Psyllid ID: psy12206

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160----
MKIDVISYYCQTCLKVIALNVGISKFMYVRRKKVTRQGNMKILDIELVKGNKGLGFSIAGGIGNQHIPGDNGIYVTKIMDGGAAQVDGRLQVGDKLIAVRNSTSEDKRASPGIFLCNIAGGIGNQHIPGDNGIYVTKIMDGGAAQVDGRLQVGDKLIAVRNSTR
cEEEEEEEcHHHHHHHHHHccccEEEEEEEEccccccccEEEEEEEEEcccccccEEEEcccccccccccccEEEEEEcccccHHcccccccccEEEEEccccccccccHHHHHHHHHcccccEEcccccccEEEEEEccccccccccccccccEEEEEccccc
ccEEEEEEccHHHHHHHHHHccccEEEEEEEccccccccccEEEEEEEEcccccEEEEEcccccccccccccEEEEEEcccccccccccEEcccEEEEEcccccccccHHHHHHHHHHccccccccccccccEEEEEEcccccccccccEEEccEEEEEccccc
MKIDVISYYCQTCLKVIALNVGISKFMYVRrkkvtrqgnmkILDIELVkgnkglgfsiaggignqhipgdngiyvtkimdggaaqvdgrlqVGDKLIAVRnstsedkraspgiflcniaggignqhipgdngiyvtkimdggaaqvdgrlqVGDKLIAVRNSTR
MKIDVISYYCQTCLKVIALNVGISKFMyvrrkkvtrqgnmkildIELVKGNKGLGFSIAGGIGNQHIPGDNGIYVTKIMDGGAAQVDGRLQVGDKLIAVRnstsedkraspGIFLCNIAGGIGNQHIPGDNGIYVTKIMDGGAaqvdgrlqvgdkliavrnstr
MKIDVISYYCQTCLKVIALNVGISKFMYVRRKKVTRQGNMKILDIELVKGNKGLGFSIAGGIGNQHIPGDNGIYVTKIMDGGAAQVDGRLQVGDKLIAVRNSTSEDKRASPGIFLCNIAGGIGNQHIPGDNGIYVTKIMDGGAAQVDGRLQVGDKLIAVRNSTR
**IDVISYYCQTCLKVIALNVGISKFMYVRRKKVTRQGNMKILDIELVKGNKGLGFSIAGGIGNQHIPGDNGIYVTKIMDGGAAQVDGRLQVGDKLIAVR**********PGIFLCNIAGGIGNQHIPGDNGIYVTKIMDGGAAQVDGRLQVGDKLIA******
MKIDVISYYCQ******************************ILDIELVKGNKGLGFSIAGGIGNQHIPGDNGIYVTKIMDGGAAQVDGRLQVGDKLIAVRNSTSEDKRASPGIFLCNIAGGI**QHIPGDNGIYVTKIMD*****VDGRLQVGDKLIAVRN***
MKIDVISYYCQTCLKVIALNVGISKFMYVRRKKVTRQGNMKILDIELVKGNKGLGFSIAGGIGNQHIPGDNGIYVTKIMDGGAAQVDGRLQVGDKLIAVRNSTSEDKRASPGIFLCNIAGGIGNQHIPGDNGIYVTKIMDGGAAQVDGRLQVGDKLIAVRNSTR
MKIDVISYYCQTCLKVIALNVGISKFMYVRRKKVTRQGNMKILDIELVKGNKGLGFSIAGGIGNQHIPGDNGIYVTKIMDGGAAQVDGRLQVGDKLIAVRNSTSEDKRASPGIFLCNIAGGIGNQHIPGDNGIYVTKIMDGGAAQVDGRLQVGDKLIAVR****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKIDVISYYCQTCLKVIALNVGISKFMYVRRKKVTRQGNMKILDIELVKGNKGLGFSIAGGIGNQHIPGDNGIYVTKIMDGGAAQVDGRLQVGDKLIAVRNSTSEDKRASPGIFLCNIAGGIGNQHIPGDNGIYVTKIMDGGAAQVDGRLQVGDKLIAVRNSTR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query164 2.2.26 [Sep-21-2011]
Q62936 849 Disks large homolog 3 OS= yes N/A 0.762 0.147 0.475 7e-31
P70175 849 Disks large homolog 3 OS= yes N/A 0.762 0.147 0.475 7e-31
Q92796 817 Disks large homolog 3 OS= yes N/A 0.762 0.152 0.475 1e-30
Q5PYH7 881 Disks large homolog 2 OS= no N/A 0.731 0.136 0.470 9e-30
Q6R005 801 Disks large homolog 4 OS= no N/A 0.756 0.154 0.440 2e-29
Q15700 870 Disks large homolog 2 OS= no N/A 0.719 0.135 0.470 6e-29
Q811D0 905 Disks large homolog 1 OS= no N/A 0.719 0.130 0.464 2e-28
Q12959 904 Disks large homolog 1 OS= no N/A 0.713 0.129 0.461 2e-28
Q63622 852 Disks large homolog 2 OS= no N/A 0.719 0.138 0.470 2e-28
Q91XM9 852 Disks large homolog 2 OS= no N/A 0.719 0.138 0.470 2e-28
>sp|Q62936|DLG3_RAT Disks large homolog 3 OS=Rattus norvegicus GN=Dlg3 PE=1 SV=1 Back     alignment and function desciption
 Score =  132 bits (333), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 76/160 (47%), Positives = 93/160 (58%), Gaps = 35/160 (21%)

Query: 38  GNMKILDIELVKGNKGLGFSIAGGIGNQHIPGDNGIYVTKIMDGGAAQVDGRLQVGDKLI 97
           G  K  +I L +GN GLGFSIAGGI N H+P D GI++TKI+ GGAA +DGRL V D ++
Sbjct: 143 GMFKYEEIVLERGNSGLGFSIAGGIDNPHVPDDPGIFITKIIPGGAAAMDGRLGVNDCVL 202

Query: 98  AVRNSTSED----------KRASPG--------------IFLCN-----------IAGGI 122
            V      +          K A P               I   N           IAGGI
Sbjct: 203 RVNEVDVSEVVHSRAVEALKEAGPVVRLVVRRRQPPPETIMEVNLLKGPKGLGFSIAGGI 262

Query: 123 GNQHIPGDNGIYVTKIMDGGAAQVDGRLQVGDKLIAVRNS 162
           GNQHIPGDN IY+TKI++GGAAQ DGRLQ+GD+L+AV N+
Sbjct: 263 GNQHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNT 302
Required for learning most likely through its role in synaptic plasticity following NMDA receptor signaling.
Rattus norvegicus (taxid: 10116)
>sp|P70175|DLG3_MOUSE Disks large homolog 3 OS=Mus musculus GN=Dlg3 PE=1 SV=1 Back     alignment and function description
>sp|Q92796|DLG3_HUMAN Disks large homolog 3 OS=Homo sapiens GN=DLG3 PE=1 SV=2 Back     alignment and function description
>sp|Q5PYH7|DLG2_DANRE Disks large homolog 2 OS=Danio rerio GN=dlg2 PE=2 SV=1 Back     alignment and function description
>sp|Q6R005|DLG4_DANRE Disks large homolog 4 OS=Danio rerio GN=dlg4 PE=2 SV=1 Back     alignment and function description
>sp|Q15700|DLG2_HUMAN Disks large homolog 2 OS=Homo sapiens GN=DLG2 PE=1 SV=3 Back     alignment and function description
>sp|Q811D0|DLG1_MOUSE Disks large homolog 1 OS=Mus musculus GN=Dlg1 PE=1 SV=1 Back     alignment and function description
>sp|Q12959|DLG1_HUMAN Disks large homolog 1 OS=Homo sapiens GN=DLG1 PE=1 SV=2 Back     alignment and function description
>sp|Q63622|DLG2_RAT Disks large homolog 2 OS=Rattus norvegicus GN=Dlg2 PE=1 SV=1 Back     alignment and function description
>sp|Q91XM9|DLG2_MOUSE Disks large homolog 2 OS=Mus musculus GN=Dlg2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query164
333033759 882 discs large 1 [Gryllus bimaculatus] 0.798 0.148 0.485 2e-31
301610790 837 PREDICTED: disks large homolog 3 [Xenopu 0.743 0.145 0.471 2e-30
326924285 926 PREDICTED: disks large homolog 3-like [M 0.762 0.134 0.481 4e-30
383849085 946 PREDICTED: disks large 1 tumor suppresso 0.725 0.125 0.5 6e-30
431914394 1042 Disks large like protein 3 [Pteropus ale 0.762 0.119 0.475 9e-30
363732984 1044 PREDICTED: LOW QUALITY PROTEIN: disks la 0.762 0.119 0.481 9e-30
28972680 950 mKIAA1232 protein [Mus musculus] gi|1486 0.762 0.131 0.475 1e-29
326673702 914 PREDICTED: disks large homolog 3-like [D 0.756 0.135 0.471 1e-29
403182343 948 AAEL016988-PA [Aedes aegypti] 0.725 0.125 0.5 2e-29
327288498 748 PREDICTED: disks large homolog 3-like, p 0.762 0.167 0.475 3e-29
>gi|333033759|dbj|BAK23256.1| discs large 1 [Gryllus bimaculatus] Back     alignment and taxonomy information
 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 81/167 (48%), Positives = 96/167 (57%), Gaps = 36/167 (21%)

Query: 32  KKVTRQGNMKILDIELVKGNKGLGFSIAGGIGNQHIPGDNGIYVTKIMDGGAAQVDGRLQ 91
           K V   G  +  +I L +G  GLGFSIAGG  N HI  D  IY+TK++ GGAA  DGRL+
Sbjct: 166 KHVNGDGEWEFEEIVLERGGAGLGFSIAGGTDNPHIGDDTAIYITKLIPGGAAAADGRLR 225

Query: 92  VGDKLIAVRNSTSED----------KRASPGIFL-------------------------- 115
           V D ++ V + T  D          KRA   + L                          
Sbjct: 226 VNDTILQVNDVTVVDVPHAAAVDALKRAGNEVRLYVRRRRQPSHVTLLEIELVKGSKGLG 285

Query: 116 CNIAGGIGNQHIPGDNGIYVTKIMDGGAAQVDGRLQVGDKLIAVRNS 162
            +IAGGIGNQHIPGDNGIYVTKIMDGGAAQ+DGRL VGDKL+AVRN+
Sbjct: 286 FSIAGGIGNQHIPGDNGIYVTKIMDGGAAQIDGRLVVGDKLVAVRNT 332

Source: Gryllus bimaculatus

Species: Gryllus bimaculatus

Genus: Gryllus

Family: Gryllidae

Order: Orthoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|301610790|ref|XP_002934927.1| PREDICTED: disks large homolog 3 [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|326924285|ref|XP_003208360.1| PREDICTED: disks large homolog 3-like [Meleagris gallopavo] Back     alignment and taxonomy information
>gi|383849085|ref|XP_003700177.1| PREDICTED: disks large 1 tumor suppressor protein-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|431914394|gb|ELK15651.1| Disks large like protein 3 [Pteropus alecto] Back     alignment and taxonomy information
>gi|363732984|ref|XP_426264.3| PREDICTED: LOW QUALITY PROTEIN: disks large homolog 3 [Gallus gallus] Back     alignment and taxonomy information
>gi|28972680|dbj|BAC65756.1| mKIAA1232 protein [Mus musculus] gi|148682220|gb|EDL14167.1| discs, large homolog 3 (Drosophila), isoform CRA_c [Mus musculus] Back     alignment and taxonomy information
>gi|326673702|ref|XP_003199963.1| PREDICTED: disks large homolog 3-like [Danio rerio] Back     alignment and taxonomy information
>gi|403182343|gb|EJY57327.1| AAEL016988-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|327288498|ref|XP_003228963.1| PREDICTED: disks large homolog 3-like, partial [Anolis carolinensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query164
UNIPROTKB|F1NB97 829 Gga.50675 "Uncharacterized pro 0.481 0.095 0.609 1.8e-21
UNIPROTKB|E1BLW4 817 DLG3 "Uncharacterized protein" 0.481 0.096 0.609 1.1e-26
UNIPROTKB|Q92796 817 DLG3 "Disks large homolog 3" [ 0.481 0.096 0.609 1.1e-26
MGI|MGI:1888986 849 Dlg3 "discs, large homolog 3 ( 0.481 0.093 0.609 1.2e-26
RGD|68423 849 Dlg3 "discs, large homolog 3 ( 0.481 0.093 0.609 1.2e-26
ZFIN|ZDB-GENE-050221-3 881 dlg2 "discs, large (Drosophila 0.469 0.087 0.65 5.1e-27
ZFIN|ZDB-GENE-050208-93 747 dlg3 "discs, large homolog 3 ( 0.481 0.105 0.621 1.6e-26
FB|FBgn0001624 970 dlg1 "discs large 1" [Drosophi 0.396 0.067 0.830 1.5e-29
MGI|MGI:1344351 852 Dlg2 "discs, large homolog 2 ( 0.469 0.090 0.637 7.6e-27
RGD|619895 852 Dlg2 "discs, large homolog 2 ( 0.469 0.090 0.637 7.6e-27
UNIPROTKB|F1NB97 Gga.50675 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 262 (97.3 bits), Expect = 1.8e-21, P = 1.8e-21
 Identities = 50/82 (60%), Positives = 66/82 (80%)

Query:    27 MYVRRKKVTRQGNMKILDIELVKGNKGLGFSIAGGIGNQHIPGDNGIYVTKIMDGGAAQV 86
             + VRR++   +    I+++ L+KG KGLGFSIAGGIGNQHIPGDN IY+TKI++GGAAQ 
Sbjct:   211 LVVRRRQPPPE---TIMEVNLMKGPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQK 267

Query:    87 DGRLQVGDKLIAVRNSTSEDKR 108
             DGRLQ+GD+L+AV N+  +D R
Sbjct:   268 DGRLQIGDRLLAVNNTNLQDVR 289
GO:0001736 "establishment of planar polarity" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0005886 "plasma membrane" evidence=IEA
GO:0005923 "tight junction" evidence=IEA
GO:0010923 "negative regulation of phosphatase activity" evidence=IEA
GO:0019902 "phosphatase binding" evidence=IEA
GO:0031625 "ubiquitin protein ligase binding" evidence=IEA
GO:0045197 "establishment or maintenance of epithelial cell apical/basal polarity" evidence=IEA
UNIPROTKB|E1BLW4 DLG3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q92796 DLG3 "Disks large homolog 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1888986 Dlg3 "discs, large homolog 3 (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|68423 Dlg3 "discs, large homolog 3 (Drosophila)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050221-3 dlg2 "discs, large (Drosophila) homolog 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050208-93 dlg3 "discs, large homolog 3 (Drosophila)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0001624 dlg1 "discs large 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:1344351 Dlg2 "discs, large homolog 2 (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|619895 Dlg2 "discs, large homolog 2 (Drosophila)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query164
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 6e-08
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 7e-08
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 1e-06
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 4e-04
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 0.003
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information 
 Score = 47.2 bits (113), Expect = 6e-08
 Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 7/59 (11%)

Query: 42 ILDIELVKG-NKGLGFSIAGGIGNQHIPGDNGIYVTKIMDGGAAQVDGRLQVGDKLIAV 99
          +  + L K    GLGFS+ GG  +       GI+V+++  GG A+  G L+VGD+++ V
Sbjct: 1  VRTVTLRKDPGGGLGFSLRGGKDS-----GGGIFVSRVEPGGPAE-RGGLRVGDRILEV 53

May be responsible for specific protein-protein interactions, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of PDZ domains an N-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in proteases. Length = 82
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 164
KOG3209|consensus984 99.74
KOG3209|consensus 984 99.73
KOG3580|consensus 1027 99.53
PRK10779 449 zinc metallopeptidase RseP; Provisional 99.4
KOG3580|consensus 1027 99.35
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 99.35
PRK10139455 serine endoprotease; Provisional 99.35
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 99.34
KOG3605|consensus829 99.33
PRK10942473 serine endoprotease; Provisional 99.32
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 99.25
KOG3550|consensus207 99.14
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 98.92
KOG3553|consensus124 98.82
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 98.81
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.75
KOG1892|consensus 1629 98.69
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 98.64
KOG3553|consensus124 98.63
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 98.6
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 98.55
KOG3571|consensus 626 98.54
KOG3549|consensus 505 98.51
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.5
KOG3651|consensus 429 98.47
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.42
KOG3551|consensus 506 98.37
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 98.34
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 98.32
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.3
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 98.3
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.29
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.27
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 98.23
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.23
KOG3550|consensus207 98.15
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.13
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 98.09
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 98.07
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 97.98
KOG3606|consensus358 97.91
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 97.9
KOG3552|consensus 1298 97.88
KOG3542|consensus 1283 97.86
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 97.83
KOG4407|consensus 1973 97.83
KOG0609|consensus 542 97.79
TIGR00225 334 prc C-terminal peptidase (prc). A C-terminal pepti 97.79
PLN00049 389 carboxyl-terminal processing protease; Provisional 97.78
TIGR00225 334 prc C-terminal peptidase (prc). A C-terminal pepti 97.64
PRK10779 449 zinc metallopeptidase RseP; Provisional 97.61
PLN00049 389 carboxyl-terminal processing protease; Provisional 97.54
PRK10139 455 serine endoprotease; Provisional 97.49
PRK10898353 serine endoprotease; Provisional 97.44
PRK10942 473 serine endoprotease; Provisional 97.41
PRK10898353 serine endoprotease; Provisional 97.4
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 97.39
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 97.38
KOG1892|consensus 1629 97.38
TIGR01713259 typeII_sec_gspC general secretion pathway protein 97.37
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 97.35
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 97.34
TIGR01713259 typeII_sec_gspC general secretion pathway protein 97.34
COG0793 406 Prc Periplasmic protease [Cell envelope biogenesis 97.3
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 97.3
COG0793 406 Prc Periplasmic protease [Cell envelope biogenesis 97.2
KOG3571|consensus 626 97.03
KOG3651|consensus 429 96.98
KOG3605|consensus829 96.97
PRK11186 667 carboxy-terminal protease; Provisional 96.94
KOG3542|consensus 1283 96.92
PRK11186 667 carboxy-terminal protease; Provisional 96.87
KOG3552|consensus 1298 96.82
COG3975558 Predicted protease with the C-terminal PDZ domain 96.64
KOG3606|consensus 358 96.56
KOG3551|consensus 506 96.48
COG3975558 Predicted protease with the C-terminal PDZ domain 96.47
KOG3129|consensus231 96.44
KOG1421|consensus 955 96.36
KOG3938|consensus334 96.31
KOG1320|consensus473 96.25
COG0265347 DegQ Trypsin-like serine proteases, typically peri 96.17
COG0265347 DegQ Trypsin-like serine proteases, typically peri 96.16
TIGR02860 402 spore_IV_B stage IV sporulation protein B. SpoIVB, 96.12
KOG3129|consensus231 96.05
KOG4371|consensus1332 95.9
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 95.83
PF11874183 DUF3394: Domain of unknown function (DUF3394); Int 95.72
KOG3834|consensus 462 95.65
KOG0606|consensus 1205 95.6
TIGR02860 402 spore_IV_B stage IV sporulation protein B. SpoIVB, 95.45
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 95.26
KOG0609|consensus 542 95.01
KOG3549|consensus 505 94.87
COG3480 342 SdrC Predicted secreted protein containing a PDZ d 94.04
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 93.83
KOG1421|consensus955 93.72
KOG1320|consensus473 93.55
KOG1738|consensus 638 93.36
KOG3532|consensus 1051 93.2
KOG3532|consensus 1051 93.05
COG3480 342 SdrC Predicted secreted protein containing a PDZ d 90.02
PRK09681276 putative type II secretion protein GspC; Provision 89.75
PRK09681276 putative type II secretion protein GspC; Provision 88.86
KOG2921|consensus 484 87.99
PF1281278 PDZ_1: PDZ-like domain 87.72
KOG0606|consensus 1205 87.19
PF1281278 PDZ_1: PDZ-like domain 86.54
COG0750 375 Predicted membrane-associated Zn-dependent proteas 83.73
KOG3938|consensus 334 83.1
KOG3834|consensus 462 82.33
COG0750 375 Predicted membrane-associated Zn-dependent proteas 81.78
>KOG3209|consensus Back     alignment and domain information 
Probab=99.74  E-value=1.9e-17  Score=144.04  Aligned_cols=155  Identities=26%  Similarity=0.400  Sum_probs=112.7

Q ss_pred             eeeeeeeeechhhh-hhhccCceeeEEEeecccCCC---------CCceEEEEEEEcCC-CCcCEEEecCCCCCCCCCCC
Q psy12206          3 IDVISYYCQTCLKV-IALNVGISKFMYVRRKKVTRQ---------GNMKILDIELVKGN-KGLGFSIAGGIGNQHIPGDN   71 (164)
Q Consensus         3 ~~~~~~~~~~~~~~-~~~~~~~~~~~~v~~~~~~~~---------~~~~~~~v~L~k~~-~glGf~i~gg~~~~~~~~~~   71 (164)
                      |.|+--+|++.... -.......|+|.|||.....+         .+..+..|.|.|.. .||||.|......+.    .
T Consensus       705 ~pV~GksH~~vv~Lm~~AArnghV~LtVRRkv~~~~~~rsp~~s~~~~~~yDV~lhR~ENeGFGFVi~sS~~kp~----s  780 (984)
T KOG3209|consen  705 IPVEGKSHSEVVDLMEAAARNGHVNLTVRRKVRTGPARRSPRNSAAPSGPYDVVLHRKENEGFGFVIMSSQNKPE----S  780 (984)
T ss_pred             eeccCccHHHHHHHHHHHHhcCceEEEEeeeeeeccccCCcccccCCCCCeeeEEecccCCceeEEEEecccCCC----C
Confidence            34444455555444 233445678999988764332         34457889998865 799999998876543    2


Q ss_pred             cEEEEEeCCCChhhhcCCCCCCCEEEEECCeeccC----------CcCC-------------------------------
Q psy12206         72 GIYVTKIMDGGAAQVDGRLQVGDKLIAVRNSTSED----------KRAS-------------------------------  110 (164)
Q Consensus        72 gv~V~~V~~gs~A~~~G~L~~GD~Il~VNG~~v~~----------~~a~-------------------------------  110 (164)
                      +  |.+|.+||||+++|+|++||+|++|||.++.+          ++|+                               
T Consensus       781 g--iGrIieGSPAdRCgkLkVGDrilAVNG~sI~~lsHadiv~LIKdaGlsVtLtIip~ee~~~~~~~~sa~~~s~~t~~  858 (984)
T KOG3209|consen  781 G--IGRIIEGSPADRCGKLKVGDRILAVNGQSILNLSHADIVSLIKDAGLSVTLTIIPPEEAGPPTSMTSAEKQSPFTQN  858 (984)
T ss_pred             C--ccccccCChhHhhccccccceEEEecCeeeeccCchhHHHHHHhcCceEEEEEcChhccCCCCCCcchhhcCccccc
Confidence            3  89999999999999999999999999999988          2222                               


Q ss_pred             ----------------------C----------c---------eeEeeeccCCCCccc---CCCCCeEEEEECCCChhhh
Q psy12206        111 ----------------------P----------G---------IFLCNIAGGIGNQHI---PGDNGIYVTKIMDGGAAQV  146 (164)
Q Consensus       111 ----------------------~----------~---------v~l~~~~~~~~~~~~---~~~~gv~I~~v~~gs~A~~  146 (164)
                                            |          +         |+|-....|+|+...   ..+.++||..+.+++||.+
T Consensus       859 ~~~~q~~glp~~~~s~~~~~pqpdt~~~~~~~~r~~qn~~~~~VelErG~kGFGFSiRGGreynM~LfVLRlAeDGPA~r  938 (984)
T KOG3209|consen  859 GPYEQQYGLPGPRPSVYEEHPQPDTFQGLSINDRMSQNGDLYTVELERGAKGFGFSIRGGREYNMDLFVLRLAEDGPAIR  938 (984)
T ss_pred             CCHhHccCCCCCCccccccCCCCccccceeccccccccCCeeEEEeeccccccceEeecccccccceEEEEeccCCCccc
Confidence                                  0          0         233222334444332   2356999999999999999


Q ss_pred             cCCCCCCCEEEEECCEe
Q psy12206        147 DGRLQVGDKLIAVRNST  163 (164)
Q Consensus       147 ~G~L~~GD~Il~VNg~~  163 (164)
                      +|+++.||+|++|||++
T Consensus       939 dGrm~VGDqi~eINGes  955 (984)
T KOG3209|consen  939 DGRMRVGDQITEINGES  955 (984)
T ss_pred             cCceeecceEEEecCcc
Confidence            99999999999999986

>KOG3209|consensus Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>KOG3550|consensus Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>KOG3550|consensus Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>PF11874 DUF3394: Domain of unknown function (DUF3394); InterPro: IPR021814 This domain is functionally uncharacterised Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>KOG2921|consensus Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query164
2xkx_A 721 Single Particle Analysis Of Psd-95 In Negative Stai 4e-29
3gsl_A196 Crystal Structure Of Psd-95 Tandem Pdz Domains 1 An 2e-27
3zrt_A199 Crystal Structure Of Human Psd-95 Pdz1-2 Length = 1 2e-27
2ka9_A189 Solution Structure Of Psd-95 Pdz12 Complexed With C 1e-26
2fe5_A94 The Crystal Structure Of The Second Pdz Domain Of H 2e-23
2fe5_A94 The Crystal Structure Of The Second Pdz Domain Of H 2e-15
2byg_A117 2nd Pdz Domain Of Discs Large Homologue 2 Length = 6e-23
2byg_A117 2nd Pdz Domain Of Discs Large Homologue 2 Length = 1e-15
4g69_A100 Structure Of The Human Discs Large 1 Pdz2 - Adenoma 1e-22
4g69_A100 Structure Of The Human Discs Large 1 Pdz2 - Adenoma 6e-15
3rl8_A105 Crytal Structure Of Hdlg1-Pdz2 Complexed With Apc L 2e-22
3rl8_A105 Crytal Structure Of Hdlg1-Pdz2 Complexed With Apc L 6e-15
2awx_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 2e-22
2awx_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 2e-14
2x7z_A99 Crystal Structure Of The Sap97 Pdz2 I342w C378a Mut 4e-22
2x7z_A99 Crystal Structure Of The Sap97 Pdz2 I342w C378a Mut 2e-14
2g2l_A105 Crystal Structure Of The Second Pdz Domain Of Sap97 5e-22
2g2l_A105 Crystal Structure Of The Second Pdz Domain Of Sap97 2e-14
1qlc_A95 Solution Structure Of The Second Pdz Domain Of Post 8e-22
1qlc_A95 Solution Structure Of The Second Pdz Domain Of Post 4e-14
2awu_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 9e-22
2awu_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 2e-14
2oqs_A97 Structure Of The HdlgSAP97 PDZ2 IN COMPLEX WITH HPV 3e-21
2oqs_A97 Structure Of The HdlgSAP97 PDZ2 IN COMPLEX WITH HPV 8e-15
2aww_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 4e-21
2aww_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 7e-14
2i0l_A84 X-Ray Crystal Structure Of Sap97 Pdz2 Bound To The 2e-20
2i0l_A84 X-Ray Crystal Structure Of Sap97 Pdz2 Bound To The 3e-14
4amh_A106 Influence Of Circular Permutation On The Folding Pa 4e-19
4amh_A106 Influence Of Circular Permutation On The Folding Pa 2e-14
2i1n_A102 Crystal Structure Of The 1st Pdz Domain Of Human Dl 2e-13
2i1n_A102 Crystal Structure Of The 1st Pdz Domain Of Human Dl 5e-08
1zok_A93 Pdz1 Domain Of Synapse Associated Protein 97 Length 2e-12
1zok_A93 Pdz1 Domain Of Synapse Associated Protein 97 Length 4e-06
1iu0_A91 The First Pdz Domain Of Psd-95 Length = 91 4e-12
1iu0_A91 The First Pdz Domain Of Psd-95 Length = 91 4e-06
3rl7_B107 Crytal Structure Of Hdlg1-Pdz1 Complexed With Apc L 6e-12
3rl7_B107 Crytal Structure Of Hdlg1-Pdz1 Complexed With Apc L 5e-06
2wl7_A102 Crystal Structure Of The Psd93 Pdz1 Domain Length = 8e-12
2wl7_A102 Crystal Structure Of The Psd93 Pdz1 Domain Length = 2e-06
1rgr_A99 Cyclic Peptides Targeting Pdz Domains Of Psd-95: St 1e-11
1rgr_A99 Cyclic Peptides Targeting Pdz Domains Of Psd-95: St 4e-06
1kef_A93 Pdz1 Of Sap90 Length = 93 1e-11
1kef_A93 Pdz1 Of Sap90 Length = 93 4e-06
2jin_A102 Crystal Structure Of Pdz Domain Of Synaptojanin-2 B 3e-11
2jin_A102 Crystal Structure Of Pdz Domain Of Synaptojanin-2 B 1e-07
2jik_A101 Crystal Structure Of Pdz Domain Of Synaptojanin-2 B 3e-11
2jik_A101 Crystal Structure Of Pdz Domain Of Synaptojanin-2 B 1e-07
2eno_A120 Solution Structure Of The Pdz Domain From Human Syn 4e-11
2eno_A120 Solution Structure Of The Pdz Domain From Human Syn 2e-07
1wha_A105 Solution Structure Of The Second Pdz Domain Of Huma 2e-08
1wha_A105 Solution Structure Of The Second Pdz Domain Of Huma 1e-04
2fne_A117 The Crystal Structure Of The 13th Pdz Domain Of Mpd 4e-08
2fne_A117 The Crystal Structure Of The 13th Pdz Domain Of Mpd 7e-04
2iwn_A97 3rd Pdz Domain Of Multiple Pdz Domain Protein Mpdz 2e-07
2fn5_A94 Nmr Structure Of The Neurabin Pdz Domain (502-594) 1e-06
2koj_A111 Solution Structure Of Mouse Par-3 Pdz2 (Residues 45 2e-06
2ogp_A97 Solution Structure Of The Second Pdz Domain Of Par- 3e-06
3hvq_C170 Crystal Structure Of A Complex Between Protein Phos 3e-06
2kom_A121 Solution Structure Of Humar Par-3b Pdz2 (Residues 4 3e-06
2g5m_B113 Spinophilin Pdz Domain Length = 113 3e-06
3egh_C170 Crystal Structure Of A Complex Between Protein Phos 5e-06
3egg_C170 Crystal Structure Of A Complex Between Protein Phos 5e-06
1d5g_A96 Solution Structure Of The Pdz2 Domain From Human Ph 8e-06
3pdz_A96 Solution Structure Of The Pdz2 Domain From Human Ph 8e-06
1wf8_A107 Solution Structure Of The Pdz Domain Of Spinophilin 1e-05
2koh_A111 Nmr Structure Of Mouse Par3-Pdz3 In Complex With Ve 2e-05
2koh_A111 Nmr Structure Of Mouse Par3-Pdz3 In Complex With Ve 8e-04
2k1z_A104 Solution Structure Of Par-3 Pdz3 Length = 104 2e-05
2k1z_A104 Solution Structure Of Par-3 Pdz3 Length = 104 7e-04
2dmz_A129 Solution Structure Of The Third Pdz Domain Of Human 2e-05
1vj6_A102 Pdz2 From Ptp-Bl In Complex With The C-Terminal Lig 3e-05
2r4h_B112 Crystal Structure Of A C1190s Mutant Of The 6th Pdz 4e-05
1gm1_A94 Second Pdz Domain (Pdz2) Of Ptp-Bl Length = 94 4e-05
2dm8_A116 Solution Structure Of The Eighth Pdz Domain Of Huma 6e-05
1um1_A110 Solution Structure Of Rsgi Ruh-007, Pdz Domain In H 7e-05
3jxt_A104 Crystal Structure Of The Third Pdz Domain Of Sap-10 7e-05
1um7_A113 Solution Structure Of The Third Pdz Domain Of Synap 8e-05
1uju_A111 Solution Structure Of The Fourth Pdz Domain Of Huma 8e-05
2dkr_A93 Solution Structure Of The Pdz Domain From Human Lin 1e-04
2ain_A93 Solution Structure Of The Af-6 Pdz Domain Complexed 1e-04
1t2m_A101 Solution Structure Of The Pdz Domain Of Af-6 Length 1e-04
3axa_A106 Crystal Structure Of Afadin Pdz Domain In Complex W 1e-04
1xz9_A101 Structure Of Af-6 Pdz Domain Length = 101 1e-04
2he2_A102 Crystal Structure Of The 3rd Pdz Domain Of Human Di 2e-04
2q9v_A90 Crystal Structure Of The C890s Mutant Of The 4th Pd 2e-04
2vz5_A139 Structure Of The Pdz Domain Of Tax1 (Human T-Cell L 2e-04
3ch8_A195 The Crystal Structure Of Pdz-Fibronectin Fusion Pro 2e-04
3diw_A124 C-Terminal Beta-Catenin Bound Tip-1 Structure Lengt 3e-04
3gj9_A124 Crystal Structure Of Tip-1 In Complex With C-Termin 3e-04
2w4f_A97 Crystal Structure Of The First Pdz Domain Of Human 3e-04
3sfj_A104 Crystal Structure Of Tax-Interacting Protein-1 (Tip 3e-04
2kg2_A124 Solution Structure Of A Pdz Protein Length = 124 3e-04
4e3b_A102 Crystal Structure Of Tax-Interacting Protein-1 (Tip 3e-04
2qg1_A92 Crystal Structure Of The 11th Pdz Domain Of Mpdz (M 3e-04
3dj3_A113 Crystal Structure Of C-Terminal Truncated Tip-1 (6- 3e-04
1mfg_A95 The Structure Of Erbin Pdz Domain Bound To The Carb 3e-04
3cbx_A105 The Dvl2 Pdz Domain In Complex With The C1 Inhibito 3e-04
1wg6_A127 Solution Structure Of Pdz Domain In Protein Xp_1108 4e-04
2h3l_A103 Crystal Structure Of Erbin Pdz Length = 103 4e-04
2rey_A100 Crystal Structure Of The Pdz Domain Of Human Dishev 4e-04
2daz_A124 Solution Structure Of The 7th Pdz Domain Of Inad-Li 4e-04
3cby_A108 The Dvl2 Pdz Domain In Complex With The N1 Inhibito 4e-04
3cc0_A108 The Dvl2 Pdz Domain In Complex With The N3 Inhibito 4e-04
1wfv_A103 Solution Structure Of The Fifth Pdz Domain Of Human 4e-04
3cbz_A108 The Dvl2 Pdz Domain In Complex With The N2 Inhibito 4e-04
1q7x_A108 Solution Structure Of The Alternatively Spliced Pdz 5e-04
2kaw_A90 Nmr Structure Of The Mdvl1 Pdz Domain In Complex Wi 6e-04
1mc7_A95 Solution Structure Of Mdvl1 Pdz Domain Length = 95 7e-04
2qbw_A195 The Crystal Structure Of Pdz-Fibronectin Fusion Pro 7e-04
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure 
Iteration: 1

 Score =  123 bits (309), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 73/160 (45%), Positives = 92/160 (57%), Gaps = 35/160 (21%)
Query: 37  QGNMKILDIELVKGNKGLGFSIAGGIGNQHIPGDNGIYVTKIMDGGAAQVDGRLQVGDKL 96
           +G M+  +I L +GN GLGFSIAGG  N HI  D  I++TKI+ GGAA  DGRL+V D +
Sbjct: 55  EGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSI 114
Query: 97  -----IAVRNSTSED-----------------KRASPG-----IFLC--------NIAGG 121
                + VR  T                    +R  P      I L         +IAGG
Sbjct: 115 LFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGG 174
Query: 122 IGNQHIPGDNGIYVTKIMDGGAAQVDGRLQVGDKLIAVRN 161
           +GNQHIPGDN IYVTKI++GGAA  DGRLQ+GDK++AV +
Sbjct: 175 VGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNS 214
>pdb|3GSL|A Chain A, Crystal Structure Of Psd-95 Tandem Pdz Domains 1 And 2 Length = 196 Back     alignment and structure
>pdb|3ZRT|A Chain A, Crystal Structure Of Human Psd-95 Pdz1-2 Length = 199 Back     alignment and structure
>pdb|2KA9|A Chain A, Solution Structure Of Psd-95 Pdz12 Complexed With Cypin Peptide Length = 189 Back     alignment and structure
>pdb|2FE5|A Chain A, The Crystal Structure Of The Second Pdz Domain Of Human Dlg3 Length = 94 Back     alignment and structure
>pdb|2FE5|A Chain A, The Crystal Structure Of The Second Pdz Domain Of Human Dlg3 Length = 94 Back     alignment and structure
>pdb|2BYG|A Chain A, 2nd Pdz Domain Of Discs Large Homologue 2 Length = 117 Back     alignment and structure
>pdb|2BYG|A Chain A, 2nd Pdz Domain Of Discs Large Homologue 2 Length = 117 Back     alignment and structure
>pdb|4G69|A Chain A, Structure Of The Human Discs Large 1 Pdz2 - Adenomatous Polyposis Coli Cytoskeletal Polarity Complex Length = 100 Back     alignment and structure
>pdb|4G69|A Chain A, Structure Of The Human Discs Large 1 Pdz2 - Adenomatous Polyposis Coli Cytoskeletal Polarity Complex Length = 100 Back     alignment and structure
>pdb|3RL8|A Chain A, Crytal Structure Of Hdlg1-Pdz2 Complexed With Apc Length = 105 Back     alignment and structure
>pdb|3RL8|A Chain A, Crytal Structure Of Hdlg1-Pdz2 Complexed With Apc Length = 105 Back     alignment and structure
>pdb|2AWX|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378s Length = 105 Back     alignment and structure
>pdb|2AWX|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378s Length = 105 Back     alignment and structure
>pdb|2X7Z|A Chain A, Crystal Structure Of The Sap97 Pdz2 I342w C378a Mutant Protein Domain Length = 99 Back     alignment and structure
>pdb|2X7Z|A Chain A, Crystal Structure Of The Sap97 Pdz2 I342w C378a Mutant Protein Domain Length = 99 Back     alignment and structure
>pdb|2G2L|A Chain A, Crystal Structure Of The Second Pdz Domain Of Sap97 In Complex With A Glur-A C-Terminal Peptide Length = 105 Back     alignment and structure
>pdb|2G2L|A Chain A, Crystal Structure Of The Second Pdz Domain Of Sap97 In Complex With A Glur-A C-Terminal Peptide Length = 105 Back     alignment and structure
>pdb|1QLC|A Chain A, Solution Structure Of The Second Pdz Domain Of Postsynaptic Density-95 Length = 95 Back     alignment and structure
>pdb|1QLC|A Chain A, Solution Structure Of The Second Pdz Domain Of Postsynaptic Density-95 Length = 95 Back     alignment and structure
>pdb|2AWU|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378g Length = 105 Back     alignment and structure
>pdb|2AWU|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378g Length = 105 Back     alignment and structure
>pdb|2OQS|A Chain A, Structure Of The HdlgSAP97 PDZ2 IN COMPLEX WITH HPV-18 Papillomavirus E6 Peptide Length = 97 Back     alignment and structure
>pdb|2OQS|A Chain A, Structure Of The HdlgSAP97 PDZ2 IN COMPLEX WITH HPV-18 Papillomavirus E6 Peptide Length = 97 Back     alignment and structure
>pdb|2AWW|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378g With C-Terminal Glur-A Peptide Length = 105 Back     alignment and structure
>pdb|2AWW|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378g With C-Terminal Glur-A Peptide Length = 105 Back     alignment and structure
>pdb|2I0L|A Chain A, X-Ray Crystal Structure Of Sap97 Pdz2 Bound To The C- Terminal Peptide Of Hpv18 E6. Length = 84 Back     alignment and structure
>pdb|2I0L|A Chain A, X-Ray Crystal Structure Of Sap97 Pdz2 Bound To The C- Terminal Peptide Of Hpv18 E6. Length = 84 Back     alignment and structure
>pdb|4AMH|A Chain A, Influence Of Circular Permutation On The Folding Pathway Of A Pdz Domain Length = 106 Back     alignment and structure
>pdb|4AMH|A Chain A, Influence Of Circular Permutation On The Folding Pathway Of A Pdz Domain Length = 106 Back     alignment and structure
>pdb|2I1N|A Chain A, Crystal Structure Of The 1st Pdz Domain Of Human Dlg3 Length = 102 Back     alignment and structure
>pdb|2I1N|A Chain A, Crystal Structure Of The 1st Pdz Domain Of Human Dlg3 Length = 102 Back     alignment and structure
>pdb|1ZOK|A Chain A, Pdz1 Domain Of Synapse Associated Protein 97 Length = 93 Back     alignment and structure
>pdb|1ZOK|A Chain A, Pdz1 Domain Of Synapse Associated Protein 97 Length = 93 Back     alignment and structure
>pdb|1IU0|A Chain A, The First Pdz Domain Of Psd-95 Length = 91 Back     alignment and structure
>pdb|1IU0|A Chain A, The First Pdz Domain Of Psd-95 Length = 91 Back     alignment and structure
>pdb|3RL7|B Chain B, Crytal Structure Of Hdlg1-Pdz1 Complexed With Apc Length = 107 Back     alignment and structure
>pdb|3RL7|B Chain B, Crytal Structure Of Hdlg1-Pdz1 Complexed With Apc Length = 107 Back     alignment and structure
>pdb|2WL7|A Chain A, Crystal Structure Of The Psd93 Pdz1 Domain Length = 102 Back     alignment and structure
>pdb|2WL7|A Chain A, Crystal Structure Of The Psd93 Pdz1 Domain Length = 102 Back     alignment and structure
>pdb|1RGR|A Chain A, Cyclic Peptides Targeting Pdz Domains Of Psd-95: Structural Basis For Enhanced Affinity And Enzymatic Stability Length = 99 Back     alignment and structure
>pdb|1RGR|A Chain A, Cyclic Peptides Targeting Pdz Domains Of Psd-95: Structural Basis For Enhanced Affinity And Enzymatic Stability Length = 99 Back     alignment and structure
>pdb|1KEF|A Chain A, Pdz1 Of Sap90 Length = 93 Back     alignment and structure
>pdb|1KEF|A Chain A, Pdz1 Of Sap90 Length = 93 Back     alignment and structure
>pdb|2JIN|A Chain A, Crystal Structure Of Pdz Domain Of Synaptojanin-2 Binding Protein Length = 102 Back     alignment and structure
>pdb|2JIN|A Chain A, Crystal Structure Of Pdz Domain Of Synaptojanin-2 Binding Protein Length = 102 Back     alignment and structure
>pdb|2JIK|A Chain A, Crystal Structure Of Pdz Domain Of Synaptojanin-2 Binding Protein Length = 101 Back     alignment and structure
>pdb|2JIK|A Chain A, Crystal Structure Of Pdz Domain Of Synaptojanin-2 Binding Protein Length = 101 Back     alignment and structure
>pdb|2ENO|A Chain A, Solution Structure Of The Pdz Domain From Human Synaptojanin 2 Binding Protein Length = 120 Back     alignment and structure
>pdb|2ENO|A Chain A, Solution Structure Of The Pdz Domain From Human Synaptojanin 2 Binding Protein Length = 120 Back     alignment and structure
>pdb|1WHA|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Scribble (Kiaa0147 Protein) Length = 105 Back     alignment and structure
>pdb|1WHA|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Scribble (Kiaa0147 Protein) Length = 105 Back     alignment and structure
>pdb|2FNE|A Chain A, The Crystal Structure Of The 13th Pdz Domain Of Mpdz Length = 117 Back     alignment and structure
>pdb|2FNE|A Chain A, The Crystal Structure Of The 13th Pdz Domain Of Mpdz Length = 117 Back     alignment and structure
>pdb|2IWN|A Chain A, 3rd Pdz Domain Of Multiple Pdz Domain Protein Mpdz (Casp Target) Length = 97 Back     alignment and structure
>pdb|2FN5|A Chain A, Nmr Structure Of The Neurabin Pdz Domain (502-594) Length = 94 Back     alignment and structure
>pdb|2KOJ|A Chain A, Solution Structure Of Mouse Par-3 Pdz2 (Residues 450-558) Length = 111 Back     alignment and structure
>pdb|2OGP|A Chain A, Solution Structure Of The Second Pdz Domain Of Par-3 Length = 97 Back     alignment and structure
>pdb|3HVQ|C Chain C, Crystal Structure Of A Complex Between Protein Phosphatase 1 Alpha (Pp1) And The Pp1 Binding And Pdz Domains Of Neurabin Length = 170 Back     alignment and structure
>pdb|2KOM|A Chain A, Solution Structure Of Humar Par-3b Pdz2 (Residues 451-549) Length = 121 Back     alignment and structure
>pdb|2G5M|B Chain B, Spinophilin Pdz Domain Length = 113 Back     alignment and structure
>pdb|3EGH|C Chain C, Crystal Structure Of A Complex Between Protein Phosphatase 1 Alpha (Pp1), The Pp1 Binding And Pdz Domains Of Spinophilin And The Small Natural Molecular Toxin Nodularin-R Length = 170 Back     alignment and structure
>pdb|3EGG|C Chain C, Crystal Structure Of A Complex Between Protein Phosphatase 1 Alpha (Pp1) And The Pp1 Binding And Pdz Domains Of Spinophilin Length = 170 Back     alignment and structure
>pdb|1D5G|A Chain A, Solution Structure Of The Pdz2 Domain From Human Phosphatase Hptp1e Complexed With A Peptide Length = 96 Back     alignment and structure
>pdb|3PDZ|A Chain A, Solution Structure Of The Pdz2 Domain From Human Phosphatase Hptp1e Length = 96 Back     alignment and structure
>pdb|1WF8|A Chain A, Solution Structure Of The Pdz Domain Of SpinophilinNEURABINII PROTEIN Length = 107 Back     alignment and structure
>pdb|2KOH|A Chain A, Nmr Structure Of Mouse Par3-Pdz3 In Complex With Ve-Cadherin C-Terminus Length = 111 Back     alignment and structure
>pdb|2KOH|A Chain A, Nmr Structure Of Mouse Par3-Pdz3 In Complex With Ve-Cadherin C-Terminus Length = 111 Back     alignment and structure
>pdb|2K1Z|A Chain A, Solution Structure Of Par-3 Pdz3 Length = 104 Back     alignment and structure
>pdb|2K1Z|A Chain A, Solution Structure Of Par-3 Pdz3 Length = 104 Back     alignment and structure
>pdb|2DMZ|A Chain A, Solution Structure Of The Third Pdz Domain Of Human Inad- Like Protein Length = 129 Back     alignment and structure
>pdb|1VJ6|A Chain A, Pdz2 From Ptp-Bl In Complex With The C-Terminal Ligand From The Apc Protein Length = 102 Back     alignment and structure
>pdb|2R4H|B Chain B, Crystal Structure Of A C1190s Mutant Of The 6th Pdz Domain Of Human Membrane Associated Guanylate Kinase Length = 112 Back     alignment and structure
>pdb|1GM1|A Chain A, Second Pdz Domain (Pdz2) Of Ptp-Bl Length = 94 Back     alignment and structure
>pdb|2DM8|A Chain A, Solution Structure Of The Eighth Pdz Domain Of Human Inad- Like Protein Length = 116 Back     alignment and structure
>pdb|1UM1|A Chain A, Solution Structure Of Rsgi Ruh-007, Pdz Domain In Human Cdna Length = 110 Back     alignment and structure
>pdb|3JXT|A Chain A, Crystal Structure Of The Third Pdz Domain Of Sap-102 In Complex With A Fluorogenic Peptide-Based Ligand Length = 104 Back     alignment and structure
>pdb|1UM7|A Chain A, Solution Structure Of The Third Pdz Domain Of Synapse- Associated Protein 102 Length = 113 Back     alignment and structure
>pdb|1UJU|A Chain A, Solution Structure Of The Fourth Pdz Domain Of Human Scribble (Kiaa0147 Protein) Length = 111 Back     alignment and structure
>pdb|2DKR|A Chain A, Solution Structure Of The Pdz Domain From Human Lin-7 Homolog B Length = 93 Back     alignment and structure
>pdb|2AIN|A Chain A, Solution Structure Of The Af-6 Pdz Domain Complexed With The C-Terminal Peptide From The Bcr Protein Length = 93 Back     alignment and structure
>pdb|1T2M|A Chain A, Solution Structure Of The Pdz Domain Of Af-6 Length = 101 Back     alignment and structure
>pdb|3AXA|A Chain A, Crystal Structure Of Afadin Pdz Domain In Complex With The C-Terminal Peptide From Nectin-3 Length = 106 Back     alignment and structure
>pdb|1XZ9|A Chain A, Structure Of Af-6 Pdz Domain Length = 101 Back     alignment and structure
>pdb|2HE2|A Chain A, Crystal Structure Of The 3rd Pdz Domain Of Human Discs Large Homologue 2, Dlg2 Length = 102 Back     alignment and structure
>pdb|2Q9V|A Chain A, Crystal Structure Of The C890s Mutant Of The 4th Pdz Domain Of Human Membrane Associated Guanylate Kinase Length = 90 Back     alignment and structure
>pdb|2VZ5|A Chain A, Structure Of The Pdz Domain Of Tax1 (Human T-Cell Leukemia Virus Type I) Binding Protein 3 Length = 139 Back     alignment and structure
>pdb|3CH8|A Chain A, The Crystal Structure Of Pdz-Fibronectin Fusion Protein Length = 195 Back     alignment and structure
>pdb|3DIW|A Chain A, C-Terminal Beta-Catenin Bound Tip-1 Structure Length = 124 Back     alignment and structure
>pdb|3GJ9|A Chain A, Crystal Structure Of Tip-1 In Complex With C-Terminal Of Kir2.3 Length = 124 Back     alignment and structure
>pdb|2W4F|A Chain A, Crystal Structure Of The First Pdz Domain Of Human Scrib1 Length = 97 Back     alignment and structure
>pdb|3SFJ|A Chain A, Crystal Structure Of Tax-Interacting Protein-1 (Tip-1) Pdz Domain Bound To Ical36 Inhibitor Peptide Length = 104 Back     alignment and structure
>pdb|2KG2|A Chain A, Solution Structure Of A Pdz Protein Length = 124 Back     alignment and structure
>pdb|4E3B|A Chain A, Crystal Structure Of Tax-Interacting Protein-1 (Tip-1) Pdz Domain Bound To Ical36-L (Ansrwptsil) Peptide Length = 102 Back     alignment and structure
>pdb|2QG1|A Chain A, Crystal Structure Of The 11th Pdz Domain Of Mpdz (Mupp1) Length = 92 Back     alignment and structure
>pdb|3DJ3|A Chain A, Crystal Structure Of C-Terminal Truncated Tip-1 (6-113) Length = 113 Back     alignment and structure
>pdb|1MFG|A Chain A, The Structure Of Erbin Pdz Domain Bound To The Carboxy- Terminal Tail Of The Erbb2 Receptor Length = 95 Back     alignment and structure
>pdb|3CBX|A Chain A, The Dvl2 Pdz Domain In Complex With The C1 Inhibitory Peptide Length = 105 Back     alignment and structure
>pdb|1WG6|A Chain A, Solution Structure Of Pdz Domain In Protein Xp_110852 Length = 127 Back     alignment and structure
>pdb|2H3L|A Chain A, Crystal Structure Of Erbin Pdz Length = 103 Back     alignment and structure
>pdb|2REY|A Chain A, Crystal Structure Of The Pdz Domain Of Human Dishevelled 2 (Homologous To Drosophila Dsh) Length = 100 Back     alignment and structure
>pdb|2DAZ|A Chain A, Solution Structure Of The 7th Pdz Domain Of Inad-Like Protein Length = 124 Back     alignment and structure
>pdb|3CBY|A Chain A, The Dvl2 Pdz Domain In Complex With The N1 Inhibitory Peptide Length = 108 Back     alignment and structure
>pdb|3CC0|A Chain A, The Dvl2 Pdz Domain In Complex With The N3 Inhibitory Peptide Length = 108 Back     alignment and structure
>pdb|1WFV|A Chain A, Solution Structure Of The Fifth Pdz Domain Of Human Membrane Associated Guanylate Kinase Inverted-2 (Kiaa0705 Protein) Length = 103 Back     alignment and structure
>pdb|3CBZ|A Chain A, The Dvl2 Pdz Domain In Complex With The N2 Inhibitory Peptide Length = 108 Back     alignment and structure
>pdb|1Q7X|A Chain A, Solution Structure Of The Alternatively Spliced Pdz2 Domain (Pdz2b) Of Ptp-Bas (Hptp1e) Length = 108 Back     alignment and structure
>pdb|2KAW|A Chain A, Nmr Structure Of The Mdvl1 Pdz Domain In Complex With Its Inhibitor Length = 90 Back     alignment and structure
>pdb|1MC7|A Chain A, Solution Structure Of Mdvl1 Pdz Domain Length = 95 Back     alignment and structure
>pdb|2QBW|A Chain A, The Crystal Structure Of Pdz-Fibronectin Fusion Protein Length = 195 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query164
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 2e-35
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 1e-18
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 3e-28
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 1e-12
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 2e-11
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 2e-05
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 4e-28
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 5e-11
2byg_A117 Channel associated protein of synapse-110; DLG2, P 7e-28
2byg_A117 Channel associated protein of synapse-110; DLG2, P 9e-18
2awx_A105 Synapse associated protein 97; membrane protein, s 6e-27
2awx_A105 Synapse associated protein 97; membrane protein, s 7e-17
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 1e-26
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 2e-16
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 4e-25
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 4e-15
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 9e-25
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 3e-14
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 2e-24
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 3e-15
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 2e-24
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 2e-17
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 5e-24
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 6e-15
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 8e-24
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 9e-13
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 1e-23
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 1e-12
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 5e-23
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 5e-13
2fne_A117 Multiple PDZ domain protein; structural protein, s 5e-23
2fne_A117 Multiple PDZ domain protein; structural protein, s 2e-13
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 7e-23
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 2e-13
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 1e-22
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 3e-13
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 1e-22
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 4e-13
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 1e-22
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 1e-12
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 2e-22
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 1e-15
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 2e-22
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 8e-14
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 7e-22
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 4e-12
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 9e-22
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 3e-14
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 2e-21
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 4e-12
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 3e-21
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 3e-11
2o2t_A117 Multiple PDZ domain protein; structural protein, s 6e-21
2o2t_A117 Multiple PDZ domain protein; structural protein, s 2e-13
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 8e-21
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 1e-11
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 1e-20
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 3e-11
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 2e-20
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 2e-11
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 5e-20
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 2e-13
2djt_A104 Unnamed protein product; PDZ domain, structural ge 6e-20
2djt_A104 Unnamed protein product; PDZ domain, structural ge 5e-11
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 1e-19
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 2e-09
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 1e-19
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 3e-12
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 1e-19
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 3e-10
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 2e-19
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 3e-10
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 4e-19
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 3e-11
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 5e-19
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 2e-12
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 6e-19
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 4e-10
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 7e-19
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 2e-10
2opg_A98 Multiple PDZ domain protein; structural protein, s 8e-19
2opg_A98 Multiple PDZ domain protein; structural protein, s 1e-09
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 9e-19
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 4e-09
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 9e-19
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 2e-12
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 9e-19
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 2e-12
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 1e-18
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 2e-11
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 1e-18
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 1e-09
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 3e-18
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 2e-09
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 4e-18
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 2e-09
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 4e-18
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 3e-11
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 8e-18
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 9e-13
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 1e-17
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 6e-11
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 2e-17
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 1e-08
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 3e-17
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 9e-11
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 4e-17
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 3e-08
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 6e-17
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 2e-08
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 8e-17
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 5e-09
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 9e-17
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 3e-10
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 1e-16
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 2e-08
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 1e-16
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 6e-09
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 2e-16
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 1e-08
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 3e-16
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 6e-10
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 4e-16
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 6e-09
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 4e-16
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 4e-09
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 5e-16
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 9e-10
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 7e-16
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 3e-08
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 8e-16
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 3e-08
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 1e-15
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 2e-09
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 1e-15
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 2e-08
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 2e-15
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 6e-09
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 2e-15
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 3e-09
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 2e-15
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 3e-09
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 3e-15
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 3e-08
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 4e-15
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 1e-08
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 4e-15
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 7e-10
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 4e-15
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 2e-09
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 9e-15
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 1e-09
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 1e-14
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 7e-10
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 1e-14
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 1e-08
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 2e-14
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 9e-08
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 2e-14
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 2e-08
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 2e-14
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 3e-08
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 2e-14
2qbw_A 195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 8e-09
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 6e-14
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 2e-08
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 7e-14
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 2e-08
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 1e-13
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 4e-08
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 2e-13
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 2e-07
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 4e-13
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 7e-08
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 5e-13
1z87_A 263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 2e-10
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 7e-13
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 3e-08
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 1e-12
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 3e-07
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 1e-12
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 1e-05
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 1e-12
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 7e-07
3k1r_A192 Harmonin; protein-protein complex, alternative spl 6e-12
3k1r_A192 Harmonin; protein-protein complex, alternative spl 1e-06
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 7e-12
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 2e-05
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 1e-11
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 8e-06
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 1e-11
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 2e-06
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 1e-11
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 2e-11
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 1e-06
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 3e-11
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 1e-04
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 4e-11
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 6e-04
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 5e-11
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 3e-05
2v90_A96 PDZ domain-containing protein 3; membrane, protein 2e-10
2v90_A96 PDZ domain-containing protein 3; membrane, protein 6e-04
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 2e-10
2eeh_A100 PDZ domain-containing protein 7; structural genomi 3e-10
2eeh_A100 PDZ domain-containing protein 7; structural genomi 3e-06
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 4e-10
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 1e-05
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 5e-10
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 5e-05
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 5e-10
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 1e-05
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 5e-10
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 9e-06
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 6e-10
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 6e-10
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 3e-05
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 6e-10
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 2e-05
2eei_A106 PDZ domain-containing protein 1; regulatory factor 6e-10
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 2e-09
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 2e-09
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 5e-05
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 2e-09
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 7e-06
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 2e-09
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 2e-09
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 2e-09
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 8e-04
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 2e-09
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 4e-09
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 4e-09
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 3e-06
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 5e-09
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 5e-09
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 5e-09
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 1e-05
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 1e-08
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 3e-04
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 2e-08
2d90_A102 PDZ domain containing protein 1; structural genomi 2e-08
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 2e-08
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 3e-08
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 4e-08
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 5e-06
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 5e-08
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 5e-08
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 6e-08
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 1e-04
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 7e-08
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 8e-08
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 1e-07
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 2e-07
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 3e-07
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 3e-07
3khf_A99 Microtubule-associated serine/threonine-protein ki 3e-07
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 3e-07
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 4e-07
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 7e-07
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 1e-06
2ego_A96 General receptor for phosphoinositides 1- associat 1e-06
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 2e-06
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 2e-06
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 2e-06
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 2e-06
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 5e-06
2eaq_A90 LIM domain only protein 7; conserved hypothetical 6e-06
2eaq_A90 LIM domain only protein 7; conserved hypothetical 4e-04
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 8e-06
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 1e-05
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 2e-05
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 3e-05
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 4e-05
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 9e-05
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 2e-04
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
 Score =  121 bits (305), Expect = 2e-35
 Identities = 72/159 (45%), Positives = 91/159 (57%), Gaps = 35/159 (22%)

Query: 38  GNMKILDIELVKGNKGLGFSIAGGIGNQHIPGDNGIYVTKIMDGGAAQVDGRLQVGDKLI 97
           G+M+  +I L +GN GLGFSIAGG  N HI  D  I++TKI+ GGAA  DGRL+V D ++
Sbjct: 2   GSMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSIL 61

Query: 98  AV-----RNSTSED-----KRASPGIFL-------------------------CNIAGGI 122
            V     R  T        K A   + L                          +IAGG+
Sbjct: 62  FVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGV 121

Query: 123 GNQHIPGDNGIYVTKIMDGGAAQVDGRLQVGDKLIAVRN 161
           GNQHIPGDN IYVTKI++GGAA  DGRLQ+GDK++AV +
Sbjct: 122 GNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNS 160
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Length = 195 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Length = 195 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query164
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.92
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.86
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.83
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.81
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.77
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.76
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 99.74
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 99.66
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 99.57
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 99.56
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.56
2awx_A105 Synapse associated protein 97; membrane protein, s 99.51
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 99.49
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 99.49
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.46
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.45
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 99.44
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.44
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 99.44
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 99.44
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 99.43
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 99.42
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.42
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 99.42
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 99.42
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 99.41
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.41
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.41
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 99.41
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.4
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.4
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 99.4
2fne_A117 Multiple PDZ domain protein; structural protein, s 99.39
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.39
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.39
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 99.38
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.38
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.38
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 99.38
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.38
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 99.38
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 99.38
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.37
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.37
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.36
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.36
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 99.36
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 99.36
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.36
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 99.36
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 99.36
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.35
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 99.35
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 99.35
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 99.35
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 99.34
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 99.34
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.34
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 99.33
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.33
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.33
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 99.33
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 99.33
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.33
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 99.32
2djt_A104 Unnamed protein product; PDZ domain, structural ge 99.32
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 99.32
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.32
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 99.32
2d90_A102 PDZ domain containing protein 1; structural genomi 99.31
2ego_A96 General receptor for phosphoinositides 1- associat 99.31
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.31
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 99.31
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.31
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 99.3
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 99.3
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 99.3
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 99.3
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 99.3
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.3
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 99.3
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 99.3
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 99.29
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 99.29
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 99.29
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 99.29
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 99.28
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 99.28
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.27
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.27
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.27
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.27
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 99.26
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 99.26
2eei_A106 PDZ domain-containing protein 1; regulatory factor 99.26
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.26
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 99.26
2o2t_A117 Multiple PDZ domain protein; structural protein, s 99.25
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 99.25
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 99.25
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 99.24
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 99.24
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 99.24
2eeh_A100 PDZ domain-containing protein 7; structural genomi 99.24
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 99.24
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 99.24
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 99.23
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 99.23
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 99.23
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 99.22
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.22
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 99.22
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 99.22
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 99.22
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 99.21
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 99.21
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 99.2
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 99.2
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 99.19
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 99.19
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 99.18
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 99.18
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 99.17
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 99.16
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 99.16
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 99.15
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 99.15
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 99.15
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 99.15
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 99.14
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 99.13
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 99.13
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 99.12
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.12
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.12
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 99.12
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 99.12
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 99.11
3khf_A99 Microtubule-associated serine/threonine-protein ki 99.1
3k1r_A192 Harmonin; protein-protein complex, alternative spl 99.1
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.1
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 99.08
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 99.07
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 99.07
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 99.06
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 99.06
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 98.65
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 99.06
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 99.06
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 99.06
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 99.06
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 99.06
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 99.05
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 99.04
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 99.02
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 99.02
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.02
2eaq_A90 LIM domain only protein 7; conserved hypothetical 99.0
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 98.99
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 98.98
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 98.96
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 98.95
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 98.94
4amh_A106 Disks large homolog 1; permutation, protein foldin 98.93
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 98.92
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 98.92
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 98.91
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 98.91
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 98.91
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 98.88
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 98.83
2awx_A105 Synapse associated protein 97; membrane protein, s 98.8
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 98.79
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 98.79
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 98.77
2byg_A117 Channel associated protein of synapse-110; DLG2, P 98.76
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 98.75
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 98.75
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 98.75
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 98.74
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 98.74
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 98.74
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 98.72
2opg_A98 Multiple PDZ domain protein; structural protein, s 98.72
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 98.71
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 98.7
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 98.69
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 98.69
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 98.69
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 98.68
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 98.68
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 98.68
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.67
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 98.67
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 98.67
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 98.67
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 98.67
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 98.67
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 98.67
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 98.66
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 98.66
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 98.66
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 98.65
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 98.65
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 98.65
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 98.65
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 98.65
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 98.65
2eaq_A90 LIM domain only protein 7; conserved hypothetical 98.65
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 98.65
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 98.65
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 98.64
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 98.63
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 98.63
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 98.63
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 98.63
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 98.63
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 98.62
2fne_A117 Multiple PDZ domain protein; structural protein, s 98.62
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 98.62
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 98.61
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 98.61
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 98.61
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 98.61
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 98.6
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 98.6
2eei_A106 PDZ domain-containing protein 1; regulatory factor 98.6
2d90_A102 PDZ domain containing protein 1; structural genomi 98.6
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 98.6
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 98.6
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 98.59
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 98.59
2v90_A96 PDZ domain-containing protein 3; membrane, protein 98.59
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 98.59
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 98.59
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 98.58
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 98.58
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 98.58
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 98.58
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 98.58
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 98.58
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 98.57
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 98.57
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 98.57
2djt_A104 Unnamed protein product; PDZ domain, structural ge 98.57
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.57
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 98.56
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 98.56
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 98.56
2eeh_A100 PDZ domain-containing protein 7; structural genomi 98.56
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 98.56
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 98.56
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 98.56
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 98.56
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 98.55
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 98.55
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 98.55
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 98.54
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 98.54
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 98.53
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 98.52
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 98.52
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 98.52
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 98.52
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 98.51
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 98.51
2ego_A96 General receptor for phosphoinositides 1- associat 98.5
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 98.5
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 98.5
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 98.5
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.5
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 98.49
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 98.49
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 98.49
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 98.49
3khf_A99 Microtubule-associated serine/threonine-protein ki 98.48
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 98.48
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 98.48
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 98.47
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 98.47
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 98.47
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 98.47
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 98.46
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 98.46
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 98.46
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 98.44
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 98.44
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 98.43
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 98.43
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 98.43
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.42
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 98.42
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 98.42
2o2t_A117 Multiple PDZ domain protein; structural protein, s 98.42
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 98.41
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 98.41
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 98.41
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 98.41
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 98.41
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 98.4
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 98.39
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 98.38
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 98.38
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 98.38
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 98.38
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 98.38
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 98.38
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 98.35
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 98.35
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 98.35
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 98.34
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 98.34
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 98.34
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 98.34
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 98.34
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 98.34
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 98.32
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 98.32
2qbw_A 195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 98.31
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 98.31
3k1r_A192 Harmonin; protein-protein complex, alternative spl 98.29
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 98.29
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 98.27
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.27
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.26
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 98.26
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.26
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 98.24
2krg_A 216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 98.24
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.24
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 98.24
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 98.22
2kl1_A94 YLBL protein; structure genomics, structural genom 98.2
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.2
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.19
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 97.5
2kl1_A94 YLBL protein; structure genomics, structural genom 98.18
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 98.18
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 98.18
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 98.17
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 98.15
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.15
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.15
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.15
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.14
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.13
1z87_A 263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 98.08
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 98.08
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.08
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.07
3k50_A 403 Putative S41 protease; structural genomics, joint 98.05
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 97.94
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 97.92
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 97.92
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 97.91
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 97.88
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 97.87
2hga_A125 Conserved protein MTH1368; GFT structural genomics 97.85
2hga_A125 Conserved protein MTH1368; GFT structural genomics 97.84
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 97.83
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 97.83
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 97.83
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 97.81
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 97.76
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 97.75
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 97.73
3pv2_A 451 DEGQ; trypsin fold, PDZ domain, chaperone protease 97.72
4fgm_A597 Aminopeptidase N family protein; structural genomi 97.68
3k50_A 403 Putative S41 protease; structural genomics, joint 97.66
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 97.65
4fgm_A597 Aminopeptidase N family protein; structural genomi 97.65
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 97.51
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 97.43
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 97.33
1ky9_A 448 Protease DO, DEGP, HTRA; protein quality control, 97.13
4fln_A 539 Protease DO-like 2, chloroplastic; protease, DEG, 96.78
1k32_A 1045 Tricorn protease; protein degradation, substrate g 96.4
1k32_A 1045 Tricorn protease; protein degradation, substrate g 96.04
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
Probab=99.92  E-value=8.1e-24  Score=159.49  Aligned_cols=127  Identities=50%  Similarity=0.793  Sum_probs=100.7

Q ss_pred             CCceEEEEEEEcCCCCcCEEEecCCCCCCCCCCCcEEEEEeCCCChhhhcCCCCCCCEEEEECCeeccCC----------
Q psy12206         38 GNMKILDIELVKGNKGLGFSIAGGIGNQHIPGDNGIYVTKIMDGGAAQVDGRLQVGDKLIAVRNSTSEDK----------  107 (164)
Q Consensus        38 ~~~~~~~v~L~k~~~glGf~i~gg~~~~~~~~~~gv~V~~V~~gs~A~~~G~L~~GD~Il~VNG~~v~~~----------  107 (164)
                      .+++.++++|.|+..+|||++.++.+.++...+.+++|..|.|+|||+++|+|++||+|++|||.++.+.          
T Consensus         2 ~~~~~~~v~l~~~~~~lG~~i~~g~~~~~~~~~~g~~V~~V~~~spA~~aG~l~~GD~I~~vng~~v~~~~~~~~~~~~~   81 (196)
T 3gsl_A            2 GSMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALK   81 (196)
T ss_dssp             -CEEEEEEEEECBTTBSSEEEECCTTSCTTSSCCCEEEEEECTTSHHHHHCCCCTTCEEEEETTEECTTCCHHHHHHHHH
T ss_pred             CCcEEEEEEEEECCCCCCEEEEcccCCcccCCCCCEEEEEECCCChHHhcCCCCCCCEEEEECCEECCCCCHHHHHHHHH
Confidence            4678999999999999999999998876544568999999999999999999999999999999999871          


Q ss_pred             cCCCceeE-----------------eeeccCCCCcc--------cCCCCCeEEEEECCCChhhhcCCCCCCCEEEEECCE
Q psy12206        108 RASPGIFL-----------------CNIAGGIGNQH--------IPGDNGIYVTKIMDGGAAQVDGRLQVGDKLIAVRNS  162 (164)
Q Consensus       108 ~a~~~v~l-----------------~~~~~~~~~~~--------~~~~~gv~I~~v~~gs~A~~~G~L~~GD~Il~VNg~  162 (164)
                      .+...+.|                 .....++|+..        .....|++|.+|.++|||+++|+|++||+|++|||+
T Consensus        82 ~~g~~v~l~v~r~~~~~~~~~~v~l~~~~~~lG~~~~~~~~~~~~~~~~gv~V~~V~~gs~A~~aG~L~~GD~Il~Vng~  161 (196)
T 3gsl_A           82 EAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSV  161 (196)
T ss_dssp             TSCSEEEEEEEEECCCCEEEEEEEEEEBTTBSCEEEEESBTSCSBTTBCCEEEEEECTTSHHHHHCCCCTTCEEEEETTE
T ss_pred             hCCCcEEEEEEecCCCccccEEEEEecCCCCceEEEEccCCCcCCCCCCCEEEEEECCCChHHhcCCCCCCCEEEEECCC
Confidence            11222222                 11112333322        223458999999999999999999999999999999


Q ss_pred             eC
Q psy12206        163 TR  164 (164)
Q Consensus       163 ~v  164 (164)
                      +|
T Consensus       162 ~v  163 (196)
T 3gsl_A          162 GL  163 (196)
T ss_dssp             EC
T ss_pred             cC
Confidence            86
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 164
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 8e-17
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 8e-08
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 3e-15
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 3e-07
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 5e-14
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 2e-05
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 3e-13
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 4e-05
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 3e-12
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 6e-05
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 3e-12
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 1e-04
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 9e-12
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 4e-07
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 9e-12
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 6e-04
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 2e-11
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 3e-06
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 2e-11
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 7e-04
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 2e-11
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 2e-04
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 3e-11
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 2e-07
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 5e-11
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 7e-04
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 5e-11
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 3e-05
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 6e-11
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 6e-06
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 1e-10
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 0.002
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-10
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 3e-10
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 6e-04
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 3e-10
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 6e-04
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 3e-10
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 5e-05
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 4e-10
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 6e-05
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 4e-10
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 7e-05
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 5e-10
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 6e-06
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 5e-10
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 8e-05
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 5e-10
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 7e-05
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 7e-10
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 5e-05
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 1e-09
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 5e-04
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 2e-09
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 7e-04
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-09
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 3e-09
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 9e-04
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 3e-09
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 5e-09
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 5e-09
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 0.004
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 8e-09
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 0.001
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 8e-09
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 1e-04
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 2e-08
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 8e-04
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 2e-08
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 0.003
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 3e-08
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 3e-08
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 7e-04
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 4e-08
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 6e-08
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 0.004
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 7e-08
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 0.004
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 7e-08
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 9e-08
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 0.002
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-07
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 6e-07
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 1e-06
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 4e-06
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 9e-06
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 1e-05
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 2e-05
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 4e-05
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 7e-05
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 8e-05
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 9e-05
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 1e-04
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 0.003
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 3e-04
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 4e-04
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 6e-04
d1vaea_111 b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T 0.002
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure

class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Synapse-associated protein 102
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 69.2 bits (169), Expect = 8e-17
 Identities = 47/67 (70%), Positives = 59/67 (88%)

Query: 42  ILDIELVKGNKGLGFSIAGGIGNQHIPGDNGIYVTKIMDGGAAQVDGRLQVGDKLIAVRN 101
           I+++ L+KG KGLGFSIAGGIGNQHIPGDN IY+TKI++GGAAQ DGRLQ+GD+L+AV N
Sbjct: 2   IMEVNLLKGPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNN 61

Query: 102 STSEDKR 108
           +  +D R
Sbjct: 62  TNLQDVR 68
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query164
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.68
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.67
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.6
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.58
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.58
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.58
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.58
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.57
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.57
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.55
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.55
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.53
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.52
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.52
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.51
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.51
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.5
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.5
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.5
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.5
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.49
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.48
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.48
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.48
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 99.48
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.46
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.46
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.45
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 99.45
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.45
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.45
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.45
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.45
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 99.45
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.44
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.43
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.43
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.42
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.42
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 99.41
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.41
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 99.4
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 99.4
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.38
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.38
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.38
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 99.37
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.36
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 99.36
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 99.35
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.32
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.31
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 99.28
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.25
d1y7na179 Amyloid beta A4 precursor protein-binding family A 99.23
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 99.19
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 99.14
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.11
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.08
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 98.99
d1fc6a392 Photosystem II D1 C-terminal processing protease { 98.99
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 98.97
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 98.97
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 98.96
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.92
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 98.91
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 98.9
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 98.89
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 98.89
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 98.87
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 98.87
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 98.87
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 98.87
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 98.86
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 98.86
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 98.85
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 98.84
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 98.84
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 98.83
d1x45a185 Amyloid beta A4 precursor protein-binding family A 98.83
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 98.83
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 98.82
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 98.81
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 98.79
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 98.79
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 98.79
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 98.77
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 98.77
d1rzxa_98 GTPase-binding domain of the cell polarity protein 98.77
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 98.77
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 98.76
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 98.76
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 98.76
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 98.76
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 98.75
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 98.74
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 98.73
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 98.71
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 98.71
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 98.7
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 98.69
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 98.69
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 98.69
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 98.69
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 98.68
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 98.68
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 98.67
d1fc6a392 Photosystem II D1 C-terminal processing protease { 98.67
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 98.66
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.66
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 98.65
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 98.65
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 98.63
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 98.62
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.6
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 98.59
d1y7na179 Amyloid beta A4 precursor protein-binding family A 98.58
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 98.58
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 98.57
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 98.53
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 98.53
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.52
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 98.51
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 98.46
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 98.39
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 98.39
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.32
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.31
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.28
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 98.23
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.21
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 98.19
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 98.18
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.12
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.04
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 97.69
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Synaptic protein PSD-95
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=99.68  E-value=5.4e-17  Score=108.17  Aligned_cols=66  Identities=48%  Similarity=0.810  Sum_probs=61.0

Q ss_pred             eEEEEEEEcCCCCcCEEEecCCCCCCCCCCCcEEEEEeCCCChhhhcCCCCCCCEEEEECCeeccC
Q psy12206         41 KILDIELVKGNKGLGFSIAGGIGNQHIPGDNGIYVTKIMDGGAAQVDGRLQVGDKLIAVRNSTSED  106 (164)
Q Consensus        41 ~~~~v~L~k~~~glGf~i~gg~~~~~~~~~~gv~V~~V~~gs~A~~~G~L~~GD~Il~VNG~~v~~  106 (164)
                      |+.+|+|.|++.+|||+|.||.+.+......++||..|.++|||+++|+|++||+|++|||.++.+
T Consensus         1 E~~~V~l~k~~~glG~~i~gg~~~~~~~~~~gi~I~~V~~gg~A~~~G~L~~GD~Il~VNg~~v~~   66 (93)
T d1rgra_           1 EYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVRE   66 (93)
T ss_dssp             CEEEEEEECCSSCCSEEECCCSSSCSCTTCCCCCEEEECTTSHHHHHCCCCTTCEEEEETTEECSS
T ss_pred             CCEEEEEEeCCCcCCEEEEeecCCCCcCCCCCEEEEEECCCChHHhcCCCCcCcEEEEECCEECCC
Confidence            467899999989999999999887776677899999999999999999999999999999999988
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure