Psyllid ID: psy12238

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160------
MCQNMLVILAHFLCKYFLGFSSNFKLFSKFGDTKSDGKLLTLSQSDKWMKQAKVIDGKKVTTTDTGIHFKKFKSLKIGLSDYQKFIESLAKHKSVPEYDVWASKNSEAQIQNTISRLTDPSRYTGSHKLRFDEAGKGKGLAGRKDSVEAAGYVQGYQNRNSYDKTH
ccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHcccccccccccccccEEEEEEEcccccccHHHHHHHHHHHHccccccHHHccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHcccccccEEccccccEEEEEEccccccHHHHHHHHHHHHHcccccccccccccccccccccccHcccccccccccccccccccccccccccccEcccccccEccccccccccccc
MCQNMLVILAHFLCKyflgfssnFKLFskfgdtksdgklltlsQSDKWMKqakvidgkkvtttdtgihfkkfkslkigLSDYQKFIESLAkhksvpeydvwasknsEAQIQNTIsrltdpsrytgshklrfdeagkgkglagrkdsVEAAgyvqgyqnrnsydkth
MCQNMLVILAHFLCKYFLGFSSNFKLFSKFGDTKSDGKLLtlsqsdkwmkqakvidgkkvtttdtgihfkkfkslkiglSDYQKFIESLAKHKSVPEYDVWASKNSEAQiqntisrltdpsrytgshklrfdeagkgkglagrkdsveaagyvqgyqnrnsydkth
MCQNMLVILAHFLCKYFLGFSSNFKLFSKFGDTKSDGKLLTLSQSDKWMKQAKVIDGKKVTTTDTGIHFKKFKSLKIGLSDYQKFIESLAKHKSVPEYDVWASKNSEAQIQNTISRLTDPSRYTGSHKLRFDEAGKGKGLAGRKDSVEAAGYVQGYQNRNSYDKTH
***NMLVILAHFLCKYFLGFSSNFKLFSKFGDTKSDGKLLTLSQSDKWMKQAKVIDGKKVTTTDTGIHFKKFKSLKIGLSDYQKFIESLAKHKSVPEYDVWA****************************************************************
***NMLVILAHFLCKYFLGFSSNFKLFSK*************SQSDKWMKQAKVIDGKKVTTTDTGIHFKKFKSLKIGLSDYQKFIESLA*************************RLTDPSRYTGSHKLRFD*******LAGRKDSVEAAGYVQ*Y**********
MCQNMLVILAHFLCKYFLGFSSNFKLFSKFGDTKSDGKLLTLSQSDKWMKQAKVIDGKKVTTTDTGIHFKKFKSLKIGLSDYQKFIESLAKHKSVPEYDVWASKNSEAQIQNTISRLTDPSRYTGSHKLRFDEAGKGKGLAGRKDSVEAAGYVQGYQNRNSYDKTH
MCQNMLVILAHFLCKYFLGFSSNFKLFSKFGDTKSDGKLLTLSQSDKWMKQAKVIDGKKVTTTDTGIHFKKFKSLKIGLSDYQKFIESLAKHK************************T*****T***KLRFDEAGKGKGLAGRKDSVEAAGYVQGYQNRNS*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCQNMLVILAHFLCKYFLGFSSNFKLFSKFGDTKSDGKLLTLSQSDKWMKQAKVIDGKKVTTTDTGIHFKKFKSLKIGLSDYQKFIESLAKHKSVPEYDVWASKNSEAQIQNTISRLTDPSRYTGSHKLRFDEAGKGKGLAGRKDSVEAAGYVQGYQNRNSYDKTH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query166 2.2.26 [Sep-21-2011]
Q9VV43192 TPPP family protein CG489 yes N/A 0.891 0.770 0.597 7e-46
Q9BW30176 Tubulin polymerization-pr yes N/A 0.885 0.835 0.406 2e-21
Q9CRB6176 Tubulin polymerization-pr yes N/A 0.885 0.835 0.4 4e-21
Q7TQD2218 Tubulin polymerization-pr no N/A 0.849 0.646 0.396 7e-21
Q3ZCC8176 Tubulin polymerization-pr yes N/A 0.873 0.823 0.404 8e-21
Q5PPN5176 Tubulin polymerization-pr yes N/A 0.885 0.835 0.393 9e-21
Q3T077171 Tubulin polymerization-pr no N/A 0.849 0.824 0.383 1e-20
O94811219 Tubulin polymerization-pr no N/A 0.849 0.643 0.371 3e-19
Q27957218 Tubulin polymerization-pr no N/A 0.849 0.646 0.364 6e-19
Q0P5Y3170 Tubulin polymerization-pr no N/A 0.849 0.829 0.352 8e-19
>sp|Q9VV43|Y4893_DROME TPPP family protein CG4893 OS=Drosophila melanogaster GN=CG4893 PE=2 SV=1 Back     alignment and function desciption
 Score =  182 bits (463), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 95/159 (59%), Positives = 118/159 (74%), Gaps = 11/159 (6%)

Query: 18  LGFSSNFKLFSKFGDTKSDGKLLTLSQSDKWMKQAKVIDGKKVTTTDTGIHFKKFKSLKI 77
           + FS  FK FSKFGD+KSDGKL+TLSQSDKWMKQAKVID KK+TTTDTGIHFKKFK++KI
Sbjct: 35  VSFSDQFKAFSKFGDSKSDGKLITLSQSDKWMKQAKVID-KKITTTDTGIHFKKFKAMKI 93

Query: 78  GLSDYQKFIESLAKHKSVPEYDV---WAS-------KNSEAQIQNTISRLTDPSRYTGSH 127
            LSDY KF++ LAK K V   ++    AS         S  +    + RLTD S+YTGSH
Sbjct: 94  SLSDYNKFLDDLAKTKKVELSEIKQKLASCGAPGVVSVSAGKAAAAVDRLTDTSKYTGSH 153

Query: 128 KLRFDEAGKGKGLAGRKDSVEAAGYVQGYQNRNSYDKTH 166
           K RFD +GKGKG+AGR++ V+ +GYV GYQ++++YD  H
Sbjct: 154 KERFDASGKGKGIAGRRNVVDGSGYVSGYQHKDTYDNAH 192

Drosophila melanogaster (taxid: 7227)
>sp|Q9BW30|TPPP3_HUMAN Tubulin polymerization-promoting protein family member 3 OS=Homo sapiens GN=TPPP3 PE=1 SV=1 Back     alignment and function description
>sp|Q9CRB6|TPPP3_MOUSE Tubulin polymerization-promoting protein family member 3 OS=Mus musculus GN=Tppp3 PE=1 SV=1 Back     alignment and function description
>sp|Q7TQD2|TPPP_MOUSE Tubulin polymerization-promoting protein OS=Mus musculus GN=Tppp PE=1 SV=1 Back     alignment and function description
>sp|Q3ZCC8|TPPP3_BOVIN Tubulin polymerization-promoting protein family member 3 OS=Bos taurus GN=TPPP3 PE=1 SV=1 Back     alignment and function description
>sp|Q5PPN5|TPPP3_RAT Tubulin polymerization-promoting protein family member 3 OS=Rattus norvegicus GN=Tppp3 PE=2 SV=1 Back     alignment and function description
>sp|Q3T077|TPPP2_BOVIN Tubulin polymerization-promoting protein family member 2 OS=Bos taurus GN=TPPP2 PE=2 SV=1 Back     alignment and function description
>sp|O94811|TPPP_HUMAN Tubulin polymerization-promoting protein OS=Homo sapiens GN=TPPP PE=1 SV=1 Back     alignment and function description
>sp|Q27957|TPPP_BOVIN Tubulin polymerization-promoting protein OS=Bos taurus GN=TPPP PE=1 SV=1 Back     alignment and function description
>sp|Q0P5Y3|TPPP2_MOUSE Tubulin polymerization-promoting protein family member 2 OS=Mus musculus GN=Tppp2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query166
357628541205 hypothetical protein KGM_02734 [Danaus p 0.885 0.717 0.595 9e-47
383861053229 PREDICTED: TPPP family protein CG4893-li 0.885 0.641 0.603 1e-46
157119197236 hypothetical protein AaeL_AAEL008569 [Ae 0.891 0.627 0.614 8e-46
307186500209 TPPP family protein CG4893 [Camponotus f 0.861 0.684 0.606 3e-45
198462825205 GA18507 [Drosophila pseudoobscura pseudo 0.891 0.721 0.584 7e-45
158286559237 AGAP006948-PB [Anopheles gambiae str. PE 0.879 0.616 0.616 9e-45
158286557225 AGAP006948-PA [Anopheles gambiae str. PE 0.873 0.644 0.620 9e-45
195168195226 GL18002 [Drosophila persimilis] gi|19410 0.891 0.654 0.584 1e-44
195590783203 GD12480 [Drosophila simulans] gi|1941971 0.891 0.729 0.597 2e-44
195328107203 GM24410 [Drosophila sechellia] gi|194119 0.891 0.729 0.597 2e-44
>gi|357628541|gb|EHJ77836.1| hypothetical protein KGM_02734 [Danaus plexippus] Back     alignment and taxonomy information
 Score =  191 bits (485), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 97/163 (59%), Positives = 118/163 (72%), Gaps = 16/163 (9%)

Query: 18  LGFSSNFKLFSKFGDTKSDGKLLTLSQSDKWMKQAKVIDGKKVTTTDTGIHFKKFKSLKI 77
           + F   FK+FSKFGD KSDGK +TLSQSDKWMKQAKVIDGKK+TTTDT IHFKK KS+K+
Sbjct: 45  IPFKDAFKMFSKFGDPKSDGKQITLSQSDKWMKQAKVIDGKKITTTDTAIHFKKLKSVKL 104

Query: 78  GLSDYQKFIESLAKHKSV--------------PEYDVWASKNSEAQIQNTISRLTDPSRY 123
           G+ DYQKF+E LAK+K +              P       K+  A     + RLTD S+Y
Sbjct: 105 GIDDYQKFLEDLAKNKKMEVEEIKRKLTTCGQPGVSTHLPKSPAAAA--AVDRLTDTSKY 162

Query: 124 TGSHKLRFDEAGKGKGLAGRKDSVEAAGYVQGYQNRNSYDKTH 166
           TGSHK RFDE GKGKG+AGRKD V+A+GYV GYQ++++YDK+H
Sbjct: 163 TGSHKQRFDETGKGKGIAGRKDLVDASGYVSGYQHKDTYDKSH 205

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383861053|ref|XP_003706001.1| PREDICTED: TPPP family protein CG4893-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|157119197|ref|XP_001653296.1| hypothetical protein AaeL_AAEL008569 [Aedes aegypti] gi|108875431|gb|EAT39656.1| AAEL008569-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|307186500|gb|EFN72070.1| TPPP family protein CG4893 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|198462825|ref|XP_001352568.2| GA18507 [Drosophila pseudoobscura pseudoobscura] gi|198150998|gb|EAL30065.2| GA18507 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|158286559|ref|XP_308808.4| AGAP006948-PB [Anopheles gambiae str. PEST] gi|157020526|gb|EAA04714.5| AGAP006948-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|158286557|ref|XP_001688096.1| AGAP006948-PA [Anopheles gambiae str. PEST] gi|157020525|gb|EDO64745.1| AGAP006948-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195168195|ref|XP_002024917.1| GL18002 [Drosophila persimilis] gi|194108347|gb|EDW30390.1| GL18002 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|195590783|ref|XP_002085124.1| GD12480 [Drosophila simulans] gi|194197133|gb|EDX10709.1| GD12480 [Drosophila simulans] Back     alignment and taxonomy information
>gi|195328107|ref|XP_002030758.1| GM24410 [Drosophila sechellia] gi|194119701|gb|EDW41744.1| GM24410 [Drosophila sechellia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query166
FB|FBgn0036616192 CG4893 [Drosophila melanogaste 0.891 0.770 0.597 9.1e-45
UNIPROTKB|F1NRY4178 TPPP2 "Uncharacterized protein 0.319 0.297 0.641 7.1e-25
UNIPROTKB|J9NYH4258 TPPP "Uncharacterized protein" 0.313 0.201 0.596 3.4e-23
UNIPROTKB|O94811219 TPPP "Tubulin polymerization-p 0.313 0.237 0.596 1.1e-22
WB|WBGene00016321180 C32E8.3 [Caenorhabditis elegan 0.367 0.338 0.557 2.3e-22
UNIPROTKB|Q3T077171 TPPP2 "Tubulin polymerization- 0.867 0.842 0.344 4.7e-16
UNIPROTKB|E1C6P4219 TPPP "Uncharacterized protein" 0.716 0.543 0.4 2e-15
UNIPROTKB|Q9BW30176 TPPP3 "Tubulin polymerization- 0.819 0.772 0.383 5.4e-15
UNIPROTKB|F1P6Y7176 TPPP3 "Uncharacterized protein 0.819 0.772 0.370 6.9e-15
UNIPROTKB|Q3ZCC8176 TPPP3 "Tubulin polymerization- 0.819 0.772 0.376 8.8e-15
FB|FBgn0036616 CG4893 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 471 (170.9 bits), Expect = 9.1e-45, P = 9.1e-45
 Identities = 95/159 (59%), Positives = 118/159 (74%)

Query:    18 LGFSSNFKLFSKFGDTKSDGKLLTLSQSDKWMKQAKVIDGKKVTTTDTGIHFKKFKSLKI 77
             + FS  FK FSKFGD+KSDGKL+TLSQSDKWMKQAKVID KK+TTTDTGIHFKKFK++KI
Sbjct:    35 VSFSDQFKAFSKFGDSKSDGKLITLSQSDKWMKQAKVID-KKITTTDTGIHFKKFKAMKI 93

Query:    78 GLSDYQKFIESLAKHKSVPEYDV---WASKN-------SEAQIQNTISRLTDPSRYTGSH 127
              LSDY KF++ LAK K V   ++    AS         S  +    + RLTD S+YTGSH
Sbjct:    94 SLSDYNKFLDDLAKTKKVELSEIKQKLASCGAPGVVSVSAGKAAAAVDRLTDTSKYTGSH 153

Query:   128 KLRFDEAGKGKGLAGRKDSVEAAGYVQGYQNRNSYDKTH 166
             K RFD +GKGKG+AGR++ V+ +GYV GYQ++++YD  H
Sbjct:   154 KERFDASGKGKGIAGRRNVVDGSGYVSGYQHKDTYDNAH 192
GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0048812 "neuron projection morphogenesis" evidence=IMP
UNIPROTKB|F1NRY4 TPPP2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|J9NYH4 TPPP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O94811 TPPP "Tubulin polymerization-promoting protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00016321 C32E8.3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T077 TPPP2 "Tubulin polymerization-promoting protein family member 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1C6P4 TPPP "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BW30 TPPP3 "Tubulin polymerization-promoting protein family member 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1P6Y7 TPPP3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZCC8 TPPP3 "Tubulin polymerization-promoting protein family member 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P91127YBYK_CAEELNo assigned EC number0.38120.83130.7666yesN/A
Q5PPN5TPPP3_RATNo assigned EC number0.39390.88550.8352yesN/A
A4IIY2TPPP3_XENTRNo assigned EC number0.40740.86740.8181yesN/A
Q9VV43Y4893_DROMENo assigned EC number0.59740.89150.7708yesN/A
Q3ZCC8TPPP3_BOVINNo assigned EC number0.40490.87340.8238yesN/A
Q9CRB6TPPP3_MOUSENo assigned EC number0.40.88550.8352yesN/A
Q9BW30TPPP3_HUMANNo assigned EC number0.40600.88550.8352yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query166
pfam05517151 pfam05517, p25-alpha, p25-alpha 3e-30
>gnl|CDD|147609 pfam05517, p25-alpha, p25-alpha Back     alignment and domain information 
 Score =  107 bits (268), Expect = 3e-30
 Identities = 51/157 (32%), Positives = 73/157 (46%), Gaps = 16/157 (10%)

Query: 20  FSSNFKLFSKFGDTKSDGKLLTLSQSDKWMKQAKVIDGKKVTTTDTGIHFKKFKS---LK 76
             + FK F+ FG   + GK +      K +K  KVID KKVT TD  I F K K+    +
Sbjct: 1   LEAAFKKFASFG--TASGKEMDGKTFAKMLKDCKVID-KKVTATDVDIIFSKVKAKSARR 57

Query: 77  IGLSDYQKFIESLAKHKSVPEYDV-------WASKNSEAQIQNTISRLTDPSRYTGSHKL 129
           I    ++K +  LA  K     ++        +     A   + +  LTD S+YTG HK 
Sbjct: 58  ITYEQFEKALSELAAKKKKEADEIIEKLCAGKSPAVGGATKADAVRFLTDKSKYTGVHKE 117

Query: 130 RFDEAGKGKGLAGRKDSVEAAGYVQGYQNRNSYDKTH 166
           RFD  G GKG++GR D V+ +     Y+   +Y    
Sbjct: 118 RFDSTGDGKGISGRSDLVDRSSG---YKGAGTYGVKK 151

This family encodes a 25 kDa protein that is phosphorylated by a Ser/Thr-Pro kinase. It has been described as a brain specific protein, but it is found in Tetrahymena thermophila. Length = 151

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 166
KOG4070|consensus180 100.0
PF05517154 p25-alpha: p25-alpha ; InterPro: IPR008907 This fa 100.0
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 96.44
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 96.38
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 95.57
cd0503088 calgranulins Calgranulins: S-100 domain found in p 95.5
cd0021388 S-100 S-100: S-100 domain, which represents the la 95.36
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 95.23
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 95.15
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 95.11
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 94.45
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 93.62
KOG0030|consensus152 93.09
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 92.88
cd0005267 EH Eps15 homology domain; found in proteins implic 89.59
PTZ00183158 centrin; Provisional 89.54
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 88.46
PTZ00184149 calmodulin; Provisional 86.87
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 85.04
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 83.89
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 83.58
PLN02964 644 phosphatidylserine decarboxylase 83.36
PTZ00183158 centrin; Provisional 81.65
>KOG4070|consensus Back     alignment and domain information 
Probab=100.00  E-value=3.2e-63  Score=395.62  Aligned_cols=150  Identities=44%  Similarity=0.704  Sum_probs=140.6

Q ss_pred             HHHHHHHHHHHHhcCCCCCCCccccchhHHHHhhhcCccCCCCCCccccceeeeecccC---ccCHHHHHHHHHHHHHhc
Q psy12238         17 FLGFSSNFKLFSKFGDTKSDGKLLTLSQSDKWMKQAKVIDGKKVTTTDTGIHFKKFKSL---KIGLSDYQKFIESLAKHK   93 (166)
Q Consensus        17 ~~~L~~~F~~Fa~fG~~~~~g~eM~~k~F~Kl~KD~~liDgKkvT~TDvDiiF~KvK~k---~I~f~qF~~aL~~lA~kk   93 (166)
                      ++.|++.|++|+.||+++++|+||+++||+||||||+|||||.||.|||||+|+|||++   .|+|+||.++|++||+++
T Consensus        11 ~a~~~~~f~~Fa~fGd~~asg~em~gkn~~KlcKdc~V~DgK~vT~tdt~i~fsKvkg~~~~~~tf~~fkkal~ela~~R   90 (180)
T KOG4070|consen   11 MAGLEESFRAFAKFGDSKASGTEMNGKNWDKLCKDCKVIDGKSVTGTDTDIVFSKVKGKKARTITFEEFKKALEELATKR   90 (180)
T ss_pred             hhhHHHHHHHHHHcCCccccccccccccHHHHHhhcCcccCCcccccccceeeeeccccccccccHHHHHHHHHHHHHhh
Confidence            46799999999999999999999999999999999999999999999999999999984   899999999999999887


Q ss_pred             CCC-----hHHHHHHHhhh----------hccccccccccCCCCCccccccccCCCCCCCCcCCccccccCccccccCCC
Q psy12238         94 SVP-----EYDVWASKNSE----------AQIQNTISRLTDPSRYTGSHKLRFDEAGKGKGLAGRKDSVEAAGYVQGYQN  158 (166)
Q Consensus        94 ~~~-----~~~ei~~kl~~----------~t~~~~v~rltD~S~YTGsHKerfd~~g~gkg~~gr~~~~d~sGyv~gyk~  158 (166)
                      ...     ++++|.++|+.          +.++++|+||||+|+||||||||||+||+||||+||.+++|+||||+||||
T Consensus        91 ~k~Ks~ee~l~~I~~llagkaP~~~gvtka~t~gavdRLTDtskyTGsHKErFD~sGKGKGiaGR~d~~d~sGYVs~Yk~  170 (180)
T KOG4070|consen   91 FKGKSKEEALDAICQLLAGKAPAVVGVTKAKTAGAVDRLTDTSKYTGSHKERFDESGKGKGIAGRQDITDNSGYVSAYKN  170 (180)
T ss_pred             hcCCCHHHHHHHHHHHHhccCCcccchhhccccccccccccccccccchhhhcCcccCcCCcccccccccCCcceeeccC
Confidence            532     57889988862          567789999999999999999999999999999999999999999999999


Q ss_pred             CCccccCC
Q psy12238        159 RNSYDKTH  166 (166)
Q Consensus       159 ~~tyd~~~  166 (166)
                      +||||++|
T Consensus       171 ~gTYD~k~  178 (180)
T KOG4070|consen  171 AGTYDKKV  178 (180)
T ss_pred             CCchhhhc
Confidence            99999986

>PF05517 p25-alpha: p25-alpha ; InterPro: IPR008907 This family encodes a 25 kDa protein that is phosphorylated by a Ser/Thr-Pro kinase [] Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>KOG0030|consensus Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query166
2jrf_A184 Solution Nmr Structure Of Tubulin Polymerization-Pr 2e-22
1wlm_A151 Solution Structure Of Mouse Cgi-38 Protein Length = 2e-09
>pdb|2JRF|A Chain A, Solution Nmr Structure Of Tubulin Polymerization-Promoting Protein Family Member 3 From Homo Sapiens. Northeast Structural Genomics Target Hr387 Length = 184 Back     alignment and structure 
Iteration: 1

 Score =  101 bits (252), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 67/165 (40%), Positives = 92/165 (55%), Gaps = 18/165 (10%)
Query: 17  FLGFSSNFKLFSKFGDTKSDGKLLTLSQSDKWMKQAKVIDGKKVTTTDTGIHFKKFKSLK 76
             G   +F+ F+  GD K+ G+ +      K  K  KV DGK VT TD  I F K K   
Sbjct: 7   IAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKS 66
Query: 77  IGLSDYQKF---IESLA----KHKSVPE-YD----VWASKN------SEAQIQNTISRLT 118
             + +Y++F   +E LA    K KS  E +D    + A K       ++A+    + RLT
Sbjct: 67  ARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLT 126
Query: 119 DPSRYTGSHKLRFDEAGKGKGLAGRKDSVEAAGYVQGYQNRNSYD 163
           D SRYTGSHK RFDE+GKGKG+AGR+D ++ +GYV  Y+N  +YD
Sbjct: 127 DTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYD 171
>pdb|1WLM|A Chain A, Solution Structure Of Mouse Cgi-38 Protein Length = 151 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query166
2jrf_A184 Tubulin polymerization-promoting protein family me 1e-38
1wlm_A151 Protein CGI-38; structural genomics, NPPSFA, natio 2e-23
1pul_A125 Hypothetical protein C32E8.3 in chromosome I; alph 2e-14
>2jrf_A Tubulin polymerization-promoting protein family member 3; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Homo sapiens} Length = 184 Back     alignment and structure
 Score =  129 bits (324), Expect = 1e-38
 Identities = 59/166 (35%), Positives = 87/166 (52%), Gaps = 18/166 (10%)

Query: 19  GFSSNFKLFSKFGDTKSDGKLLTLSQSDKWMKQAKVIDGKKVTTTDTGIHFKKFKSLKIG 78
           G   +F+ F+  GD K+ G+ +      K  K  KV DGK VT TD  I F K K     
Sbjct: 9   GLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSAR 68

Query: 79  LSDYQKFIESLA-----KHKSVPEYDVWASKNS-------------EAQIQNTISRLTDP 120
           + +Y++F ++L      + K   + + + +                +A+    + RLTD 
Sbjct: 69  VINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDT 128

Query: 121 SRYTGSHKLRFDEAGKGKGLAGRKDSVEAAGYVQGYQNRNSYDKTH 166
           SRYTGSHK RFDE+GKGKG+AGR+D ++ +GYV  Y+N  +YD   
Sbjct: 129 SRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKV 174
>1wlm_A Protein CGI-38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.39.1.11 Length = 151 Back     alignment and structure
>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 Length = 125 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query166
2jrf_A184 Tubulin polymerization-promoting protein family me 100.0
1wlm_A151 Protein CGI-38; structural genomics, NPPSFA, natio 100.0
1pul_A125 Hypothetical protein C32E8.3 in chromosome I; alph 99.96
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 95.45
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 95.38
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 95.35
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 95.33
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 95.29
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 95.25
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 95.21
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 95.1
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 95.03
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 94.93
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 94.76
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 94.66
2lv7_A100 Calcium-binding protein 7; metal binding protein; 94.59
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 94.5
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 94.46
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 94.37
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 94.3
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 94.27
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 94.1
1avs_A90 Troponin C; muscle contraction, calcium-activated, 94.08
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 94.05
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 93.99
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 93.85
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 93.78
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 93.58
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 93.55
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 93.49
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 93.43
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 93.41
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 93.35
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 93.34
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 93.31
1qjt_A99 EH1, epidermal growth factor receptor substrate su 93.23
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 93.22
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 93.08
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 93.04
1c07_A95 Protein (epidermal growth factor receptor pathway 92.97
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 92.96
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 92.94
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 92.94
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 92.94
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 92.9
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 92.89
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 92.88
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 92.86
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 92.84
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 92.82
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 92.71
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 92.64
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 92.62
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 92.55
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 92.54
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 92.48
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 92.34
3fwb_A161 Cell division control protein 31; gene gating, com 92.19
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 92.13
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 92.04
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 91.97
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 91.96
2jnf_A158 Troponin C; stretch activated muscle contraction, 91.84
3akb_A166 Putative calcium binding protein; EF-hand, metal b 91.81
1y1x_A191 Leishmania major homolog of programmed cell death 91.69
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 91.65
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 91.48
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 91.38
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 91.36
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 91.35
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 91.25
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 91.2
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 91.16
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 91.15
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 91.06
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 91.05
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 90.96
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 90.94
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 90.91
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 90.82
1exr_A148 Calmodulin; high resolution, disorder, metal trans 90.78
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 90.78
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 90.72
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 90.67
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 90.65
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 90.65
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 90.59
3fwb_A161 Cell division control protein 31; gene gating, com 90.57
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 90.57
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 90.53
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 90.39
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 90.27
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 90.19
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 90.17
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 90.09
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 89.91
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 89.82
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 89.8
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 89.79
2jq6_A139 EH domain-containing protein 1; metal binding prot 89.7
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 89.69
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 89.66
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 89.65
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 89.63
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 89.47
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 89.19
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 89.18
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 89.12
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 89.06
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 89.02
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 88.59
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 88.54
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 88.47
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 88.32
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 88.28
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 88.26
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 88.08
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 87.92
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 87.84
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 87.82
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 87.77
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 87.75
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 87.37
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 87.37
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 87.34
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 87.34
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 87.31
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 86.99
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 86.89
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 86.81
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 86.61
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 86.52
2jnf_A158 Troponin C; stretch activated muscle contraction, 86.46
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 86.39
3li6_A66 Calcium-binding protein; calcium signaling protein 86.24
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 86.07
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 86.05
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 85.79
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 85.77
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 85.72
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 85.7
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 85.68
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 85.58
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 85.42
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 85.22
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 85.19
1exr_A148 Calmodulin; high resolution, disorder, metal trans 85.16
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 85.05
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 84.74
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 84.63
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 84.62
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 84.54
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 84.49
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 83.91
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 83.7
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 83.19
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 83.01
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 82.78
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 82.7
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 82.33
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 81.53
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 81.4
2hps_A186 Coelenterazine-binding protein with bound coelent; 81.33
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 80.98
1y1x_A191 Leishmania major homolog of programmed cell death 80.69
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 80.64
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 80.57
>2jrf_A Tubulin polymerization-promoting protein family member 3; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=9.3e-60  Score=383.08  Aligned_cols=148  Identities=40%  Similarity=0.631  Sum_probs=136.3

Q ss_pred             HHHHHHHHHHHhcCCCCCCCccccchhHHHHhhhcCccCCCCCCccccceeeeeccc---CccCHHHHHHHHHHHHHhc-
Q psy12238         18 LGFSSNFKLFSKFGDTKSDGKLLTLSQSDKWMKQAKVIDGKKVTTTDTGIHFKKFKS---LKIGLSDYQKFIESLAKHK-   93 (166)
Q Consensus        18 ~~L~~~F~~Fa~fG~~~~~g~eM~~k~F~Kl~KD~~liDgKkvT~TDvDiiF~KvK~---k~I~f~qF~~aL~~lA~kk-   93 (166)
                      .+|+++|++||+||++.+++.+|+++||+|||||||||||++||+|||||||+|||+   |+|||+||++||++||+++ 
T Consensus         8 ~~L~~~F~~F~~fG~~~~~~~eMd~~~F~KlcKD~~liDgk~~T~tdvDIiF~KvK~k~~rkI~feqF~~aL~~lA~kk~   87 (184)
T 2jrf_A            8 AGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRF   87 (184)
T ss_dssp             SHHHHHHHHHHSSSCTTSTTSEEEHHHHHHHHHHTTCCCSSSSCHHHHHHHHHHHCCSCCSEEEHHHHHHHHHHHHHHHS
T ss_pred             HHHHHHHHHHHhcCCCCCccccCcHHHHHHHHHHcCCccCCCCChhhcchhhheeccCcceeecHHHHHHHHHHHHHHhc
Confidence            479999999999999998889999999999999999999999999999999999994   6899999999999999999 


Q ss_pred             -CCChHHHHHH---Hhhh-------h-c---cccccccccCCCCCccccccccCCCCCCCCcCCccccccCccccccCCC
Q psy12238         94 -SVPEYDVWAS---KNSE-------A-Q---IQNTISRLTDPSRYTGSHKLRFDEAGKGKGLAGRKDSVEAAGYVQGYQN  158 (166)
Q Consensus        94 -~~~~~~ei~~---kl~~-------~-t---~~~~v~rltD~S~YTGsHKerfd~~g~gkg~~gr~~~~d~sGyv~gyk~  158 (166)
                       ++ +++|+.+   +|++       | +   .+++|+||||+|+||||||||||++|+|+||+||+++++++|||+||+|
T Consensus        88 ~g~-s~eE~~~~i~kL~~~~gP~~~GtTka~~~~~~~rltD~s~YTG~hk~rfd~~g~g~g~~gr~~~~~~~g~~~~~~~  166 (184)
T 2jrf_A           88 KGK-SKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKN  166 (184)
T ss_dssp             TTS-CHHHHHHHHHHTTTTCCSSSSSCCCCTTSCCCCCCSSSSCSTTSCCCCSCSSSCCTTTTTCCCCCCCSCCCCTTSC
T ss_pred             CCC-CHHHHHHHHHHHHhCCCCCcccccccCCcccceecccCcccchhhhhccCCCCCccCcccccccccCCCcccCCCC
Confidence             66 5666555   7763       3 2   2578999999999999999999999999999999999999999999999


Q ss_pred             CCccccCC
Q psy12238        159 RNSYDKTH  166 (166)
Q Consensus       159 ~~tyd~~~  166 (166)
                      +||||++|
T Consensus       167 ~~tyd~~~  174 (184)
T 2jrf_A          167 AGTYDAKV  174 (184)
T ss_dssp             BTTBCCTT
T ss_pred             CccHHHHH
Confidence            99999986
>1wlm_A Protein CGI-38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.39.1.11 Back     alignment and structure
>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 166
d1wlma1138 a.39.1.11 (A:8-145) Protein cgi-38 {Mouse (Mus mus 1e-21
d1pula1103 a.39.1.11 (A:18-120) Hypothetical protein c32e8.3 4e-14
>d1wlma1 a.39.1.11 (A:8-145) Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090]} Length = 138 Back     information, alignment and structure

class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: p25-alpha
domain: Protein cgi-38
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 83.0 bits (205), Expect = 1e-21
 Identities = 39/130 (30%), Positives = 60/130 (46%), Gaps = 18/130 (13%)

Query: 19  GFSSNFKLFSKFGDTKSDGKLLTLSQSDKWMKQAKVIDGKKVTTTDTGIHFKKFKSLKIG 78
           G   +F+ F+  GD K+ G+ +      K  K  KV DGK VT TD  I F K K+    
Sbjct: 9   GLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKAVTGTDVDIVFSKVKAKSAR 68

Query: 79  LSDYQKFIESLA-----KHKSVPEYDVWASKNSE-------------AQIQNTISRLTDP 120
           + +Y++F ++L      + K   + + + +                 A+    + RLTD 
Sbjct: 69  VINYEEFKKALEELATKRFKGKSKEEAFDAICQLIAGKEPANIGVTKAKTGGAVDRLTDT 128

Query: 121 SRYTGSHKLR 130
           S+YTGSHK R
Sbjct: 129 SKYTGSHKER 138
>d1pula1 a.39.1.11 (A:18-120) Hypothetical protein c32e8.3 {Caenorhabditis elegans [TaxId: 6239]} Length = 103 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query166
d1wlma1138 Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090 100.0
d1pula1103 Hypothetical protein c32e8.3 {Caenorhabditis elega 99.94
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 95.97
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 95.84
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 95.67
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 95.66
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 95.57
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 95.16
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 94.81
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 94.8
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 94.76
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 94.59
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 94.49
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 94.47
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 94.41
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 94.4
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 94.35
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 94.22
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 94.15
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 94.12
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 94.08
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 94.06
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 93.84
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 93.74
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 93.66
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 93.15
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 93.11
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 92.95
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 92.92
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 92.61
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 92.46
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 92.4
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 92.32
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 92.28
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 92.22
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 92.07
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 91.83
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 91.63
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 91.61
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 91.43
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 91.41
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 90.97
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 90.87
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 90.82
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 90.7
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 90.54
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 90.37
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 90.2
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 90.1
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 90.07
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 90.02
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 89.63
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 89.46
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 89.37
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 89.33
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 88.74
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 88.33
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 88.26
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 87.94
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 87.85
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 87.15
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 87.0
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 86.98
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 86.68
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 86.67
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 85.08
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 84.86
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 84.38
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 83.56
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 83.56
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 81.88
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 81.45
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 80.88
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 80.08
>d1wlma1 a.39.1.11 (A:8-145) Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: p25-alpha
domain: Protein cgi-38
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=3.2e-42  Score=267.12  Aligned_cols=113  Identities=36%  Similarity=0.526  Sum_probs=101.5

Q ss_pred             HHHHHHHHHHHhcCCCCCCCccccchhHHHHhhhcCccCCCCCCccccceeeeeccc---CccCHHHHHHHHHHHHHhcC
Q psy12238         18 LGFSSNFKLFSKFGDTKSDGKLLTLSQSDKWMKQAKVIDGKKVTTTDTGIHFKKFKS---LKIGLSDYQKFIESLAKHKS   94 (166)
Q Consensus        18 ~~L~~~F~~Fa~fG~~~~~g~eM~~k~F~Kl~KD~~liDgKkvT~TDvDiiF~KvK~---k~I~f~qF~~aL~~lA~kk~   94 (166)
                      ++|+++|++||+||++++++++|++++|+||||||+|||||+||+|||||||+|+|+   |+|+|+||+++|++||++++
T Consensus         8 ~~L~~~F~~F~~fG~~k~~~~~m~~~~f~K~~kd~~lid~K~~T~t~~diiF~k~k~k~~r~i~f~~F~~aL~~iA~kk~   87 (138)
T d1wlma1           8 AGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKAVTGTDVDIVFSKVKAKSARVINYEEFKKALEELATKRF   87 (138)
T ss_dssp             CSHHHHHHHHHTSSCSSCCSSEEEHHHHHHHHHHTSCCCSSSSCHHHHHHHHHHHSCSSCSEEEHHHHHHHHHHTHHHHS
T ss_pred             HHHHHHHHHHHhcCCCCCCcccCCHHHHHHHHHHcCCCcCCccchhhHHHHHHHhhcCCCcccCHHHHHHHHHHHHHHhc
Confidence            569999999999999999999999999999999999999999999999999999997   47999999999999999987


Q ss_pred             CC-----hHHHHHHHhhh----------hccccccccccCCCCCccccccc
Q psy12238         95 VP-----EYDVWASKNSE----------AQIQNTISRLTDPSRYTGSHKLR  130 (166)
Q Consensus        95 ~~-----~~~ei~~kl~~----------~t~~~~v~rltD~S~YTGsHKer  130 (166)
                      ..     .+++|.++|+.          +.++++|+||||+|+||||||||
T Consensus        88 ~~~s~~e~~~~i~~~i~~~~P~~~g~tka~~~~~v~~~~D~s~YTG~hker  138 (138)
T d1wlma1          88 KGKSKEEAFDAICQLIAGKEPANIGVTKAKTGGAVDRLTDTSKYTGSHKER  138 (138)
T ss_dssp             SSCCHHHHHHHHHHHHTTCCCSCCSCCCCCCCCCCCCCCCCCCCCSSCCCS
T ss_pred             CCccHHHHHHHHHHHHhcCCCCccCcccccCCcccccCCCCCcccccccCC
Confidence            52     35667777653          23667899999999999999998
>d1pula1 a.39.1.11 (A:18-120) Hypothetical protein c32e8.3 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure