Psyllid ID: psy12190

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-----
YIRIDGSVGSEERKSVVDQFQYEDKFRVAVLSITAANSGITLTAANLVVFAELFWNPGILTQAEDRAHRIGQQDSVLIQYLVAKQTADDYLWPLVMTKLDVPSPI
cEEEcccccHHHHHHHHHHHcccccEEEEEEEccccccccccccccEEEEEccccccccccHHHHHHHHccccccEEEEEEEEcccHHHHHHHHHHHHHcccccc
cccccccccHHHHHHHHHHHcccccEEEEEEEEcccccEEEEccccEEEEEEccccHHHHHHHHHHHHHccccEEEEEEEEEEcccHHHHHHHHHHHHHHHHccc
yiridgsvgseerkSVVDQFQYEDKFRVAVLSITAANSGITLTAANLVVFAELfwnpgiltqaedrahrigqQDSVLIQYLVAKQtaddylwplvmtkldvpspi
yiridgsvgseerksvvDQFQYEDKFRVAVLSITAANSGITLTAANLVVFAELFWNPGILTQAEDRAHRIGQQDSVLIQYLVAKQTADDYLWPLVMTKLDVPSPI
YIRIDGSVGSEERKSVVDQFQYEDKFRVAVLSITAANSGITLTAANLVVFAELFWNPGILTQAEDRAHRIGQQDSVLIQYLVAKQTADDYLWPLVMTKLDVPSPI
***************VVDQFQYEDKFRVAVLSITAANSGITLTAANLVVFAELFWNPGILTQAEDRAHRIGQQDSVLIQYLVAKQTADDYLWPLVMTKL******
YIRIDGSVGSEERKSVVDQFQYEDKFRVAVLSITAANSGITLTAANLVVFAELFWNPGILTQAEDRAHRIGQQDSVLIQYLVAKQTADDYLWPLVMTKLDVP***
**************SVVDQFQYEDKFRVAVLSITAANSGITLTAANLVVFAELFWNPGILTQAEDRAHRIGQQDSVLIQYLVAKQTADDYLWPLVMTKLDVPSPI
***IDGSVGSEERKSVVDQFQYEDKFRVAVLSITAANSGITLTAANLVVFAELFWNPGILTQAEDRAHRIGQQDSVLIQYLVAKQTADDYLWPLVMTKLDVP***
iiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YIRIDGSVGSEERKSVVDQFQYEDKFRVAVLSITAANSGITLTAANLVVFAELFWNPGILTQAEDRAHRIGQQDSVLIQYLVAKQTADDYLWPLVMTKLDVPSPI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query105 2.2.26 [Sep-21-2011]
Q498E7960 SWI/SNF-related matrix-as N/A N/A 0.961 0.105 0.663 6e-35
Q0P4U8942 SWI/SNF-related matrix-as yes N/A 0.961 0.107 0.663 1e-34
Q9NZC9954 SWI/SNF-related matrix-as yes N/A 0.961 0.105 0.663 2e-34
B4F769910 SWI/SNF-related matrix-as yes N/A 0.961 0.110 0.653 3e-33
Q8MNV7690 Putative SMARCAL1-like pr yes N/A 0.952 0.144 0.65 1e-32
B2ZFP3807 SWI/SNF-related matrix-as yes N/A 0.961 0.125 0.643 2e-32
Q8BJL0910 SWI/SNF-related matrix-as yes N/A 0.961 0.110 0.633 5e-32
Q9TTA5941 SWI/SNF-related matrix-as yes N/A 0.952 0.106 0.603 2e-29
Q6NZP1 1069 DNA annealing helicase an no N/A 0.961 0.094 0.584 4e-27
Q5FWF4 1079 DNA annealing helicase an no N/A 0.961 0.093 0.584 8e-27
>sp|Q498E7|SMAL1_XENLA SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Xenopus laevis GN=smarcal1 PE=2 SV=1 Back     alignment and function desciption
 Score =  145 bits (367), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 82/101 (81%)

Query: 1   YIRIDGSVGSEERKSVVDQFQYEDKFRVAVLSITAANSGITLTAANLVVFAELFWNPGIL 60
           YIRIDG+  S +R+S+  +FQ+ +K  VAVLSITAAN G+TL++A+LVVFAELFWNPG+L
Sbjct: 773 YIRIDGNTSSADRQSLCHKFQFSEKSCVAVLSITAANMGLTLSSADLVVFAELFWNPGVL 832

Query: 61  TQAEDRAHRIGQQDSVLIQYLVAKQTADDYLWPLVMTKLDV 101
            QAEDR HRIGQ  SV I YLVAK TADDYLWP++  K+ V
Sbjct: 833 IQAEDRVHRIGQTSSVNIHYLVAKGTADDYLWPMIQEKIKV 873
ATP-dependent annealing helicase that catalyzes the rewinding of the stably unwound DNA. Rewinds single-stranded DNA bubbles that are stably bound by replication protein A (RPA). Acts throughout the genome to reanneal stably unwound DNA, performing the opposite reaction of many enzymes, such as helicases and polymerases, that unwind DNA.
Xenopus laevis (taxid: 8355)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: -
>sp|Q0P4U8|SMAL1_XENTR SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Xenopus tropicalis GN=smarcal1 PE=2 SV=1 Back     alignment and function description
>sp|Q9NZC9|SMAL1_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Homo sapiens GN=SMARCAL1 PE=1 SV=1 Back     alignment and function description
>sp|B4F769|SMAL1_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Rattus norvegicus GN=Smarcal1 PE=2 SV=1 Back     alignment and function description
>sp|Q8MNV7|SMAL1_CAEEL Putative SMARCAL1-like protein OS=Caenorhabditis elegans GN=C16A3.1 PE=3 SV=1 Back     alignment and function description
>sp|B2ZFP3|SMAL1_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Danio rerio GN=smarcal1 PE=2 SV=1 Back     alignment and function description
>sp|Q8BJL0|SMAL1_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Mus musculus GN=Smarcal1 PE=2 SV=1 Back     alignment and function description
>sp|Q9TTA5|SMAL1_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Bos taurus GN=SMARCAL1 PE=2 SV=1 Back     alignment and function description
>sp|Q6NZP1|ZRAB3_MOUSE DNA annealing helicase and endonuclease ZRANB3 OS=Mus musculus GN=Zranb3 PE=1 SV=1 Back     alignment and function description
>sp|Q5FWF4|ZRAB3_HUMAN DNA annealing helicase and endonuclease ZRANB3 OS=Homo sapiens GN=ZRANB3 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query105
328697302 656 PREDICTED: SWI/SNF-related matrix-associ 0.961 0.153 0.762 2e-39
427785507 678 Putative chromatin remodeling protein ha 0.961 0.148 0.732 2e-38
241855293 675 conserved hypothetical protein [Ixodes s 0.980 0.152 0.718 2e-37
307191279 670 SWI/SNF-related matrix-associated actin- 0.961 0.150 0.722 3e-37
383861210 675 PREDICTED: SWI/SNF-related matrix-associ 0.961 0.149 0.722 4e-37
350402620 704 PREDICTED: SWI/SNF-related matrix-associ 0.961 0.143 0.742 8e-37
340711952 703 PREDICTED: SWI/SNF-related matrix-associ 0.961 0.143 0.742 1e-36
307209215 670 SWI/SNF-related matrix-associated actin- 0.961 0.150 0.712 2e-36
443705177 568 hypothetical protein CAPTEDRAFT_109109 [ 0.961 0.177 0.722 3e-36
328778817 673 PREDICTED: SWI/SNF-related matrix-associ 0.961 0.150 0.693 3e-35
>gi|328697302|ref|XP_001945056.2| PREDICTED: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  166 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 77/101 (76%), Positives = 87/101 (86%)

Query: 1   YIRIDGSVGSEERKSVVDQFQYEDKFRVAVLSITAANSGITLTAANLVVFAELFWNPGIL 60
           YIRIDG   SEERK V DQFQ ED +RVAVLSI AANSGITLTAA LV+FAEL+WNPGIL
Sbjct: 493 YIRIDGKTSSEERKCVCDQFQSEDMYRVAVLSICAANSGITLTAAKLVIFAELYWNPGIL 552

Query: 61  TQAEDRAHRIGQQDSVLIQYLVAKQTADDYLWPLVMTKLDV 101
           TQAEDRAHRIGQ ++V IQYL+AK TADD++WPL+ +KL V
Sbjct: 553 TQAEDRAHRIGQAETVTIQYLLAKGTADDHIWPLIQSKLSV 593

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|427785507|gb|JAA58205.1| Putative chromatin remodeling protein harp/smarcal1 dead-box superfamily [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|241855293|ref|XP_002416013.1| conserved hypothetical protein [Ixodes scapularis] gi|215510227|gb|EEC19680.1| conserved hypothetical protein [Ixodes scapularis] Back     alignment and taxonomy information
>gi|307191279|gb|EFN74926.1| SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383861210|ref|XP_003706079.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350402620|ref|XP_003486546.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340711952|ref|XP_003394530.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307209215|gb|EFN86322.1| SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|443705177|gb|ELU01833.1| hypothetical protein CAPTEDRAFT_109109 [Capitella teleta] Back     alignment and taxonomy information
>gi|328778817|ref|XP_624010.3| PREDICTED: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1-like [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query105
UNIPROTKB|F1P0X4704 SMARCAL1 "Uncharacterized prot 0.961 0.143 0.663 1.2e-31
UNIPROTKB|Q498E7960 smarcal1 "SWI/SNF-related matr 0.961 0.105 0.663 8.7e-31
UNIPROTKB|H7BYI2796 SMARCAL1 "SWI/SNF-related matr 0.961 0.126 0.663 2e-30
UNIPROTKB|Q0P4U8942 smarcal1 "SWI/SNF-related matr 0.961 0.107 0.663 2.3e-30
UNIPROTKB|Q9NZC9954 SMARCAL1 "SWI/SNF-related matr 0.961 0.105 0.663 3e-30
UNIPROTKB|E2RGL2961 SMARCAL1 "Uncharacterized prot 0.961 0.105 0.663 3.9e-30
WB|WBGene00015806690 C16A3.1 [Caenorhabditis elegan 0.952 0.144 0.65 2.1e-29
UNIPROTKB|Q8MNV7690 C16A3.1 "Putative SMARCAL1-lik 0.952 0.144 0.65 2.1e-29
RGD|1306134910 Smarcal1 "Swi/SNF related matr 0.961 0.110 0.653 4.1e-29
ZFIN|ZDB-GENE-041210-303807 smarcal1 "SWI/SNF related, mat 0.961 0.125 0.643 1.1e-28
UNIPROTKB|F1P0X4 SMARCAL1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 355 (130.0 bits), Expect = 1.2e-31, P = 1.2e-31
 Identities = 67/101 (66%), Positives = 83/101 (82%)

Query:     1 YIRIDGSVGSEERKSVVDQFQYEDKFRVAVLSITAANSGITLTAANLVVFAELFWNPGIL 60
             YIRIDGS  S ER+S+  +FQ+ +K  VAVLS+TAAN G+TL+AA+LVVFAELFWNPG+L
Sbjct:   514 YIRIDGSTSSAERQSLCQKFQFSEKQAVAVLSLTAANMGLTLSAADLVVFAELFWNPGVL 573

Query:    61 TQAEDRAHRIGQQDSVLIQYLVAKQTADDYLWPLVMTKLDV 101
              QAEDRAHRIGQ  SV + YLVA+ TADD+LWP++  K+ V
Sbjct:   574 IQAEDRAHRIGQTSSVNVHYLVARGTADDFLWPMIQEKIKV 614
GO:0003677 "DNA binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0016568 "chromatin modification" evidence=IEA
GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=IEA
GO:0008094 "DNA-dependent ATPase activity" evidence=IEA
GO:0036310 "annealing helicase activity" evidence=IEA
UNIPROTKB|Q498E7 smarcal1 "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|H7BYI2 SMARCAL1 "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q0P4U8 smarcal1 "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NZC9 SMARCAL1 "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RGL2 SMARCAL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
WB|WBGene00015806 C16A3.1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q8MNV7 C16A3.1 "Putative SMARCAL1-like protein" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
RGD|1306134 Smarcal1 "Swi/SNF related matrix associated, actin dependent regulator of chromatin, subfamily a-like 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041210-303 smarcal1 "SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a-like 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9VMX6SMAL1_DROME3, ., 6, ., 4, ., -0.54281.00.1390yesN/A
Q8BJL0SMAL1_MOUSE3, ., 6, ., 4, ., -0.63360.96190.1109yesN/A
Q8MNV7SMAL1_CAEEL3, ., 6, ., 4, ., -0.650.95230.1449yesN/A
B2ZFP3SMAL1_DANRE3, ., 6, ., 4, ., -0.64350.96190.1251yesN/A
Q0P4U8SMAL1_XENTR3, ., 6, ., 4, ., -0.66330.96190.1072yesN/A
Q9NZC9SMAL1_HUMAN3, ., 6, ., 4, ., -0.66330.96190.1058yesN/A
B4F769SMAL1_RAT3, ., 6, ., 4, ., -0.65340.96190.1109yesN/A
Q9TTA5SMAL1_BOVIN3, ., 6, ., 4, ., -0.60390.95230.1062yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query105
COG0553866 COG0553, HepA, Superfamily II DNA/RNA helicases, S 3e-19
PLN03142 1033 PLN03142, PLN03142, Probable chromatin-remodeling 3e-16
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 5e-16
smart0049082 smart00490, HELICc, helicase superfamily c-termina 2e-14
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 8e-10
>gnl|CDD|223627 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information 
 Score = 80.9 bits (199), Expect = 3e-19
 Identities = 35/101 (34%), Positives = 64/101 (63%)

Query: 1   YIRIDGSVGSEERKSVVDQFQYEDKFRVAVLSITAANSGITLTAANLVVFAELFWNPGIL 60
           Y+R+DGS  ++ R+ ++D+F  +++ +V +LS+ A   G+ LT A+ V+  + +WNP + 
Sbjct: 738 YVRLDGSTPAKRRQELIDRFNADEEEKVFLLSLKAGGLGLNLTGADTVILFDPWWNPAVE 797

Query: 61  TQAEDRAHRIGQQDSVLIQYLVAKQTADDYLWPLVMTKLDV 101
            QA DRAHRIGQ+  V +  L+ + T ++ +  L   K ++
Sbjct: 798 LQAIDRAHRIGQKRPVKVYRLITRGTIEEKILELQEKKQEL 838

Length = 866
>gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 105
KOG0390|consensus776 100.0
KOG0392|consensus1549 100.0
KOG0387|consensus 923 99.98
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.97
KOG0385|consensus 971 99.97
KOG0389|consensus941 99.97
KOG0384|consensus 1373 99.96
KOG1002|consensus791 99.96
KOG0391|consensus 1958 99.95
KOG0388|consensus1185 99.94
KOG1015|consensus 1567 99.94
KOG1000|consensus689 99.93
KOG4439|consensus901 99.93
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 99.93
PRK04914 956 ATP-dependent helicase HepA; Validated 99.92
KOG0386|consensus 1157 99.89
KOG1001|consensus674 99.87
KOG1016|consensus 1387 99.85
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.77
smart0049082 HELICc helicase superfamily c-terminal domain. 99.7
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.69
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 99.68
PRK13766 773 Hef nuclease; Provisional 99.65
KOG0298|consensus1394 99.51
PTZ00110545 helicase; Provisional 99.49
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 99.49
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.47
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.47
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.47
KOG0331|consensus519 99.46
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 99.45
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 99.45
PHA02558501 uvsW UvsW helicase; Provisional 99.43
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 99.43
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.43
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.42
KOG0328|consensus400 99.42
PTZ00424401 helicase 45; Provisional 99.41
KOG0330|consensus476 99.4
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 99.38
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.38
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.36
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.36
KOG0348|consensus 708 99.35
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.33
KOG0333|consensus673 99.31
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.27
KOG0335|consensus482 99.2
PF13871 278 Helicase_C_4: Helicase_C-like 99.19
KOG0345|consensus 567 99.18
KOG0336|consensus629 99.16
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.16
KOG0332|consensus477 99.15
PRK13767 876 ATP-dependent helicase; Provisional 99.14
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.13
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.12
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.09
KOG0342|consensus543 99.09
KOG0341|consensus610 99.09
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.08
KOG0344|consensus593 99.08
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 99.07
KOG0350|consensus620 99.03
KOG0343|consensus 758 99.02
PRK10689 1147 transcription-repair coupling factor; Provisional 99.01
KOG0326|consensus459 99.0
KOG0340|consensus442 98.98
PRK02362 737 ski2-like helicase; Provisional 98.97
KOG0338|consensus 691 98.95
KOG1123|consensus 776 98.94
KOG0354|consensus 746 98.91
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 98.9
KOG0327|consensus397 98.88
PRK01172 674 ski2-like helicase; Provisional 98.81
KOG0347|consensus 731 98.81
PRK00254 720 ski2-like helicase; Provisional 98.8
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 98.78
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 98.75
KOG4284|consensus 980 98.75
PRK05298652 excinuclease ABC subunit B; Provisional 98.72
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 98.72
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 98.71
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 98.58
PRK09200 790 preprotein translocase subunit SecA; Reviewed 98.55
KOG0349|consensus725 98.54
KOG0351|consensus 941 98.54
KOG0339|consensus 731 98.54
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 98.53
KOG0953|consensus 700 98.52
COG1200677 RecG RecG-like helicase [DNA replication, recombin 98.48
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 98.45
PHA02653 675 RNA helicase NPH-II; Provisional 98.44
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 98.37
KOG0334|consensus 997 98.34
KOG0352|consensus 641 98.23
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 98.21
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 98.2
COG1202 830 Superfamily II helicase, archaea-specific [General 98.15
KOG0346|consensus 569 98.13
TIGR00595 505 priA primosomal protein N'. All proteins in this f 98.11
PRK05580 679 primosome assembly protein PriA; Validated 98.1
KOG0337|consensus 529 98.08
COG1201 814 Lhr Lhr-like helicases [General function predictio 98.06
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 98.05
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 98.01
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 97.94
PRK09694 878 helicase Cas3; Provisional 97.89
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 97.84
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 97.65
KOG1513|consensus 1300 97.61
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 97.47
PRK09401 1176 reverse gyrase; Reviewed 97.42
PRK12904 830 preprotein translocase subunit SecA; Reviewed 97.34
COG1205 851 Distinct helicase family with a unique C-terminal 97.3
PRK14701 1638 reverse gyrase; Provisional 97.29
KOG0329|consensus387 97.26
COG4098441 comFA Superfamily II DNA/RNA helicase required for 97.25
COG1204 766 Superfamily II helicase [General function predicti 97.24
COG4889 1518 Predicted helicase [General function prediction on 97.22
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 97.08
PRK13107 908 preprotein translocase subunit SecA; Reviewed 97.04
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 96.99
COG0556663 UvrB Helicase subunit of the DNA excision repair c 96.98
KOG0949|consensus 1330 96.97
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 96.96
KOG0952|consensus 1230 96.89
KOG0353|consensus 695 96.87
KOG4150|consensus 1034 96.86
KOG0922|consensus 674 96.82
COG4096 875 HsdR Type I site-specific restriction-modification 96.45
smart00491142 HELICc2 helicase superfamily c-terminal domain. 96.39
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 96.22
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 96.14
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 96.13
smart00492141 HELICc3 helicase superfamily c-terminal domain. 95.95
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 95.41
COG1198 730 PriA Primosomal protein N' (replication factor Y) 95.39
KOG0950|consensus 1008 95.32
KOG0383|consensus696 95.31
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 95.23
KOG0926|consensus 1172 95.08
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 95.06
KOG0947|consensus 1248 95.04
KOG0923|consensus 902 94.72
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 94.61
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 94.54
KOG0924|consensus 1042 94.46
PRK12326 764 preprotein translocase subunit SecA; Reviewed 93.69
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 93.57
KOG0951|consensus 1674 93.49
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 92.93
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 92.02
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 90.65
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 90.35
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 89.82
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 89.27
KOG0920|consensus 924 88.68
PRK15483 986 type III restriction-modification system StyLTI en 87.52
PF11496297 HDA2-3: Class II histone deacetylase complex subun 86.88
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 86.47
COG0610 962 Type I site-specific restriction-modification syst 86.26
KOG0948|consensus 1041 86.22
>KOG0390|consensus Back     alignment and domain information 
Probab=100.00  E-value=5.6e-33  Score=209.65  Aligned_cols=103  Identities=30%  Similarity=0.438  Sum_probs=98.7

Q ss_pred             CEEEECCCCHHHHHHHHHHhccCCCe-eEEEEecccceecccccccCeeEEecCCCCcChHhHHHHhhhccCCCCeEEEE
Q psy12190          1 YIRIDGSVGSEERKSVVDQFQYEDKF-RVAVLSITAANSGITLTAANLVVFAELFWNPGILTQAEDRAHRIGQQDSVLIQ   79 (105)
Q Consensus         1 ~~~~~g~~~~~~r~~~~~~F~~~~~~-~vll~s~~~~~~Gl~l~~~~~vi~~~~~wn~~~~~Q~~gR~~R~Gq~~~v~v~   79 (105)
                      |+++||+++..+|+.+++.||++++. .|+|+|++|||+||||..|+++|++|++|||+...||++|+||.||+++|+||
T Consensus       622 ~~rLdG~~~~~qRq~~vd~FN~p~~~~~vfLlSsKAgg~GinLiGAsRlil~D~dWNPa~d~QAmaR~~RdGQKk~v~iY  701 (776)
T KOG0390|consen  622 VLRLDGKTSIKQRQKLVDTFNDPESPSFVFLLSSKAGGEGLNLIGASRLILFDPDWNPAVDQQAMARAWRDGQKKPVYIY  701 (776)
T ss_pred             EEEEcCCCchHHHHHHHHhccCCCCCceEEEEecccccCceeecccceEEEeCCCCCchhHHHHHHHhccCCCcceEEEE
Confidence            58999999999999999999987766 89999999999999999999999999999999999999999999999999999


Q ss_pred             EEeeCCCHHHHHHHHHHhhhhcCC
Q psy12190         80 YLVAKQTADDYLWPLVMTKLDVPS  103 (105)
Q Consensus        80 ~l~~~~s~d~~i~~~~~~K~~~~~  103 (105)
                      +|++.||+||++++++..|..+..
T Consensus       702 rLlatGtiEEk~~qrq~~K~~lS~  725 (776)
T KOG0390|consen  702 RLLATGTIEEKIYQRQTHKEGLSS  725 (776)
T ss_pred             EeecCCCchHHHHHHHHHhhhhhh
Confidence            999999999999999999987654

>KOG0392|consensus Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>KOG1016|consensus Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>KOG1513|consensus Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>KOG0383|consensus Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>PF11496 HDA2-3: Class II histone deacetylase complex subunits 2 and 3; InterPro: IPR021006 This entry contains the class II histone deacetylase complex subunits HDA2 and HDA3 is found in fungi Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query105
1z5z_A271 Sulfolobus Solfataricus Swi2SNF2 ATPASE C-Terminal 3e-12
1z6a_A500 Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN 3e-12
1z63_A500 Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COM 4e-12
3mwy_W800 Crystal Structure Of The Chromodomain-atpase Portio 4e-11
1z3i_X644 Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMA 2e-06
>pdb|1Z5Z|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE C-Terminal Domain Length = 271 Back     alignment and structure 
Iteration: 1

 Score = 67.0 bits (162), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 54/93 (58%)
Query: 6   GSVGSEERKSVVDQFQYEDKFRVAVLSITAANSGITLTAANLVVFAELFWNPGILTQAED 65
           G +  +ER  ++ +FQ     +  VLS+ A   GI LT+AN V+  + +WNP +  QA D
Sbjct: 145 GELSKKERDDIISKFQNNPSVKFIVLSVKAGGFGINLTSANRVIHFDRWWNPAVEDQATD 204
Query: 66  RAHRIGQQDSVLIQYLVAKQTADDYLWPLVMTK 98
           R +RIGQ  +V++  L++  T ++ +  L+  K
Sbjct: 205 RVYRIGQTRNVIVHKLISVGTLEEKIDQLLAFK 237
>pdb|1Z6A|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN Length = 500 Back     alignment and structure
>pdb|1Z63|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COMPLEX With Dsdna Length = 500 Back     alignment and structure
>pdb|3MWY|W Chain W, Crystal Structure Of The Chromodomain-atpase Portion Of The Yeast Chd1 Chromatin Remodeler Length = 800 Back     alignment and structure
>pdb|1Z3I|X Chain X, Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMAIN OF EUKARYOTIC Rad54 Length = 644 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query105
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 4e-23
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 8e-22
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 1e-20
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 1e-17
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 1e-15
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 2e-04
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 3e-04
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Length = 271 Back     alignment and structure
 Score = 88.8 bits (221), Expect = 4e-23
 Identities = 30/86 (34%), Positives = 49/86 (56%)

Query: 1   YIRIDGSVGSEERKSVVDQFQYEDKFRVAVLSITAANSGITLTAANLVVFAELFWNPGIL 60
              + G +  +ER  ++ +FQ     +  VLS+ A   GI LT+AN V+  + +WNP + 
Sbjct: 140 VPFLYGELSKKERDDIISKFQNNPSVKFIVLSVKAGGFGINLTSANRVIHFDRWWNPAVE 199

Query: 61  TQAEDRAHRIGQQDSVLIQYLVAKQT 86
            QA DR +RIGQ  +V++  L++  T
Sbjct: 200 DQATDRVYRIGQTRNVIVHKLISVGT 225
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800 Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Length = 328 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query105
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.98
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.96
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.96
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.95
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.86
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.86
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.82
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.76
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.73
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.73
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.73
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.71
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.7
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 99.7
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.69
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.69
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.68
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.5
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.66
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.66
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.66
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.64
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.6
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.6
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.57
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 99.57
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.55
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.55
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.54
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.54
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.53
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.5
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.49
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.49
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.48
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.47
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.47
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 99.45
3h1t_A590 Type I site-specific restriction-modification syst 99.44
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.42
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.37
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.28
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.27
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.26
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.26
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.24
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.23
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.21
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.19
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.18
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.14
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.12
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.07
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.04
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 98.85
1yks_A 440 Genome polyprotein [contains: flavivirin protease 98.85
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 98.82
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 98.77
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 98.75
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 98.71
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 98.7
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 98.68
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 98.62
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 98.56
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 98.5
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 98.49
3jux_A 822 Protein translocase subunit SECA; protein transloc 98.45
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 98.38
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 98.31
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 98.3
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 98.2
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 97.01
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 95.68
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 83.48
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
Probab=99.98  E-value=7e-33  Score=189.94  Aligned_cols=105  Identities=31%  Similarity=0.492  Sum_probs=85.5

Q ss_pred             CEEEECCCCHHHHHHHHHHhccCCCeeEEEEecccceecccccccCeeEEecCCCCcChHhHHHHhhhccCCCCeEEEEE
Q psy12190          1 YIRIDGSVGSEERKSVVDQFQYEDKFRVAVLSITAANSGITLTAANLVVFAELFWNPGILTQAEDRAHRIGQQDSVLIQY   80 (105)
Q Consensus         1 ~~~~~g~~~~~~r~~~~~~F~~~~~~~vll~s~~~~~~Gl~l~~~~~vi~~~~~wn~~~~~Q~~gR~~R~Gq~~~v~v~~   80 (105)
                      +..++|+++.++|++++++|++++++.++|++++++|+|+||+.|++||++|+||||..+.||+||+||+||+++|.||+
T Consensus       140 ~~~l~G~~~~~~R~~~i~~F~~~~~~~v~L~st~~~g~Glnl~~a~~VI~~d~~wnp~~~~Q~~gR~~R~Gq~~~v~v~~  219 (271)
T 1z5z_A          140 VPFLYGELSKKERDDIISKFQNNPSVKFIVLSVKAGGFGINLTSANRVIHFDRWWNPAVEDQATDRVYRIGQTRNVIVHK  219 (271)
T ss_dssp             CCEECTTSCHHHHHHHHHHHHHCTTCCEEEEECCTTCCCCCCTTCSEEEECSCCSCTTTC--------------CCEEEE
T ss_pred             EEEEECCCCHHHHHHHHHHhcCCCCCCEEEEehhhhcCCcCcccCCEEEEECCCCChhHHHHHHHhccccCCCCceEEEE
Confidence            45799999999999999999988677888999999999999999999999999999999999999999999999999999


Q ss_pred             EeeCCCHHHHHHHHHHhhhhcCCCC
Q psy12190         81 LVAKQTADDYLWPLVMTKLDVPSPI  105 (105)
Q Consensus        81 l~~~~s~d~~i~~~~~~K~~~~~~i  105 (105)
                      +++++|+||++++++..|..+++.+
T Consensus       220 li~~~TiEe~i~~~~~~K~~l~~~~  244 (271)
T 1z5z_A          220 LISVGTLEEKIDQLLAFKRSLFKDI  244 (271)
T ss_dssp             EEETTSHHHHHHHHHHHCHHHHTTG
T ss_pred             EeeCCCHHHHHHHHHHHHHHHHHHH
Confidence            9999999999999999999887653
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 105
d1z3ix1346 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fi 2e-12
d1z5za1244 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 h 9e-12
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 4e-07
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 6e-07
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 346 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Rad54-like, Rad54L
species: Zebra fish (Danio rerio) [TaxId: 7955]

 Score = 59.6 bits (143), Expect = 2e-12
 Identities = 24/93 (25%), Positives = 41/93 (44%), Gaps = 1/93 (1%)

Query: 10  SEERKSVVDQFQYEDKFRV-AVLSITAANSGITLTAANLVVFAELFWNPGILTQAEDRAH 68
            ++R  +V++F          +LS  A   G+ L  AN +V  +  WNP    QA  R  
Sbjct: 154 IKKRAKIVERFNNPSSPEFIFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVW 213

Query: 69  RIGQQDSVLIQYLVAKQTADDYLWPLVMTKLDV 101
           R GQ+ +  I  L++  T ++ +      K  +
Sbjct: 214 RDGQKKTCYIYRLLSTGTIEEKILQRQAHKKAL 246
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 244 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query105
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 100.0
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 100.0
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.86
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.79
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.79
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.78
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.77
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.74
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.74
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.69
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.63
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.52
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.48
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.28
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.27
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.13
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 98.97
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 98.97
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 98.54
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 97.71
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 97.27
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 96.33
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 87.01
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Rad54-like, Rad54L
species: Zebra fish (Danio rerio) [TaxId: 7955]

Probab=100.00  E-value=9.1e-34  Score=198.34  Aligned_cols=105  Identities=28%  Similarity=0.415  Sum_probs=99.0

Q ss_pred             CEEEECCCCHHHHHHHHHHhccCCC-eeEEEEecccceecccccccCeeEEecCCCCcChHhHHHHhhhccCCCCeEEEE
Q psy12190          1 YIRIDGSVGSEERKSVVDQFQYEDK-FRVAVLSITAANSGITLTAANLVVFAELFWNPGILTQAEDRAHRIGQQDSVLIQ   79 (105)
Q Consensus         1 ~~~~~g~~~~~~r~~~~~~F~~~~~-~~vll~s~~~~~~Gl~l~~~~~vi~~~~~wn~~~~~Q~~gR~~R~Gq~~~v~v~   79 (105)
                      |++++|+++.++|.++++.|+++.. ..|+|+++.+||+|+||+.|++||++||+|||..+.||+||+||+||+++|+||
T Consensus       145 ~~~l~G~~~~~~R~~~i~~F~~~~~~~~vlLls~~agg~GlnL~~a~~vi~~d~~wnp~~~~Qa~~R~~R~GQ~~~V~v~  224 (346)
T d1z3ix1         145 YVRLDGTMSIKKRAKIVERFNNPSSPEFIFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYIY  224 (346)
T ss_dssp             EEEECSSCCHHHHHHHHHHHHSTTCCCCEEEEEGGGSCTTCCCTTEEEEEECSCCSSHHHHHHHHTTSSSTTCCSCEEEE
T ss_pred             ccccccchhHHHHHHHHHhhhcccccceeeeecchhhhhccccccceEEEEecCCCccchHhHhhhcccccCCCCceEEE
Confidence            5789999999999999999997554 458999999999999999999999999999999999999999999999999999


Q ss_pred             EEeeCCCHHHHHHHHHHhhhhcCCCC
Q psy12190         80 YLVAKQTADDYLWPLVMTKLDVPSPI  105 (105)
Q Consensus        80 ~l~~~~s~d~~i~~~~~~K~~~~~~i  105 (105)
                      +|+++||+||+|++++..|..+++.+
T Consensus       225 rli~~~TiEe~i~~~~~~K~~l~~~v  250 (346)
T d1z3ix1         225 RLLSTGTIEEKILQRQAHKKALSSCV  250 (346)
T ss_dssp             EEEETTSHHHHHHHHHHHHHHTSCCC
T ss_pred             EEEeCCCHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999988764
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure