Psyllid ID: psy12127

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260---
LHCKKEPECCANCKELIASISECGVCLEPLDRGITSCQTCGNLVCTSCAARLLKCPFCRITIDYSWQRNVALERIFTKLELPCRNFRFGCKVYLPKAKRDKHEDKCKFRQLKCPMHACPWTNSVLHLSEHLNQVHHLHLLKGNGVNIEISNFKTKVSESETKVHKYVILMNCYSQYFICKLCLYKKVLTMSFVQISNSSPFHFGVFVNIASNFKSMKGIVPIHYACPELHISCDALVTPWKSQDNCVKIYLNIRYMNAPIRFM
ccccccccccccccccccccEEcccccccccccEEEcccccEEEcccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccEEEEEEEcccccccccccccccEEEEEcccccEEEEEEEEEccEEEEEEEEEccccccEEEEEEEEccccEEEEccccEEEEccccccccccccccccccccEEEEEEEEEEEccccccc
cccccccccccccHHHHHHHcccccccccccccEEEcccccEEEEcccccHHccccccccccccHHHHHHHHHHHHHHccccccccccccccEEcccccHHHHHHccccccccccccccccccHHHHHHHHHHcccEEEccccEEEEEEEEccccccEccccHccEEEEEHccccEEEEEEEEHHHHcEEEEEEHHccccccccEEEEEccccccccccccccccccEEEEEccEEEcccccccccEEEEEEEEEcccccEcc
lhckkepeccaNCKELIASISecgvclepldrgitscqtcgnlvctscaarllkcpfcritidySWQRNVALERIFtklelpcrnfrfgckvylpkakrdkhedkckfrqlkcpmhacpwtnsVLHLSEHLNQVHHLHLLkgngvnieisnfktkvsesetKVHKYVILMNCYSQYFICKLCLYKKVLTMSFVqisnsspfhFGVFVNIASNfksmkgivpihyacpelhiscdalvtpwksqdncVKIYLNIRymnapirfm
lhckkepecCANCKELIASISECGVCLEPLDRGITSCQTCGNLVCTSCAARLLKCPFCRITIDYSWQRNVALERIftklelpcrnfrfgckvylpkakrdkheDKCKFRQLKCPMHACPWTNSVLHLSEHLNQVHHLHLLKGNGVNIEISNFKTKVSESETKVHKYVILMNCYSQYFICKLCLYKKVLTMSFVQISNSSPFHFGVFVNIASNFKSMKGIVPIHYACPELHISCDALVTPWKSQDNCVKIYLNIRYmnapirfm
LHCKKEPECCANCKELIASISECGVCLEPLDRGITSCQTCGNLVCTSCAARLLKCPFCRITIDYSWQRNVALERIFTKLELPCRNFRFGCKVYLPKAKRDKHEDKCKFRQLKCPMHACPWTNSVLHLSEHLNQVHHLHLLKGNGVNIEISNFKTKVSESETKVHKYVILMNCYSQYFICKLCLYKKVLTMSFVQISNSSPFHFGVFVNIASNFKSMKGIVPIHYACPELHISCDALVTPWKSQDNCVKIYLNIRYMNAPIRFM
*******ECCANCKELIASISECGVCLEPLDRGITSCQTCGNLVCTSCAARLLKCPFCRITIDYSWQRNVALERIFTKLELPCRNFRFGCKVYLPKAKRDKHEDKCKFRQLKCPMHACPWTNSVLHLSEHLNQVHHLHLLKGNGVNIEISNFKTKVSESETKVHKYVILMNCYSQYFICKLCLYKKVLTMSFVQISNSSPFHFGVFVNIASNFKSMKGIVPIHYACPELHISCDALVTPWKSQDNCVKIYLNIRYMNAPI***
******************SISECGVCLEPLDRGITSCQTCGNLVCTSCAARLLKCPFCRITIDYSWQRNVALERIFTKLELPCRNFRFGCKVYLPKAKRDKHEDKCKFRQLKCPMHACPWTNSVLHLSEHLNQVHHLHLLKGNGVNIEISNFKTKVSESETKVHKYVILMNCYSQYFICKLCLYKKVLTMSFVQISNSSPFHFGVFVNIASNFKSMKGIVPIHYACPELHISCDALVTPWKSQDNCVKIYLNIRYMNAPIRFM
LHCKKEPECCANCKELIASISECGVCLEPLDRGITSCQTCGNLVCTSCAARLLKCPFCRITIDYSWQRNVALERIFTKLELPCRNFRFGCKVYLPKAKRDKHEDKCKFRQLKCPMHACPWTNSVLHLSEHLNQVHHLHLLKGNGVNIEISNFKTKVSESETKVHKYVILMNCYSQYFICKLCLYKKVLTMSFVQISNSSPFHFGVFVNIASNFKSMKGIVPIHYACPELHISCDALVTPWKSQDNCVKIYLNIRYMNAPIRFM
**********ANCKELIASISECGVCLEPLDRGITSCQTCGNLVCTSCAARLLKCPFCRITIDYSWQRNVALERIFTKLELPCRNFRFGCKVYLPKAKRDKHEDKCKFRQLKCPMHACPWTNSVLHLSEHLNQVHHLHLLKGNGVNIEISNFKTKVSESETKVHKYVILMNCYSQYFICKLCLYKKVLTMSFVQISNSSPFHFGVFVNIASNFKSMKGIVPIHYACPELHISCDALVTPWKSQDNCVKIYLNIRYMNAPIRFM
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LHCKKEPECCANCKELIASISECGVCLEPLDRGITSCQTCGNLVCTSCAARLLKCPFCRITIDYSWQRNVALERIFTKLELPCRNFRFGCKVYLPKAKRDKHEDKCKFRQLKCPMHACPWTNSVLHLSEHLNQVHHLHLLKGNGVNIEISNFKTKVSESETKVHKYVILMNCYSQYFICKLCLYKKVLTMSFVQISNSSPFHFGVFVNIASNFKSMKGIVPIHYACPELHISCDALVTPWKSQDNCVKIYLNIRYMNAPIRFM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query263 2.2.26 [Sep-21-2011]
Q06985282 E3 ubiquitin-protein liga yes N/A 0.593 0.553 0.291 8e-14
Q920M9282 E3 ubiquitin-protein liga yes N/A 0.593 0.553 0.285 1e-13
P61092282 E3 ubiquitin-protein liga yes N/A 0.593 0.553 0.285 1e-13
Q8IUQ4282 E3 ubiquitin-protein liga yes N/A 0.593 0.553 0.285 2e-13
Q7ZVG6282 E3 ubiquitin-protein liga yes N/A 0.593 0.553 0.291 2e-13
Q9I8X5313 E3 ubiquitin-protein liga N/A N/A 0.585 0.492 0.278 3e-13
Q8T3Y0351 Probable E3 ubiquitin-pro yes N/A 0.604 0.452 0.263 4e-13
O43255324 E3 ubiquitin-protein liga no N/A 0.596 0.484 0.279 9e-13
Q8R4T2325 E3 ubiquitin-protein liga no N/A 0.596 0.483 0.279 1e-12
Q06986325 E3 ubiquitin-protein liga no N/A 0.596 0.483 0.279 1e-12
>sp|Q06985|SIA1B_MOUSE E3 ubiquitin-protein ligase SIAH1B OS=Mus musculus GN=Siah1b PE=2 SV=2 Back     alignment and function desciption
 Score = 77.8 bits (190), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 86/168 (51%), Gaps = 12/168 (7%)

Query: 17  IASISECGVCLEPLDRGITSCQTCGNLVCTSCAARLLKCPFCRITIDYSWQRNVALERIF 76
           +AS+ EC VC + +   I  CQ+ G+LVC++C  +L  CP CR  +     RN+A+E++ 
Sbjct: 35  LASLFECPVCFDYVLPPILQCQS-GHLVCSNCRPKLTCCPTCRGPLGSI--RNLAVEKVA 91

Query: 77  TKLELPCRNFRFGCKVYLPKAKRDKHEDKCKFRQLK--CPMHACPWTNSVLHLSEHLNQV 134
             +  PC+    GC++ LP  K+ +HE+ C+FR     CP  +C W  S+  +  HL   
Sbjct: 92  NSVLFPCKYSASGCEITLPHTKKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQ 151

Query: 135 H-HLHLLKGNGVNIEISNFKTKVSESETKVHKYVILMNCYSQYFICKL 181
           H  +  L+G  +    ++              +V++ +C+  +F+  L
Sbjct: 152 HKSITTLQGEDIVFLATDINLP------GAVDWVMMQSCFGFHFMLVL 193
E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates E3 ubiquitin ligase activity either through direct binding to substrates or by functioning as the essential RING domain subunit of larger E3 complexes. Confers constitutive instability to HIPK2 through proteasomal degradation. Probably triggers the ubiquitin-mediated degradation of many substrates. Upon nitric oxid (NO) generation that follows apoptotic stimulation, interacts with S-nitrosylated GAPDH, mediating the translocation of GAPDH to the nucleus. GAPDH acts as a stabilizer of SIAH1, facilitating the degradation of nuclear proteins.
Mus musculus (taxid: 10090)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q920M9|SIAH1_RAT E3 ubiquitin-protein ligase SIAH1 OS=Rattus norvegicus GN=Siah1 PE=1 SV=2 Back     alignment and function description
>sp|P61092|SIA1A_MOUSE E3 ubiquitin-protein ligase SIAH1A OS=Mus musculus GN=Siah1a PE=1 SV=1 Back     alignment and function description
>sp|Q8IUQ4|SIAH1_HUMAN E3 ubiquitin-protein ligase SIAH1 OS=Homo sapiens GN=SIAH1 PE=1 SV=2 Back     alignment and function description
>sp|Q7ZVG6|SIAH1_DANRE E3 ubiquitin-protein ligase Siah1 OS=Danio rerio GN=siah1 PE=2 SV=2 Back     alignment and function description
>sp|Q9I8X5|SIAH2_XENLA E3 ubiquitin-protein ligase siah2 OS=Xenopus laevis GN=siah2 PE=2 SV=1 Back     alignment and function description
>sp|Q8T3Y0|SINAL_DROME Probable E3 ubiquitin-protein ligase sinah OS=Drosophila melanogaster GN=sinah PE=1 SV=2 Back     alignment and function description
>sp|O43255|SIAH2_HUMAN E3 ubiquitin-protein ligase SIAH2 OS=Homo sapiens GN=SIAH2 PE=1 SV=1 Back     alignment and function description
>sp|Q8R4T2|SIAH2_RAT E3 ubiquitin-protein ligase SIAH2 OS=Rattus norvegicus GN=Siah2 PE=1 SV=2 Back     alignment and function description
>sp|Q06986|SIAH2_MOUSE E3 ubiquitin-protein ligase SIAH2 OS=Mus musculus GN=Siah2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query263
345479501 401 PREDICTED: hypothetical protein LOC10068 0.844 0.553 0.348 2e-31
357618447344 SINA2 [Danaus plexippus] 0.665 0.508 0.363 7e-23
195435938326 GK20883 [Drosophila willistoni] gi|27374 0.646 0.521 0.298 3e-15
395849909283 PREDICTED: E3 ubiquitin-protein ligase S 0.596 0.554 0.333 1e-14
321469580 509 hypothetical protein DAPPUDRAFT_304089 [ 0.494 0.255 0.353 1e-14
395839207284 PREDICTED: E3 ubiquitin-protein ligase S 0.604 0.559 0.317 3e-14
395839201284 PREDICTED: E3 ubiquitin-protein ligase S 0.604 0.559 0.317 4e-14
402909821276 PREDICTED: E3 ubiquitin-protein ligase S 0.593 0.565 0.303 1e-13
332247222272 PREDICTED: E3 ubiquitin-protein ligase S 0.593 0.573 0.309 2e-13
157123728284 seven in absentia, putative [Aedes aegyp 0.593 0.549 0.297 2e-13
>gi|345479501|ref|XP_003423961.1| PREDICTED: hypothetical protein LOC100680278 [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  142 bits (358), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 84/241 (34%), Positives = 137/241 (56%), Gaps = 19/241 (7%)

Query: 10  CANCKELIASISECGVCLEPLDRG-ITSCQTCGNLVCTSCAARLLKCPFCRITIDYSWQR 68
           C NC+ L ++++ECGVC E L    I +C  C N+VC SCA RL  C FCR T+    +R
Sbjct: 127 CRNCRAL-SNLTECGVCFESLQSNQIKACPVCANVVCVSCAVRLSSCAFCRSTL--PPER 183

Query: 69  NVALERIFTKLELPCRNFRFGCKVYLPKAKRDKHEDKCKFRQLKCPMHA--CPWTNSVLH 126
           N ALER+  +L LPC++ + GCK+ L    R  HE  C F  + CP+    C W  +V  
Sbjct: 184 NRALERLVDRLILPCKHSKSGCKILLDGESRFIHESICNFAPICCPVGRGICAWHGTVAS 243

Query: 127 LSEHLNQVHHLHLLKGNGVNIEISNFKTKVSESETKVHKYVILMNCYSQYFICKLCLYKK 186
           +  HL  VH+L  L+ +G+++EI +F++K   ++ +V  Y + ++CY Q F+ ++ L++ 
Sbjct: 244 VQSHLQAVHNLLPLRDHGISVEIHSFRSKAKANDGRV--YTVCLSCYDQLFVIRVVLHQN 301

Query: 187 VLTMSFVQISN-------SSPFHFGVFVNI-ASNFKSMKGIVPI---HYACPELHISCDA 235
            L + F ++ +       S P  +GV V I A   + ++G+VP      A  +++++ D 
Sbjct: 302 RLRLCFTRLGHATAQPVISRPARYGVSVIIRAHAGRRLRGLVPFGKYDRASRDVNVNIDN 361

Query: 236 L 236
           L
Sbjct: 362 L 362

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|357618447|gb|EHJ71419.1| SINA2 [Danaus plexippus] Back     alignment and taxonomy information
>gi|195435938|ref|XP_002065935.1| GK20883 [Drosophila willistoni] gi|27374388|gb|AAO01125.1| CG13030-PA [Drosophila willistoni] gi|194162020|gb|EDW76921.1| GK20883 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|395849909|ref|XP_003797551.1| PREDICTED: E3 ubiquitin-protein ligase SIAH1-like [Otolemur garnettii] Back     alignment and taxonomy information
>gi|321469580|gb|EFX80560.1| hypothetical protein DAPPUDRAFT_304089 [Daphnia pulex] Back     alignment and taxonomy information
>gi|395839207|ref|XP_003792489.1| PREDICTED: E3 ubiquitin-protein ligase SIAH1-like [Otolemur garnettii] Back     alignment and taxonomy information
>gi|395839201|ref|XP_003792487.1| PREDICTED: E3 ubiquitin-protein ligase SIAH1-like [Otolemur garnettii] Back     alignment and taxonomy information
>gi|402909821|ref|XP_003917603.1| PREDICTED: E3 ubiquitin-protein ligase SIAH1-like [Papio anubis] Back     alignment and taxonomy information
>gi|332247222|ref|XP_003272752.1| PREDICTED: E3 ubiquitin-protein ligase SIAH1-like [Nomascus leucogenys] Back     alignment and taxonomy information
>gi|157123728|ref|XP_001653865.1| seven in absentia, putative [Aedes aegypti] gi|108874285|gb|EAT38510.1| AAEL009614-PA [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query263
UNIPROTKB|G3X7V0281 G3X7V0 "Uncharacterized protei 0.589 0.551 0.310 7.5e-18
MGI|MGI:108063282 Siah1b "seven in absentia 1B" 0.479 0.446 0.340 9.5e-18
FB|FBgn0259794351 sinah "sina homologue" [Drosop 0.600 0.450 0.276 1.3e-17
MGI|MGI:108064282 Siah1a "seven in absentia 1A" 0.479 0.446 0.333 2e-17
RGD|620449282 Siah1a "seven in absentia 1A" 0.479 0.446 0.333 2e-17
UNIPROTKB|Q920M9282 Siah1 "E3 ubiquitin-protein li 0.479 0.446 0.333 2e-17
TAIR|locus:2153774276 AT5G37910 [Arabidopsis thalian 0.798 0.760 0.301 2.5e-17
UNIPROTKB|F1P2G0282 SIAH1 "Uncharacterized protein 0.479 0.446 0.333 3.2e-17
UNIPROTKB|F1N5G3313 SIAH1 "Uncharacterized protein 0.479 0.402 0.333 3.2e-17
UNIPROTKB|F1PEG8308 SIAH1 "Uncharacterized protein 0.479 0.409 0.333 3.2e-17
UNIPROTKB|G3X7V0 G3X7V0 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 217 (81.4 bits), Expect = 7.5e-18, P = 7.5e-18
 Identities = 51/164 (31%), Positives = 87/164 (53%)

Query:    17 IASISECGVCLEPLDRGITSCQTCGNLVCTSCAARLLKCPFCRITIDYSWQRNVALERIF 76
             +AS+ EC VC + +   I  CQ+ G+LVC SC  +L  CP CR  +     RN+A+E++ 
Sbjct:    33 LASLFECPVCFDYVLPPIIQCQS-GHLVCGSCRPKLTSCPTCRGPLTSI--RNLAMEKLA 89

Query:    77 TKLELPCRNFRFGCKVYLPKAKRDKHEDKCKFRQLKCPMH--ACPWTNSVLHLSEHLNQV 134
               +  PC+    GC+V +P  ++  HE+ C+FR  +CP    +C W  S+  +  HL Q 
Sbjct:    90 NSVLFPCKYASSGCEVTMPPTEKADHEEHCEFRPCRCPCPGTSCGWQGSMDAVVPHLMQH 149

Query:   135 HHLHLLKGNGVNIEISNFKTKVSESETKVHKYVILMNCYSQYFI 178
             ++  ++   G   E+  F   V+ +      +V++ +C+   FI
Sbjct:   150 YNESIITLQG---EVVVFLA-VNINLAGALDWVMIQSCFGFNFI 189
GO:0008270 "zinc ion binding" evidence=IEA
GO:0007275 "multicellular organismal development" evidence=IEA
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0004842 "ubiquitin-protein ligase activity" evidence=IEA
MGI|MGI:108063 Siah1b "seven in absentia 1B" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0259794 sinah "sina homologue" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:108064 Siah1a "seven in absentia 1A" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620449 Siah1a "seven in absentia 1A" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q920M9 Siah1 "E3 ubiquitin-protein ligase SIAH1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
TAIR|locus:2153774 AT5G37910 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1P2G0 SIAH1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1N5G3 SIAH1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PEG8 SIAH1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query263
pfam03145198 pfam03145, Sina, Seven in absentia protein family 1e-13
>gnl|CDD|190542 pfam03145, Sina, Seven in absentia protein family Back     alignment and domain information 
 Score = 67.4 bits (165), Expect = 1e-13
 Identities = 33/122 (27%), Positives = 58/122 (47%), Gaps = 15/122 (12%)

Query: 68  RNVALERIFTKLELPCRNFRFGCKVYLPKAKRDKHEDKCKFRQLKCPMHA--CPWTNSVL 125
           RN+A+E++ +K+  PC++   GC V LP   +D HE++C+++   CPM    C W     
Sbjct: 2   RNLAVEKVASKVLFPCKHAALGCPVRLPLQLKDWHEERCEYKPYFCPMPGAKCKWQGDED 61

Query: 126 HLSEHLNQVHHLHLLKGNGVNIEISNFKTKVSESETKVHKYVILM---NCYSQYFICKLC 182
            L  HL   H +   +G   +I        ++ +   V     +M   +C+ ++F     
Sbjct: 62  DLMPHLTADHKVITTEGGEFDI------VYLAAAVNLVGAPTWVMVQFSCFGRHF----N 111

Query: 183 LY 184
           LY
Sbjct: 112 LY 113

The seven in absentia (sina) gene was first identified in Drosophila. The Drosophila Sina protein is essential for the determination of the R7 pathway in photoreceptor cell development: the loss of functional Sina results in the transformation of the R7 precursor cell to a non- neuronal cell type. The Sina protein contains an N-terminal RING finger domain pfam00097. Through this domain, Sina binds E2 ubiquitin-conjugating enzymes (UbcD1) Sina also interacts with Tramtrack (TTK88) via PHYL. Tramtrack is a transcriptional repressor that blocks photoreceptor determination, while PHYL down-regulates the activity of TTK88. In turn, the activity of PHYL requires the activation of the Sevenless receptor tyrosine kinase, a process essential for R7 determination. It is thought that thus Sina targets TTK88 for degradation, therefore promoting the R7 pathway. Murine and human homologues of Sina have also been identified. The human homologue Siah-1 also binds E2 enzymes (UbcH5) and through a series of physical interactions, targets beta-catenin for ubiquitin degradation. Siah-1 expression is enhanced by p53, itself promoted by DNA damage. Thus this pathway links DNA damage to beta-catenin degradation. Sina proteins, therefore, physically interact with a variety of proteins. The N-terminal RING finger domain that binds ubiquitin conjugating enzymes is described in pfam00097, and does not form part of the alignment for this family. The remainder C-terminal part is involved in interactions with other proteins, and is included in this alignment. In addition to the Drosophila protein and mammalian homologues, whose similarity was noted previously, this family also includes putative homologues from Caenorhabditis elegans, Arabidopsis thaliana. Length = 198

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 263
KOG3002|consensus299 100.0
PF03145198 Sina: Seven in absentia protein family; InterPro: 99.94
cd03829127 Sina Seven in absentia (Sina) protein family, C-te 99.53
KOG0297|consensus 391 99.36
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.79
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.47
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.43
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.4
KOG0320|consensus187 98.33
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.31
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.29
KOG0287|consensus 442 98.21
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.16
KOG0823|consensus230 98.13
PF0217660 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 98.13
PF1463444 zf-RING_5: zinc-RING finger domain 98.04
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.94
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 97.94
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 97.91
cd0016245 RING RING-finger (Really Interesting New Gene) dom 97.79
PHA02929238 N1R/p28-like protein; Provisional 97.76
KOG0317|consensus293 97.75
KOG2177|consensus 386 97.55
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.52
PHA02926242 zinc finger-like protein; Provisional 97.49
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.45
KOG2164|consensus513 97.43
KOG0311|consensus381 97.35
KOG0978|consensus698 97.26
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.21
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 97.15
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 97.1
PLN03086567 PRLI-interacting factor K; Provisional 96.74
COG5152259 Uncharacterized conserved protein, contains RING a 96.72
PF0217660 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 96.48
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 96.39
KOG4159|consensus398 96.25
KOG2660|consensus331 96.17
KOG1813|consensus313 96.13
COG5222427 Uncharacterized conserved protein, contains RING Z 96.03
PLN03086567 PRLI-interacting factor K; Provisional 95.56
KOG2879|consensus298 95.54
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 95.15
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 94.71
KOG0824|consensus324 94.59
PF0797551 C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al 94.26
KOG4172|consensus62 94.21
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 93.81
KOG0802|consensus543 93.14
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 92.8
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 92.76
KOG4739|consensus233 92.65
KOG4275|consensus350 92.43
KOG1002|consensus791 92.25
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 92.03
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 91.95
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 91.57
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 88.27
COG52191525 Uncharacterized conserved protein, contains RING Z 87.96
KOG4265|consensus349 87.66
PF04641260 Rtf2: Rtf2 RING-finger 87.37
COG5175 480 MOT2 Transcriptional repressor [Transcription] 87.18
KOG4367|consensus 699 86.79
COG5236 493 Uncharacterized conserved protein, contains RING Z 86.15
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 86.09
PRK04023 1121 DNA polymerase II large subunit; Validated 85.95
KOG1039|consensus344 85.94
KOG1571|consensus355 85.89
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 85.56
KOG1785|consensus563 85.19
PF14319111 Zn_Tnp_IS91: Transposase zinc-binding domain 84.02
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 84.01
KOG4185|consensus296 83.55
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 83.44
KOG1645|consensus 463 82.9
KOG3039|consensus303 82.55
PF0136369 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc f 81.22
KOG0804|consensus493 80.58
>KOG3002|consensus Back     alignment and domain information 
Probab=100.00  E-value=3.7e-36  Score=274.89  Aligned_cols=222  Identities=23%  Similarity=0.456  Sum_probs=186.4

Q ss_pred             hcCCceeeeccccCccccccccccCCCceecccccccc-CCCCCCccCCcccccccHHHHHhhhcceecCCCCCCCceee
Q psy12127         15 ELIASISECGVCLEPLDRGITSCQTCGNLVCTSCAARL-LKCPFCRITIDYSWQRNVALERIFTKLELPCRNFRFGCKVY   93 (263)
Q Consensus        15 ~~l~~~l~CpIC~~~l~~Pv~qC~~CGH~~C~~C~~~l-~~CP~Cr~~~~~~~~rn~~le~~v~~l~v~C~~~~~GC~~~   93 (263)
                      ..+.++|+||||.+++.+||+||.+ ||+.|++|..++ ++||.||.+++  .+|+++||++++++.++|+|+..||++.
T Consensus        43 ~~~~~lleCPvC~~~l~~Pi~QC~n-GHlaCssC~~~~~~~CP~Cr~~~g--~~R~~amEkV~e~~~vpC~~~~~GC~~~  119 (299)
T KOG3002|consen   43 LLDLDLLDCPVCFNPLSPPIFQCDN-GHLACSSCRTKVSNKCPTCRLPIG--NIRCRAMEKVAEAVLVPCKNAKLGCTKS  119 (299)
T ss_pred             ccchhhccCchhhccCcccceecCC-CcEehhhhhhhhcccCCccccccc--cHHHHHHHHHHHhceecccccccCCcee
Confidence            3467899999999999999999999 999999999765 69999999999  8999999999999999999999999999


Q ss_pred             eccchhhhhhcccCCceecCCCC--CCCCccChhhHHHHHhcccCc--ceeeCCeEEEeecccccccccCcccceeEEEE
Q psy12127         94 LPKAKRDKHEDKCKFRQLKCPMH--ACPWTNSVLHLSEHLNQVHHL--HLLKGNGVNIEISNFKTKVSESETKVHKYVIL  169 (263)
Q Consensus        94 ~~~~~~~~He~~C~~~~~~CP~~--~C~~~g~~~~L~~Hl~~~H~~--~~~~g~~~~~~i~nf~~~~n~~~~~~~~~~~l  169 (263)
                      ++|.+..+||+.|.|+|+.||.+  .|+|.|..++|..|+...|+.  ....+..+.+.    +++.+  +.+..+|++.
T Consensus       120 ~~Y~~~~~HE~~C~f~~~~CP~p~~~C~~~G~~~~l~~H~~~~hk~~~~~~~~~~~~~~----~~~~~--~~~~~~~~~~  193 (299)
T KOG3002|consen  120 FPYGEKSKHEKVCEFRPCSCPVPGAECKYTGSYKDLYAHLNDTHKSDIITLTGFDFVFV----ATDEN--LLGAATWTLK  193 (299)
T ss_pred             eccccccccccccccCCcCCCCCcccCCccCcHHHHHHHHHhhChhhhhhccccceecc----cCCcc--ccccchhhee
Confidence            99999999999999999999997  999999999999999999994  44555555555    56666  6778899766


Q ss_pred             Ee-ecCceEEEEEecc---C-CeEEEEEEeeeC----CCCceEEEEEEeeccccccCCceeeeeecceee-------eec
Q psy12127        170 MN-CYSQYFICKLCLY---K-KVLTMSFVQISN----SSPFHFGVFVNIASNFKSMKGIVPIHYACPELH-------ISC  233 (263)
Q Consensus       170 ~~-~~g~~F~l~~~~~---~-~~~~v~~v~~~~----~~~~~y~~~l~~~~~~~~~~g~~~~~~q~~~~~-------v~~  233 (263)
                      +. ++|+.|++.++.+   + +.++|++.++++    +.+|.|++++....+..+|.|.+|+.-|+....       +-.
T Consensus       194 ~~~~~~~~~~~~~~~q~~~~~~~~y~tv~~i~~~~~e~~~fsy~L~~~~~~~klt~~s~~~s~~~kvs~~~p~~dfm~ip  273 (299)
T KOG3002|consen  194 TSVCFGREFGLLFEVQCFREPHGVYVTVNRIAPSAPEAGEFSYSLALGGSGRKLTWQSPPRSIIQKVSKVRPEDDFMLIP  273 (299)
T ss_pred             eeecCcEEEeeeeeehhhcCCCceEEEeehhccCCCcccccceeeecCCCCceEeecCCcceeecccceeccCCCceecc
Confidence            66 8999999988653   2 369999999755    346889999876666678999988888877733       334


Q ss_pred             ccCCCCCCCCCc
Q psy12127        234 DALVTPWKSQDN  245 (263)
Q Consensus       234 ~~l~~~~~~~~~  245 (263)
                      .+|+.+++..+-
T Consensus       274 ~~~~~~~~~~~~  285 (299)
T KOG3002|consen  274 RSLLCLFSLLKM  285 (299)
T ss_pred             HHHhhcccccCC
Confidence            445666666554

>PF03145 Sina: Seven in absentia protein family; InterPro: IPR018121 The seven in absentia (sina) gene was first identified in Drosophila Back     alignment and domain information
>cd03829 Sina Seven in absentia (Sina) protein family, C-terminal substrate binding domain; composed of the Drosophila Sina protein, the mammalian Sina homolog (Siah), the plant protein SINAT5, and similar proteins Back     alignment and domain information
>KOG0297|consensus Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0320|consensus Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0287|consensus Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG0823|consensus Back     alignment and domain information
>PF02176 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG0317|consensus Back     alignment and domain information
>KOG2177|consensus Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG2164|consensus Back     alignment and domain information
>KOG0311|consensus Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>PF02176 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4159|consensus Back     alignment and domain information
>KOG2660|consensus Back     alignment and domain information
>KOG1813|consensus Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>KOG2879|consensus Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG0824|consensus Back     alignment and domain information
>PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair Back     alignment and domain information
>KOG4172|consensus Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG0802|consensus Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG4739|consensus Back     alignment and domain information
>KOG4275|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4265|consensus Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PRK04023 DNA polymerase II large subunit; Validated Back     alignment and domain information
>KOG1039|consensus Back     alignment and domain information
>KOG1571|consensus Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>KOG1785|consensus Back     alignment and domain information
>PF14319 Zn_Tnp_IS91: Transposase zinc-binding domain Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4185|consensus Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information
>PF01363 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query263
1k2f_A190 Siah, Seven In Absentia Homolog Length = 190 2e-04
2an6_A191 Protein-Peptide Complex Length = 191 2e-04
2a25_A193 Crystal Structure Of Siah1 Sbd Bound To The Peptide 2e-04
>pdb|1K2F|A Chain A, Siah, Seven In Absentia Homolog Length = 190 Back     alignment and structure 
Iteration: 1

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 49/104 (47%), Gaps = 9/104 (8%)
Query: 81  LPCRNFRFGCKVYLPKAKRDKHEDKCKFRQLK--CPMHACPWTNSVLHLSEHLNQVH-HL 137
            PC+    GC++ LP  ++ +HE+ C+FR     CP  +C W  S+  +  HL   H  +
Sbjct: 4   FPCKYASSGCEITLPHTEKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSI 63
Query: 138 HLLKGNGVNIEISNFKTKVSESETKVHKYVILMNCYSQYFICKL 181
             L+G  +    ++     +        +V++ +C+  +F+  L
Sbjct: 64  TTLQGEDIVFLATDINLPGAVD------WVMMQSCFGFHFMLVL 101
>pdb|2AN6|A Chain A, Protein-Peptide Complex Length = 191 Back     alignment and structure
>pdb|2A25|A Chain A, Crystal Structure Of Siah1 Sbd Bound To The Peptide Ekpaavvapittg From Sip Length = 193 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query263
2a25_A193 Ubiquitin ligase SIAH1; protein-peptide complex, l 1e-10
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 6e-04
>2a25_A Ubiquitin ligase SIAH1; protein-peptide complex, ligase; 2.20A {Homo sapiens} PDB: 2an6_A 1k2f_A Length = 193 Back     alignment and structure
 Score = 58.3 bits (140), Expect = 1e-10
 Identities = 24/104 (23%), Positives = 48/104 (46%), Gaps = 9/104 (8%)

Query: 78  KLELPCRNFRFGCKVYLPKAKRDKHEDKCKFRQLKC--PMHACPWTNSVLHLSEHLNQVH 135
            +  PC+    GC++ LP  ++  HE+ C+FR   C  P  +C W  S+  +  HL   H
Sbjct: 4   SVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQH 63

Query: 136 H-LHLLKGNGVNIEISNFKTKVSESETKVHKYVILMNCYSQYFI 178
             +  L+G  +    ++       +      +V++ +C+  +F+
Sbjct: 64  KSITTLQGEDIVFLATDI------NLPGAVDWVMMQSCFGFHFM 101
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query263
2a25_A193 Ubiquitin ligase SIAH1; protein-peptide complex, l 99.93
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 99.86
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.66
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.62
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.62
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.06
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.06
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.96
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.94
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.91
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.9
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.9
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.89
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.85
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.83
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.83
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.83
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.8
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.79
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.79
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.79
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.76
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.75
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.75
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.74
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.73
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.72
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.67
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.67
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.67
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.62
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.62
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.59
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.56
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.55
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.55
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.52
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.51
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.51
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.49
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.49
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.48
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.45
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.4
2ect_A78 Ring finger protein 126; metal binding protein, st 98.39
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.38
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.34
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.31
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.28
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.26
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.24
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.24
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.23
2ea5_A68 Cell growth regulator with ring finger domain prot 98.19
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.15
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.15
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.03
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 97.94
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 97.93
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.92
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 97.87
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 97.86
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 97.77
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 97.76
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 97.71
2yre_A100 F-box only protein 30; zinc binding, E3 ubiquitin 97.52
2yre_A100 F-box only protein 30; zinc binding, E3 ubiquitin 97.37
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.25
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 97.23
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 97.09
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 96.68
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 96.43
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.3
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 96.19
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 95.93
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 95.75
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 95.69
1z60_A59 TFIIH basal transcription factor complex P44 subun 93.76
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 93.73
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 91.77
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 91.51
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 89.08
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 88.47
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 87.21
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 86.59
3nw0_A238 Non-structural maintenance of chromosomes element 86.04
2jne_A101 Hypothetical protein YFGJ; zinc fingers, two zinc, 84.17
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 83.51
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 82.52
2jmo_A80 Parkin; IBR, E3 ligase, zinc binding domain, RBR; 80.95
2ct7_A86 Ring finger protein 31; IBR, structural genomics, 80.82
>2a25_A Ubiquitin ligase SIAH1; protein-peptide complex, ligase; 2.20A {Homo sapiens} PDB: 2an6_A 1k2f_A Back     alignment and structure
Probab=99.93  E-value=2.9e-27  Score=203.65  Aligned_cols=145  Identities=19%  Similarity=0.431  Sum_probs=82.9

Q ss_pred             hhhcceecCCCCCCCceeeeccchhhhhhcccCCceecCCCCC--CCCccChhhHHHHHhcccC-cceeeCCeEEEeecc
Q psy12127         75 IFTKLELPCRNFRFGCKVYLPKAKRDKHEDKCKFRQLKCPMHA--CPWTNSVLHLSEHLNQVHH-LHLLKGNGVNIEISN  151 (263)
Q Consensus        75 ~v~~l~v~C~~~~~GC~~~~~~~~~~~He~~C~~~~~~CP~~~--C~~~g~~~~L~~Hl~~~H~-~~~~~g~~~~~~i~n  151 (263)
                      +++++++||+|+.+||++.++|.++.+||++|+|+|+.||.++  |+|+|+.++|..|++.+|+ +.+.+|.++.+.   
T Consensus         1 v~~s~~~pC~~~~~GC~~~~~y~~~~~He~~C~f~p~~Cp~~g~~C~~~G~~~~l~~H~~~~H~~~~~~~g~~i~f~---   77 (193)
T 2a25_A            1 VANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFL---   77 (193)
T ss_dssp             -----------------------------------CEECCCC--CCCCEECSTTHHHHHHHHCTTSCEEESSEEEEE---
T ss_pred             CccceEecCCCCCCCCCcccccccccchhhcCCCCCccCCCCCCCCcCCCCHHHHHHHHHHHCCCcceecCceEEEE---
Confidence            4788999999999999999999999999999999999999965  9999999999999999998 788999998876   


Q ss_pred             cccccccCcccceeEEEEEeecCceEEEEEeccC----Ce-EEEE--EEee-eCCCCceEEEEEEeeccccccCCceeee
Q psy12127        152 FKTKVSESETKVHKYVILMNCYSQYFICKLCLYK----KV-LTMS--FVQI-SNSSPFHFGVFVNIASNFKSMKGIVPIH  223 (263)
Q Consensus       152 f~~~~n~~~~~~~~~~~l~~~~g~~F~l~~~~~~----~~-~~v~--~v~~-~~~~~~~y~~~l~~~~~~~~~~g~~~~~  223 (263)
                       ++++|  ++++.+|+++++++|++|+|++++.+    .. ++++  +++. +.+++|.|++++.++.+..+|++.+||.
T Consensus        78 -~~~~~--l~~~~~~~~v~~~~g~~Fll~~~~~~~~~g~~~~~~~V~~ig~~~ea~~f~Y~l~~~~~~r~L~~~~~~~s~  154 (193)
T 2a25_A           78 -ATDIN--LPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSI  154 (193)
T ss_dssp             -EECCC------CEEEEEEEETTEEEEEEEEEC------CEEEEEEEESSCHHHHTTEEEEEEEEETTEEEEEEECCEET
T ss_pred             -ecccc--cccceeEEEEEEecCceEEEEEEEeccCCCCcEEEEEEEEeCCcchhcceEEEEEEEcCCCEEEEEEEEEeh
Confidence             56666  77888999999999999999988754    22 2333  3443 3357899999998766666777777655


Q ss_pred             ee
Q psy12127        224 YA  225 (263)
Q Consensus       224 ~q  225 (263)
                      .+
T Consensus       155 ~e  156 (193)
T 2a25_A          155 HE  156 (193)
T ss_dssp             TT
T ss_pred             hh
Confidence            43
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>2yre_A F-box only protein 30; zinc binding, E3 ubiquitin ligase, SCF, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yre_A F-box only protein 30; zinc binding, E3 ubiquitin ligase, SCF, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1z60_A TFIIH basal transcription factor complex P44 subunit; basic transcription factor, zinc binding protein, ring finger; NMR {Homo sapiens} SCOP: g.49.1.2 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jne_A Hypothetical protein YFGJ; zinc fingers, two zinc, structural genomics, PSI-2, protein structure initiative; NMR {Escherichia coli} SCOP: g.41.18.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens} Back     alignment and structure
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 263
d1k2fa_190 b.8.1.2 (A:) SIAH, seven in absentia homolog {Mous 3e-11
>d1k2fa_ b.8.1.2 (A:) SIAH, seven in absentia homolog {Mouse (Mus musculus) [TaxId: 10090]} Length = 190 Back     information, alignment and structure

class: All beta proteins
fold: TRAF domain-like
superfamily: TRAF domain-like
family: SIAH, seven in absentia homolog
domain: SIAH, seven in absentia homolog
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 58.5 bits (141), Expect = 3e-11
 Identities = 24/103 (23%), Positives = 48/103 (46%), Gaps = 9/103 (8%)

Query: 79  LELPCRNFRFGCKVYLPKAKRDKHEDKCKFRQLKCPMHA--CPWTNSVLHLSEHLNQVHH 136
           +  PC+    GC++ LP  ++ +HE+ C+FR   CP     C W  S+  +  HL   H 
Sbjct: 2   VLFPCKYASSGCEITLPHTEKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHK 61

Query: 137 -LHLLKGNGVNIEISNFKTKVSESETKVHKYVILMNCYSQYFI 178
            +  L+G  +    ++       +      +V++ +C+  +F+
Sbjct: 62  SITTLQGEDIVFLATDI------NLPGAVDWVMMQSCFGFHFM 98

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query263
d1k2fa_190 SIAH, seven in absentia homolog {Mouse (Mus muscul 99.92
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.16
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.05
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.01
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.99
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.96
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.81
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.72
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.67
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.58
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.52
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.47
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.45
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.4
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 97.61
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 97.6
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 97.6
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 96.91
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 94.74
d2jnea171 Hypothetical protein YfgJ {Escherichia coli [TaxId 91.4
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 90.57
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 90.08
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 88.89
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 88.27
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 87.32
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 87.08
d2ct7a173 Ring finger protein 31 {Human (Homo sapiens) [TaxI 85.39
d1zbdb_124 Effector domain of rabphilin-3a {Rat (Rattus norve 84.66
d1joca164 Eea1 {Human (Homo sapiens) [TaxId: 9606]} 83.47
d1y02a251 Rififylin (FYVE-RING finger protein Sakura) {Human 80.41
>d1k2fa_ b.8.1.2 (A:) SIAH, seven in absentia homolog {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: TRAF domain-like
superfamily: TRAF domain-like
family: SIAH, seven in absentia homolog
domain: SIAH, seven in absentia homolog
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.92  E-value=1.4e-25  Score=190.52  Aligned_cols=147  Identities=20%  Similarity=0.424  Sum_probs=123.4

Q ss_pred             cceecCCCCCCCceeeeccchhhhhhcccCCceecCCC--CCCCCccChhhHHHHHhcccC-cceeeCCeEEEeeccccc
Q psy12127         78 KLELPCRNFRFGCKVYLPKAKRDKHEDKCKFRQLKCPM--HACPWTNSVLHLSEHLNQVHH-LHLLKGNGVNIEISNFKT  154 (263)
Q Consensus        78 ~l~v~C~~~~~GC~~~~~~~~~~~He~~C~~~~~~CP~--~~C~~~g~~~~L~~Hl~~~H~-~~~~~g~~~~~~i~nf~~  154 (263)
                      ++++||+|++.||+++++|.++.+||++|+|+|+.||.  .+|+|+|+.++|..|++..|+ +....|..+.++    ++
T Consensus         1 Sv~~pC~~~~~GC~~~~~~~~~~~HE~~C~~~p~~C~~~~~~C~~~G~~~~l~~Hl~~~H~~~~~~~~~~~~~~----~~   76 (190)
T d1k2fa_           1 SVLFPCKYASSGCEITLPHTEKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFL----AT   76 (190)
T ss_dssp             CCCCCCTTGGGTCCCCCCGGGHHHHHHTCTTSCEECCSSSTTCCCEECHHHHHHHHHHSSCCCEEEESSEEEEE----EC
T ss_pred             CeeEecCCCCCCCCEeccccchhhHHhcCCCcccCCCCCCCCCccCCCHhHHHHHHHhcCCcccccCccceEEe----ee
Confidence            57899999999999999999999999999999998876  669999999999999999999 677788888887    45


Q ss_pred             ccccCcccceeEEEEEeecCceEEEEEecc---CC-eEEEEEEee----eCCCCceEEEEEEeeccccccCCceeeeeec
Q psy12127        155 KVSESETKVHKYVILMNCYSQYFICKLCLY---KK-VLTMSFVQI----SNSSPFHFGVFVNIASNFKSMKGIVPIHYAC  226 (263)
Q Consensus       155 ~~n~~~~~~~~~~~l~~~~g~~F~l~~~~~---~~-~~~v~~v~~----~~~~~~~y~~~l~~~~~~~~~~g~~~~~~q~  226 (263)
                      +.+  +++...|++++.++|++|+|+++++   +. ..+++.++.    +.|++|.|++++.+++++.+|++.+||+.+.
T Consensus        77 ~~~--~~~~~~~v~~~~~~g~~F~l~~~~~~~~~~~~~~~~~v~~~G~~~~a~~f~Yel~l~~~~r~l~~~~~~~si~e~  154 (190)
T d1k2fa_          77 DIN--LPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEG  154 (190)
T ss_dssp             CTT--CTTCCEEEEEEEETTEEEEEEEEEEEETTTEEEEEEEEEESSCHHHHTTEEEEEEEEETTEEEEEEECCEETTTC
T ss_pred             ccc--cccceeEEEEEecCCCEEEEEEEEEeccCCCCeEEEEEEEECCHHHhhCccEEEEecCCCceEEEeccccccccc
Confidence            555  5677899999999999999998763   22 355666664    3478999999999888888899998777665


Q ss_pred             ceee
Q psy12127        227 PELH  230 (263)
Q Consensus       227 ~~~~  230 (263)
                      ....
T Consensus       155 ~~~~  158 (190)
T d1k2fa_         155 IATA  158 (190)
T ss_dssp             SHHH
T ss_pred             cccc
Confidence            5433
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure