lc_ b.1.1.1 (C:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ntsp1 b.1.1.1 (P:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1n4xl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1xaua_ b.1.1.4 (A:) B and T lymphocyte attenuator, Btla {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oaql_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ncwl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1hxmb1 b.1.1.1 (B:1-123) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1fp5a2 b.1.1.2 (A:439-543) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dqta_ b.1.1.1 (A:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j8he1 b.1.1.1 (E:2-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1muja1 b.1.1.2 (A:84-183) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} Back     information, alignment and structure
>d1ow0a2 b.1.1.2 (A:343-450) Immunoglobulin heavy chain alpha constant domain 3, CH3-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gsia1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d2bnub1 b.1.1.1 (B:2-113) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1k5nb_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure