Psyllid ID: psy12296

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430---
MFNGTLGFSIRGGREHTTGVFVSNVEPKSEAERSGLLIGDQIIRINGFPIEDATHSEVLQLIHSQNIISLKVRSVGMIPTKERDKSVTWKFVDTNKSNLNQNERFPVVPITLEVPPHGKLGCGICKGPQWKPGIFVQFTKDACVAKDAGLKCGDQILACNGVKFSPDVTFEHAVSVMKSSCLLELLVHRGVGLDLFPGGSSGYNSSTSSLNGDNQDEPTLVQFKRLSVVKEESVGNGRSNSLEDVTQARAEPRTLHNGGGGASLSSAISEEIKRRSERLNSGKEFVKVETTKNNIEEDSSYHLKLQTLMKEVKEAHNKMFPGSQEEKDKCSDSPPSCPTPDYDTMSVTSHTNNNKVDMASFKSFSAAPAPAKPPPVYFPPPSGFQDEKNKPEATAVKPAPPPVVTLREYPNPNEPKVPSKFKFLSNNKPACYF
cccccccEEEEccccccccEEEEEEccccHHHHcccccccEEEEEccEEcccccHHHHHHHHHcccEEEEEEEEEcccccccccccccccEEccccccccccccccEEEEEEEEccccccEEEEEccccccccEEEEEEccccHHHHcccccccEEEEEccccccccccHHHHHHHHHcccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccHHHHHHHHcccccccEEEEEEccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccEEEEEcccccccEEEEEEEccccHHHHcccccccEEEEEccccHHHccHHHHHHHHHcccEEEEEEEcccccccccccccccccccccccccccccccccEEEEEEEEccccccEEEEEcccccccEEEEEEEccccHHHHcccccccEEEEEccccHHccccHHHHHHHHcccccEEEEEEccccccccccccccccccccccccccccccccccccccccccHHHccccccccHHcccccccccEEEEEccccccEEEEEEcccccccccccccccEEEEEccccccccccHcccccccccccccccccccccccccccccccccccccccccHHHHEccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccHHHcccccccc
mfngtlgfsirggrehttgvfvsnvepkseaersglligdqiiringfpiedatHSEVLQLIHSQNiislkvrsvgmiptkerdksvtwKFVDtnksnlnqnerfpvvpitlevpphgklgcgickgpqwkpgifvQFTKDACVakdaglkcgdqilacngvkfspdvTFEHAVSVMKSSCLLELLVHRGvgldlfpggssgynsstsslngdnqdeptlvQFKRLSVvkeesvgngrsnsledvtqaraeprtlhnggggaslSSAISEEIKRRSERLNSGKEFVKVettknnieedssYHLKLQTLMKEVKEAHnkmfpgsqeekdkcsdsppscptpdydtmsvtshtnnnkvdmasfksfsaapapakpppvyfpppsgfqdeknkpeatavkpapppvvtlreypnpnepkvpskfkflsnnkpacyf
mfngtlgfsirggrehttgvfvsnvepkseaersglLIGDQIIRINGFPIEDATHSEVLQLIHsqniislkvrsvgmiptkerdksvtwkfvdtnksnlnqnerfpvVPITLEVPPHGKLGCGICKGPQWKPGIFVQFTKDACVAKDAGLKCGDQILACNGVKFSPDVTFEHAVSVMKSSCLLELLVHRGVGLDLFPGGSSGYNSSTSslngdnqdepTLVQFKRLSVvkeesvgngrsnsledvTQARaeprtlhnggggaslssAISEEIKRrserlnsgkefvkvettknnieedssyHLKLQTLMKEVKEAHNKMfpgsqeekdkcsDSPPSCPTPDYDTMSVTSHTNNNKVDMASFKSFSAAPAPAKPPPVYFPPPSGFQDEKNKPEATAVKPAPPPVVTLREYPNPnepkvpskfkflsnnkpacyf
MFNGTLGFSIRGGREHTTGVFVSNVEPKSEAERSGLLIGDQIIRINGFPIEDATHSEVLQLIHSQNIISLKVRSVGMIPTKERDKSVTWKFVDTNKSNLNQNERFPVVPITLEVPPHGKLGCGICKGPQWKPGIFVQFTKDACVAKDAGLKCGDQILACNGVKFSPDVTFEHAVSVMKSSCLLELLVHRGVGLDLFPggssgynsstsslngDNQDEPTLVQFKRLSVVKEESVGNGRSNSLEDVTQARAEPRTLHNggggaslssaiseeiKRRSERLNSGKEFVKVETTKNNIEEDSSYHLKLQTLMKEVKEAHNKMFPGSQEEkdkcsdsppscptpdydtMSVTSHTNNNKVDMasfksfsaapapakpppvyfpppsgfQDEKNkpeatavkpapppvvtLREYPNPNEPKVPSKFKFLSNNKPACYF
*****************TGVFV************GLLIGDQIIRINGFPIEDATHSEVLQLIHSQNIISLKVRSVGMIPTKERDKSVTWKFVDTNKSNLNQNERFPVVPITLEVPPHGKLGCGICKGPQWKPGIFVQFTKDACVAKDAGLKCGDQILACNGVKFSPDVTFEHAVSVMKSSCLLELLVHRGVGLDLF*********************************************************************************************************************************************************************************************************************************************
*FNGTLGFSIRGGREHTTGVFVSNVEPKSEAERSGLLIGDQIIRINGFPIEDATHSEVLQLIHSQNIISLKVRSV************************************LEVPPHGKLGCGICKGPQWKPGIFVQFTKDACVAKDAGLKCGDQILACNGVKFSPDVTFEHAVSVMKSSCLLELLVHRGV**********************************************************************************************VKVETT**********************************************************************************************************************************************
MFNGTLGFSIRGGREHTTGVFVSNVEPKSEAERSGLLIGDQIIRINGFPIEDATHSEVLQLIHSQNIISLKVRSVGMIPTKERDKSVTWKFVDTNKSNLNQNERFPVVPITLEVPPHGKLGCGICKGPQWKPGIFVQFTKDACVAKDAGLKCGDQILACNGVKFSPDVTFEHAVSVMKSSCLLELLVHRGVGLDLFPGGSSG************QDEPTLVQFKRLSVV**************DVTQARAEPRTLHNGGGGASLSSAISEEIKRRSERLNSGKEFVKVETTKNNIEEDSSYHLKLQTLMKEVKEAHNKMF*****************PTPDYDTMSVTSHTNNNKVDMASFKSFSAAPAPAKPPPVYFPPPSGFQDEKNKPEATAVKPAPPPVVTLREYPNPNEPKVPSKFKFLSNNKPACYF
****TLGFSIRGGREHTTGVFVSNVEPKSEAERSGLLIGDQIIRINGFPIEDATHSEVLQLIHSQNIISLKVRSVGMIPTKERDKSVTWKFVDTNKSNLNQNERFPVVPITLEVPPHGKLGCGICKGPQWKPGIFVQFTKDACVAKDAGLKCGDQILACNGVKFSPDVTFEHAVSVMKSSCLLELLVHRGVGLDLFPGGSSGY*SS**********************************SLEDVTQARAEPRTLHNGGGGASLSSAISEEIKRRSERLNSGKEFVKVETTKNNIEEDSSYHLKLQT*****************************CPTPDYDTMSVTS************************************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFNGTLGFSIRGGREHTTGVFVSNVEPKSEAERSGLLIGDQIIRINGFPIEDATHSEVLQLIHSQNIISLKVRSVGMIPTKERDKSVTWKFVDTNKSNLNQNERFPVVPITLEVPPHGKLGCGICKGPQWKPGIFVQFTKDACVAKDAGLKCGDQILACNGVKFSPDVTFEHAVSVMKSSCLLELLVHRGVGLDLFPGGSSGYNSSTSSLNGDNQDEPTLVQFKRLSVVKEESVGNGRSNSLEDVTQARAEPRTLHNGGGGASLSSAISEEIKRRSERLNSGKEFVKVETTKNNIEEDSSYHLKLQTLMKEVKEAHNKMFPGSQEEKDKCSDSPPSCPTPDYDTMSVTSHTNNNKVDMASFKSFSAAPAPAKPPPVYFPPPSGFQDEKNKPEATAVKPAPPPVVTLREYPNPNEPKVPSKFKFLSNNKPACYF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query433 2.2.26 [Sep-21-2011]
Q9ES64 910 Harmonin OS=Mus musculus yes N/A 0.434 0.206 0.389 2e-31
Q9Y6N9552 Harmonin OS=Homo sapiens no N/A 0.434 0.340 0.394 4e-31
Q3MHQ0551 Harmonin OS=Bos taurus GN yes N/A 0.434 0.341 0.389 7e-31
Q9H5P4517 PDZ domain-containing pro no N/A 0.422 0.353 0.328 4e-22
Q5RBI7528 PDZ domain-containing pro yes N/A 0.422 0.346 0.323 1e-21
Q80VW5 918 Whirlin OS=Mus musculus G no N/A 0.418 0.197 0.330 2e-20
Q810W9 920 Whirlin OS=Rattus norvegi no N/A 0.418 0.196 0.333 2e-20
Q9P202 907 Whirlin OS=Homo sapiens G no N/A 0.397 0.189 0.316 2e-19
Q80U72 1612 Protein scribble homolog no N/A 0.429 0.115 0.271 1e-10
Q14160 1630 Protein scribble homolog no N/A 0.429 0.114 0.266 6e-10
>sp|Q9ES64|USH1C_MOUSE Harmonin OS=Mus musculus GN=Ush1c PE=1 SV=1 Back     alignment and function desciption
 Score =  137 bits (344), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 79/203 (38%), Positives = 120/203 (59%), Gaps = 15/203 (7%)

Query: 6   LGFSIRGGREHTTGVFVSNVEPKSEAERSGLLIGDQIIRINGFPIEDATHSEVLQLIHSQ 65
           LG S+RGG E   G+F+S++    +A+  GL +GD+I+RING+ I   TH EV+ LI ++
Sbjct: 98  LGLSVRGGLEFGCGLFISHLIKGGQADSVGLQVGDEIVRINGYSISSCTHEEVINLIRTK 157

Query: 66  NIISLKVRSVGMIPTKER-DKSVTWKFVDTNKSNL-----------NQNERFPVVPITLE 113
             +S+KVR +G+IP K   ++S+ W++VD   S             N+  +   V I+L 
Sbjct: 158 KTVSIKVRHIGLIPVKSSPEESLKWQYVDQFVSESGGVRGGLGSPGNRTTKEKKVFISL- 216

Query: 114 VPPHGKLGCGICKGPQWKPGIFVQFTKDACVAKDAGLKCGDQILACNGVKFSPDVTFEHA 173
           V   G LGC I  GP  KPGIFV   K   ++ + GL+ GDQI+  NG+ F+ ++  + A
Sbjct: 217 VGSRG-LGCSISSGPIQKPGIFVSHVKPGSLSAEVGLETGDQIVEVNGIDFT-NLDHKEA 274

Query: 174 VSVMKSSCLLELLVHRGVGLDLF 196
           V+V+KSS  L + +  G G +LF
Sbjct: 275 VNVLKSSRSLTISIVAGAGRELF 297
Required for normal development and maintenance of cochlear hair cell bundles. Anchoring/scaffolding protein that is a part of the functional network formed by USH1C, USH1G, CDH23 and MYO7A that mediates mechanotransduction in cochlear hair cells. Required for normal hearing.
Mus musculus (taxid: 10090)
>sp|Q9Y6N9|USH1C_HUMAN Harmonin OS=Homo sapiens GN=USH1C PE=1 SV=3 Back     alignment and function description
>sp|Q3MHQ0|USH1C_BOVIN Harmonin OS=Bos taurus GN=USH1C PE=2 SV=1 Back     alignment and function description
>sp|Q9H5P4|PDZD7_HUMAN PDZ domain-containing protein 7 OS=Homo sapiens GN=PDZD7 PE=1 SV=1 Back     alignment and function description
>sp|Q5RBI7|PDZD7_PONAB PDZ domain-containing protein 7 OS=Pongo abelii GN=PDZD7 PE=2 SV=1 Back     alignment and function description
>sp|Q80VW5|WHRN_MOUSE Whirlin OS=Mus musculus GN=Dfnb31 PE=1 SV=3 Back     alignment and function description
>sp|Q810W9|WHRN_RAT Whirlin OS=Rattus norvegicus GN=Dfnb31 PE=1 SV=1 Back     alignment and function description
>sp|Q9P202|WHRN_HUMAN Whirlin OS=Homo sapiens GN=DFNB31 PE=1 SV=3 Back     alignment and function description
>sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 Back     alignment and function description
>sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query433
91081527 847 PREDICTED: similar to harmonin [Triboliu 0.521 0.266 0.561 4e-62
347971084 721 AGAP004018-PA [Anopheles gambiae str. PE 0.535 0.321 0.535 1e-57
170054214 841 harmonin [Culex quinquefasciatus] gi|167 0.545 0.280 0.492 2e-57
195166906 771 GL14906 [Drosophila persimilis] gi|19410 0.545 0.306 0.506 1e-55
312380008 765 hypothetical protein AND_08005 [Anophele 0.528 0.299 0.524 1e-55
198468870 579 GA26523 [Drosophila pseudoobscura pseudo 0.545 0.407 0.506 1e-55
195456880 631 GK15791 [Drosophila willistoni] gi|19417 0.545 0.374 0.502 2e-54
386763881 886 CG5921, isoform D [Drosophila melanogast 0.526 0.257 0.510 5e-54
386763879 829 CG5921, isoform C [Drosophila melanogast 0.526 0.275 0.510 5e-54
195340454 954 GM12462 [Drosophila sechellia] gi|194130 0.524 0.237 0.508 7e-54
>gi|91081527|ref|XP_974840.1| PREDICTED: similar to harmonin [Tribolium castaneum] gi|270005137|gb|EFA01585.1| hypothetical protein TcasGA2_TC007147 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  245 bits (625), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 173/235 (73%), Gaps = 9/235 (3%)

Query: 5   TLGFSIRGGREHTTGVFVSNVEPKSEAERSGLLIGDQIIRINGFPIEDATHSEVLQLIHS 64
           +LGFS+RGGREH TG FVS+VEP SEA R GL +GDQIIR+NGF ++DA H EVLQLI +
Sbjct: 86  SLGFSVRGGREHGTGFFVSHVEPASEAHRQGLRVGDQIIRVNGFTVDDAVHKEVLQLISN 145

Query: 65  QNIISLKVRSVGMIPTKERD-KSVTWKFVDTNKSNLNQN----ERFPVVPITLEVPPHGK 119
              ++LKVRSVGMIP K++   +++W+ + T+ S+L  +    E+   V I + V P  K
Sbjct: 146 HTHLTLKVRSVGMIPVKDKKTDTLSWQII-TDNSSLRSSPPLGEKIHDVRINIIVAPRSK 204

Query: 120 LGCGICKGPQWKPGIFVQFTKDACVAKDAGLKCGDQILACNGVKFSPDVTFEHAVSVMKS 179
           LGCGICKGP+WKPGIF+QFTK+  +A++AGL+ GDQIL CN V FS D+ F  AV++MK+
Sbjct: 205 LGCGICKGPEWKPGIFIQFTKEGGIAREAGLRPGDQILFCNNVDFS-DIPFNEAVNLMKT 263

Query: 180 SCLLELLVHRGVGLDLFPGGSSGYNSSTSSLNGDNQDEPTLVQFKRLSVVKEESV 234
           S  L+L+V +  G +LFPG SSGYNSS SS+ GD    P+    KRLS+VKEES+
Sbjct: 264 SRQLDLIVRKSAGSELFPGESSGYNSSASSVTGD--QSPSWSDQKRLSIVKEESL 316

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|347971084|ref|XP_001231159.3| AGAP004018-PA [Anopheles gambiae str. PEST] gi|347971086|ref|XP_003436689.1| AGAP004018-PB [Anopheles gambiae str. PEST] gi|333469624|gb|EAU76182.3| AGAP004018-PA [Anopheles gambiae str. PEST] gi|333469625|gb|EGK97363.1| AGAP004018-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|170054214|ref|XP_001863023.1| harmonin [Culex quinquefasciatus] gi|167874543|gb|EDS37926.1| harmonin [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|195166906|ref|XP_002024275.1| GL14906 [Drosophila persimilis] gi|194107648|gb|EDW29691.1| GL14906 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|312380008|gb|EFR26126.1| hypothetical protein AND_08005 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|198468870|ref|XP_002134145.1| GA26523 [Drosophila pseudoobscura pseudoobscura] gi|198146610|gb|EDY72772.1| GA26523 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195456880|ref|XP_002075328.1| GK15791 [Drosophila willistoni] gi|194171413|gb|EDW86314.1| GK15791 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|386763881|ref|NP_727061.2| CG5921, isoform D [Drosophila melanogaster] gi|383293234|gb|AAF46116.3| CG5921, isoform D [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|386763879|ref|NP_572290.2| CG5921, isoform C [Drosophila melanogaster] gi|383293233|gb|AAN09159.2| CG5921, isoform C [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195340454|ref|XP_002036828.1| GM12462 [Drosophila sechellia] gi|194130944|gb|EDW52987.1| GM12462 [Drosophila sechellia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query433
UNIPROTKB|Q3MHQ0551 USH1C "Harmonin" [Bos taurus ( 0.434 0.341 0.394 1.4e-31
UNIPROTKB|E1BRM6556 USH1C "Uncharacterized protein 0.434 0.338 0.402 1.9e-31
UNIPROTKB|Q9Y6N9552 USH1C "Harmonin" [Homo sapiens 0.434 0.340 0.399 5.1e-31
UNIPROTKB|E1BK26 883 USH1C "Harmonin" [Bos taurus ( 0.434 0.212 0.394 7.4e-31
ZFIN|ZDB-GENE-060312-41 895 ush1c "Usher syndrome 1C (auto 0.554 0.268 0.357 1.3e-30
UNIPROTKB|E2QSX8 907 USH1C "Uncharacterized protein 0.431 0.206 0.392 2.1e-30
MGI|MGI:1919338 910 Ush1c "Usher syndrome 1C" [Mus 0.434 0.206 0.389 7.2e-30
RGD|1303329548 Ush1c "Usher syndrome 1C homol 0.434 0.343 0.384 8.5e-30
UNIPROTKB|Q4KMB9548 Ush1c "Usher syndrome 1C homol 0.434 0.343 0.384 8.5e-30
UNIPROTKB|F1S9A7 887 USH1C "Uncharacterized protein 0.434 0.211 0.387 2.4e-29
UNIPROTKB|Q3MHQ0 USH1C "Harmonin" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 350 (128.3 bits), Expect = 1.4e-31, P = 1.4e-31
 Identities = 80/203 (39%), Positives = 122/203 (60%)

Query:     6 LGFSIRGGREHTTGVFVSNVEPKSEAERSGLLIGDQIIRINGFPIEDATHSEVLQLIHSQ 65
             LG S+RGG E   G+F+S++    +A+  GL +GD+I+RING+ I   TH EV+ LI ++
Sbjct:    98 LGLSVRGGLEFGCGLFISHLIKDGQADSVGLQVGDEIVRINGYSISSCTHEEVINLIRTK 157

Query:    66 NIISLKVRSVGMIPTKER-DKSVTWKFVDT-------NKSNL----NQNERFPVVPITLE 113
               +S+KVR +G+IP K   D+ + W++VD         +S+L    +Q  +   V I+L 
Sbjct:   158 KTVSIKVRHIGLIPVKSSPDEPLKWQYVDQFVSESGGGRSSLGSPGSQENKEKKVFISL- 216

Query:   114 VPPHGKLGCGICKGPQWKPGIFVQFTKDACVAKDAGLKCGDQILACNGVKFSPDVTFEHA 173
             V   G LGC I  GP  KPGIF+   K   ++ + GL+ GDQI+  NG+ FS ++  + A
Sbjct:   217 VGSRG-LGCSISSGPIQKPGIFISHVKPGSLSAEVGLETGDQIVEVNGIDFS-NLDHKEA 274

Query:   174 VSVMKSSCLLELLVHRGVGLDLF 196
             V+V+KSS  L + +  G G +LF
Sbjct:   275 VNVLKSSRSLTISIVAGAGRELF 297
GO:0005856 "cytoskeleton" evidence=IEA
GO:0005829 "cytosol" evidence=IEA
GO:0007605 "sensory perception of sound" evidence=IEA
UNIPROTKB|E1BRM6 USH1C "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y6N9 USH1C "Harmonin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BK26 USH1C "Harmonin" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060312-41 ush1c "Usher syndrome 1C (autosomal recessive, severe)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2QSX8 USH1C "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1919338 Ush1c "Usher syndrome 1C" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1303329 Ush1c "Usher syndrome 1C homolog (human)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q4KMB9 Ush1c "Usher syndrome 1C homolog (Human)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1S9A7 USH1C "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query433
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 1e-21
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 4e-18
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 5e-15
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 5e-14
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 7e-10
cd0098790 cd00987, PDZ_serine_protease, PDZ domain of tryspi 5e-08
TIGR02037428 TIGR02037, degP_htrA_DO, periplasmic serine protea 7e-08
cd0098979 cd00989, PDZ_metalloprotease, PDZ domain of bacter 7e-07
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 2e-06
cd0098885 cd00988, PDZ_CTP_protease, PDZ domain of C-termina 2e-05
COG0793406 COG0793, Prc, Periplasmic protease [Cell envelope 2e-05
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 4e-05
pfam1318081 pfam13180, PDZ_2, PDZ domain 1e-04
COG0265347 COG0265, DegQ, Trypsin-like serine proteases, typi 0.002
TIGR02038351 TIGR02038, protease_degS, periplasmic serine pepet 0.003
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information 
 Score = 88.0 bits (219), Expect = 1e-21
 Identities = 34/72 (47%), Positives = 50/72 (69%), Gaps = 1/72 (1%)

Query: 3  NGTLGFSIRGGREHTTGVFVSNVEPKSEAERSGLLIGDQIIRINGFPIEDATHSEVLQLI 62
           G LGFS+RGG++   G+FVS VEP   AER GL +GD+I+ +NG  +E  TH E ++L+
Sbjct: 11 GGGLGFSLRGGKDSGGGIFVSRVEPGGPAERGGLRVGDRILEVNGVSVEGLTHEEAVELL 70

Query: 63 -HSQNIISLKVR 73
           +S + ++L VR
Sbjct: 71 KNSGDEVTLTVR 82

May be responsible for specific protein-protein interactions, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of PDZ domains an N-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in proteases. Length = 82
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>gnl|CDD|238489 cd00989, PDZ_metalloprotease, PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|238488 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>gnl|CDD|223864 COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|221961 pfam13180, PDZ_2, PDZ domain Back     alignment and domain information
>gnl|CDD|223343 COG0265, DegQ, Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233696 TIGR02038, protease_degS, periplasmic serine pepetdase DegS Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 433
KOG3209|consensus984 99.83
KOG3209|consensus984 99.77
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 99.75
PRK10942473 serine endoprotease; Provisional 99.71
PRK10139455 serine endoprotease; Provisional 99.7
PRK10779449 zinc metallopeptidase RseP; Provisional 99.66
KOG3580|consensus 1027 99.63
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 99.53
KOG3580|consensus 1027 99.44
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 99.37
KOG3605|consensus829 99.36
COG0793406 Prc Periplasmic protease [Cell envelope biogenesis 99.35
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 99.2
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 99.2
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 99.11
KOG3550|consensus207 99.1
PLN00049389 carboxyl-terminal processing protease; Provisional 99.07
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 99.03
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 99.02
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 99.01
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.97
PRK11186667 carboxy-terminal protease; Provisional 98.96
KOG3553|consensus124 98.94
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 98.84
TIGR00225334 prc C-terminal peptidase (prc). A C-terminal pepti 98.83
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 98.79
KOG3550|consensus207 98.78
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 98.77
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.76
KOG3551|consensus506 98.76
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.76
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.7
KOG3553|consensus124 98.68
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 98.67
KOG3549|consensus505 98.67
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 98.6
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.59
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 98.59
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 98.53
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 98.51
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.51
TIGR00225334 prc C-terminal peptidase (prc). A C-terminal pepti 98.49
KOG1421|consensus 955 98.48
PLN00049389 carboxyl-terminal processing protease; Provisional 98.48
KOG3551|consensus506 98.46
TIGR01713259 typeII_sec_gspC general secretion pathway protein 98.43
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.42
TIGR01713259 typeII_sec_gspC general secretion pathway protein 98.38
KOG3549|consensus 505 98.38
COG0793406 Prc Periplasmic protease [Cell envelope biogenesis 98.37
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 98.33
PRK10898353 serine endoprotease; Provisional 98.33
KOG1892|consensus 1629 98.26
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 98.14
PRK10898353 serine endoprotease; Provisional 98.13
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 98.13
PRK10139455 serine endoprotease; Provisional 98.12
KOG1421|consensus955 98.11
PRK10942473 serine endoprotease; Provisional 98.1
PRK11186667 carboxy-terminal protease; Provisional 98.06
KOG3542|consensus 1283 98.04
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 98.0
KOG3571|consensus626 98.0
KOG3651|consensus429 98.0
PRK10779449 zinc metallopeptidase RseP; Provisional 97.97
KOG3542|consensus 1283 97.95
KOG3552|consensus 1298 97.93
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 97.88
KOG3606|consensus358 97.84
KOG3571|consensus626 97.84
KOG3651|consensus429 97.78
TIGR02860402 spore_IV_B stage IV sporulation protein B. SpoIVB, 97.77
TIGR03279433 cyano_FeS_chp putative FeS-containing Cyanobacteri 97.76
KOG1320|consensus473 97.7
KOG4371|consensus1332 97.63
KOG3606|consensus358 97.61
TIGR02860402 spore_IV_B stage IV sporulation protein B. SpoIVB, 97.5
COG0265347 DegQ Trypsin-like serine proteases, typically peri 97.4
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 97.38
KOG1892|consensus 1629 97.35
KOG3552|consensus 1298 97.33
KOG0609|consensus542 97.3
PRK09681276 putative type II secretion protein GspC; Provision 97.26
PRK09681276 putative type II secretion protein GspC; Provision 97.26
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 97.26
KOG3834|consensus462 97.22
KOG3129|consensus231 97.19
COG3975558 Predicted protease with the C-terminal PDZ domain 97.19
COG0265347 DegQ Trypsin-like serine proteases, typically peri 97.17
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 96.97
KOG3129|consensus231 96.82
COG3480342 SdrC Predicted secreted protein containing a PDZ d 96.73
KOG3938|consensus334 96.67
KOG0609|consensus542 96.66
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 96.44
COG3975558 Predicted protease with the C-terminal PDZ domain 96.44
KOG0606|consensus 1205 96.33
KOG3605|consensus829 96.27
COG3031275 PulC Type II secretory pathway, component PulC [In 96.12
KOG3532|consensus 1051 96.0
PF1281278 PDZ_1: PDZ-like domain 95.84
KOG4407|consensus 1973 95.8
COG3031275 PulC Type II secretory pathway, component PulC [In 95.7
KOG1320|consensus473 95.56
COG3480342 SdrC Predicted secreted protein containing a PDZ d 94.63
KOG3532|consensus 1051 94.34
KOG1738|consensus638 93.69
KOG0606|consensus 1205 91.75
KOG3938|consensus334 91.65
COG0750375 Predicted membrane-associated Zn-dependent proteas 91.31
KOG1738|consensus 638 89.3
PF1281278 PDZ_1: PDZ-like domain 88.22
KOG3834|consensus462 86.4
COG0750375 Predicted membrane-associated Zn-dependent proteas 83.0
>KOG3209|consensus Back     alignment and domain information 
Probab=99.83  E-value=5e-20  Score=193.44  Aligned_cols=185  Identities=23%  Similarity=0.334  Sum_probs=136.8

Q ss_pred             CCeEeEEEEecCCCCCCeEEEEeCCCCHhHhCC-CCCCCEEEEECCEecCCCCHHHHHHHhcC-CcEEEEEEEEcCcc--
Q psy12296          3 NGTLGFSIRGGREHTTGVFVSNVEPKSEAERSG-LLIGDQIIRINGFPIEDATHSEVLQLIHS-QNIISLKVRSVGMI--   78 (433)
Q Consensus         3 ~~gLGfsI~gG~~~~~Gv~Vs~V~pgSpA~~aG-L~~GD~ILaVNG~~V~~~s~~eav~lL~~-g~~V~L~V~R~g~~--   78 (433)
                      |+||||.|...... .+.-|..|.+||||+++| |++||+|++|||+++.+++|.+++++|++ |-.|+|+|.-....  
T Consensus       764 NeGFGFVi~sS~~k-p~sgiGrIieGSPAdRCgkLkVGDrilAVNG~sI~~lsHadiv~LIKdaGlsVtLtIip~ee~~~  842 (984)
T KOG3209|consen  764 NEGFGFVIMSSQNK-PESGIGRIIEGSPADRCGKLKVGDRILAVNGQSILNLSHADIVSLIKDAGLSVTLTIIPPEEAGP  842 (984)
T ss_pred             CCceeEEEEecccC-CCCCccccccCChhHhhccccccceEEEecCeeeeccCchhHHHHHHhcCceEEEEEcChhccCC
Confidence            78999999986554 333399999999999999 99999999999999999999999999997 78899999643211  


Q ss_pred             c----CccccceeeeEe-----ecCCCcc---------C--C--------CCCCCCccceEEeeCCCCCCCceeecCCCC
Q psy12296         79 P----TKERDKSVTWKF-----VDTNKSN---------L--N--------QNERFPVVPITLEVPPHGKLGCGICKGPQW  130 (433)
Q Consensus        79 ~----~~~~~~~~sv~l-----~~~p~s~---------~--~--------~~~~~~~~~v~L~~~~~~~LG~~l~gg~~~  130 (433)
                      +    ..++...++.+-     ...|...         +  .        .........|.|.+. ..+|||+|+||...
T Consensus       843 ~~~~~sa~~~s~~t~~~~~~q~~glp~~~~s~~~~~pqpdt~~~~~~~~r~~qn~~~~~VelErG-~kGFGFSiRGGrey  921 (984)
T KOG3209|consen  843 PTSMTSAEKQSPFTQNGPYEQQYGLPGPRPSVYEEHPQPDTFQGLSINDRMSQNGDLYTVELERG-AKGFGFSIRGGREY  921 (984)
T ss_pred             CCCCcchhhcCcccccCCHhHccCCCCCCccccccCCCCccccceeccccccccCCeeEEEeecc-ccccceEeeccccc
Confidence            0    000100110000     0000000         0  0        001122344555553 46799999999988


Q ss_pred             CCceEEEEECCCChhhhcC-CCCCCEEEEEccEecCChhhHHHHHHHhcCCCeEEEEEEEC
Q psy12296        131 KPGIFVQFTKDACVAKDAG-LKCGDQILACNGVKFSPDVTFEHAVSVMKSSCLLELLVHRG  190 (433)
Q Consensus       131 ~~GV~V~~V~~gspA~~aG-L~~GD~Il~ING~~v~s~~s~~eav~~Lr~~~~v~L~V~R~  190 (433)
                      ..++||-.+.+++||.+.| +++||+|++|||+++. +++|..|+++|+++....+++.|.
T Consensus       922 nM~LfVLRlAeDGPA~rdGrm~VGDqi~eINGesTk-gmtH~rAIelIk~gg~~vll~Lr~  981 (984)
T KOG3209|consen  922 NMDLFVLRLAEDGPAIRDGRMRVGDQITEINGESTK-GMTHDRAIELIKQGGRRVLLLLRR  981 (984)
T ss_pred             ccceEEEEeccCCCccccCceeecceEEEecCcccC-CCcHHHHHHHHHhCCeEEEEEecc
Confidence            8999999999999999988 9999999999999999 999999999999985555555444

>KOG3209|consensus Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>KOG3550|consensus Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>KOG3550|consensus Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query433
3k1r_A192 Structure Of Harmonin Npdz1 In Complex With The Sam 2e-18
2eeh_A100 Solution Structure Of First Pdz Domain Of Pdz Domai 2e-13
2eeh_A100 Solution Structure Of First Pdz Domain Of Pdz Domai 7e-05
1uez_A101 Solution Structure Of The First Pdz Domain Of Human 5e-13
1uf1_A128 Solution Structure Of The Second Pdz Domain Of Huma 8e-13
1wi2_A104 Solution Structure Of The Pdz Domain From Riken Cdn 2e-10
1wi2_A104 Solution Structure Of The Pdz Domain From Riken Cdn 2e-05
1x5n_A114 Solution Structure Of The Second Pdz Domain Of Harm 2e-10
2kbs_A92 Solution Structure Of Harmonin Pdz2 In Complex With 7e-10
1wfv_A103 Solution Structure Of The Fifth Pdz Domain Of Human 2e-07
1p1d_A196 Structural Insights Into The Inter-Domain Chaperoni 8e-07
2lob_A112 Pdz Domain Of Cal (Cystic Fibrosis Transmembrane Re 9e-07
4e34_A87 Crystal Structure Of Cftr Associated Ligand (Cal) P 1e-06
2dc2_A103 Solution Structure Of Pdz Domain Length = 103 1e-06
2r4h_B112 Crystal Structure Of A C1190s Mutant Of The 6th Pdz 1e-06
2dkr_A93 Solution Structure Of The Pdz Domain From Human Lin 2e-06
2w4f_A97 Crystal Structure Of The First Pdz Domain Of Human 5e-06
2vrf_A95 Crystal Structure Of The Human Beta-2-Syntrophin Pd 1e-05
2eei_A106 Solution Structure Of Second Pdz Domain Of Pdz Doma 1e-05
2xkx_A 721 Single Particle Analysis Of Psd-95 In Negative Stai 1e-05
1wha_A105 Solution Structure Of The Second Pdz Domain Of Huma 2e-05
1x5q_A110 Solution Structure Of The First Pdz Domain Of Scrib 2e-05
3gsl_A196 Crystal Structure Of Psd-95 Tandem Pdz Domains 1 An 2e-05
3zrt_A199 Crystal Structure Of Human Psd-95 Pdz1-2 Length = 1 3e-05
2ka9_A189 Solution Structure Of Psd-95 Pdz12 Complexed With C 3e-05
1z87_A263 Solution Structure Of The Split Ph-Pdz Supramodule 4e-05
2pdz_A86 Solution Structure Of The Syntrophin Pdz Domain In 5e-05
1qav_A90 Unexpected Modes Of Pdz Domain Scaffolding Revealed 5e-05
1z86_A87 Solution Structure Of The Pdz Domain Of Alpha-Syntr 5e-05
2dls_A93 Solution Structure Of The Pdz Domain Of Human Rho G 6e-05
1gq5_A91 Structural Determinants Of The Nherf Interaction Wi 6e-05
1i92_A91 Structural Basis Of The Nherf Pdz1-Cftr Interaction 6e-05
1gq4_A90 Structural Determinants Of The Nherf Interaction Wi 6e-05
2edz_A114 Solution Structures Of The Pdz Domain Of Mus Muscul 6e-05
1v5q_A122 Solution Structure Of The Pdz Domain From Mouse Glu 7e-05
1g9o_A91 First Pdz Domain Of The Human Na+H+ EXCHANGER REGUL 8e-05
1p1e_A101 Structural Insights Into The Inter-Domain Chaperoni 8e-05
4f8k_A109 Molecular Analysis Of The Interaction Between The P 8e-05
3ngh_A106 Molecular Analysis Of The Interaction Of The Hdl Re 9e-05
2omj_A89 Solution Structure Of Larg Pdz Domain Length = 89 1e-04
2o2t_A117 The Crystal Structure Of The 1st Pdz Domain Of Mpdz 1e-04
2ocs_A88 The Crystal Structure Of The First Pdz Domain Of Hu 2e-04
1gm1_A94 Second Pdz Domain (Pdz2) Of Ptp-Bl Length = 94 2e-04
1vj6_A102 Pdz2 From Ptp-Bl In Complex With The C-Terminal Lig 2e-04
2vph_A100 Crystal Structure Of The Human Protein Tyrosine Pho 2e-04
3o46_A93 Crystal Structure Of The Pdz Domain Of Mpp7 Length 2e-04
3qdo_A109 Crystal Structure Of Pdz Domain Of Sorting Nexin 27 3e-04
3nfk_A107 Crystal Structure Of The Ptpn4 Pdz Domain Complexed 3e-04
2cs5_A119 Solution Structure Of Pdz Domain Of Protein Tyrosin 3e-04
3ch8_A195 The Crystal Structure Of Pdz-Fibronectin Fusion Pro 6e-04
2qbw_A195 The Crystal Structure Of Pdz-Fibronectin Fusion Pro 6e-04
3qgl_A101 Crystal Structure Of Pdz Domain Of Sorting Nexin 27 6e-04
1x5r_A112 Solution Structure Of The Fourth Pdz Domain Of Glut 7e-04
2byg_A117 2nd Pdz Domain Of Discs Large Homologue 2 Length = 8e-04
1uhp_A107 Solution Structure Of Rsgi Ruh-005, A Pdz Domain In 9e-04
1vb7_A94 Solution Structure Of The Pdz Domain Of Pdz And Lim 9e-04
>pdb|3K1R|A Chain A, Structure Of Harmonin Npdz1 In Complex With The Sam-Pbm Of Sans Length = 192 Back     alignment and structure 
Iteration: 1

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 40/89 (44%), Positives = 62/89 (69%), Gaps = 1/89 (1%)
Query: 6   LGFSIRGGREHTTGVFVSNVEPKSEAERSGLLIGDQIIRINGFPIEDATHSEVLQLIHSQ 65
           LG S+RGG E   G+F+S++    +A+  GL +GD+I+RING+ I   TH EV+ LI ++
Sbjct: 98  LGLSVRGGLEFGCGLFISHLIKGGQADSVGLQVGDEIVRINGYSISSCTHEEVINLIRTE 157
Query: 66  NIISLKVRSVGMIPTKER-DKSVTWKFVD 93
             +S+KVR +G+IP K   D+ +TW++VD
Sbjct: 158 KTVSIKVRHIGLIPVKSSPDEPLTWQYVD 186
>pdb|2EEH|A Chain A, Solution Structure Of First Pdz Domain Of Pdz Domain Containing Protein 7 Length = 100 Back     alignment and structure
>pdb|2EEH|A Chain A, Solution Structure Of First Pdz Domain Of Pdz Domain Containing Protein 7 Length = 100 Back     alignment and structure
>pdb|1UEZ|A Chain A, Solution Structure Of The First Pdz Domain Of Human Kiaa1526 Protein Length = 101 Back     alignment and structure
>pdb|1UF1|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Kiaa1526 Protein Length = 128 Back     alignment and structure
>pdb|1WI2|A Chain A, Solution Structure Of The Pdz Domain From Riken Cdna 2700099c19 Length = 104 Back     alignment and structure
>pdb|1WI2|A Chain A, Solution Structure Of The Pdz Domain From Riken Cdna 2700099c19 Length = 104 Back     alignment and structure
>pdb|1X5N|A Chain A, Solution Structure Of The Second Pdz Domain Of Harmonin Protein Length = 114 Back     alignment and structure
>pdb|2KBS|A Chain A, Solution Structure Of Harmonin Pdz2 In Complex With The Carboxyl Tail Peptide Of Cadherin23 Length = 92 Back     alignment and structure
>pdb|1WFV|A Chain A, Solution Structure Of The Fifth Pdz Domain Of Human Membrane Associated Guanylate Kinase Inverted-2 (Kiaa0705 Protein) Length = 103 Back     alignment and structure
>pdb|1P1D|A Chain A, Structural Insights Into The Inter-Domain Chaperoning Of Tandem Pdz Domains In Glutamate Receptor Interacting Proteins Length = 196 Back     alignment and structure
>pdb|2LOB|A Chain A, Pdz Domain Of Cal (Cystic Fibrosis Transmembrane Regulator-Associated Ligand) Length = 112 Back     alignment and structure
>pdb|4E34|A Chain A, Crystal Structure Of Cftr Associated Ligand (Cal) Pdz Domain Bound To Ical36 (Ansrwptsii) Peptide Length = 87 Back     alignment and structure
>pdb|2DC2|A Chain A, Solution Structure Of Pdz Domain Length = 103 Back     alignment and structure
>pdb|2R4H|B Chain B, Crystal Structure Of A C1190s Mutant Of The 6th Pdz Domain Of Human Membrane Associated Guanylate Kinase Length = 112 Back     alignment and structure
>pdb|2DKR|A Chain A, Solution Structure Of The Pdz Domain From Human Lin-7 Homolog B Length = 93 Back     alignment and structure
>pdb|2W4F|A Chain A, Crystal Structure Of The First Pdz Domain Of Human Scrib1 Length = 97 Back     alignment and structure
>pdb|2VRF|A Chain A, Crystal Structure Of The Human Beta-2-Syntrophin Pdz Domain Length = 95 Back     alignment and structure
>pdb|2EEI|A Chain A, Solution Structure Of Second Pdz Domain Of Pdz Domain Containing Protein 1 Length = 106 Back     alignment and structure
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure
>pdb|1WHA|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Scribble (Kiaa0147 Protein) Length = 105 Back     alignment and structure
>pdb|1X5Q|A Chain A, Solution Structure Of The First Pdz Domain Of Scribble Homolog Protein (Hscrib) Length = 110 Back     alignment and structure
>pdb|3GSL|A Chain A, Crystal Structure Of Psd-95 Tandem Pdz Domains 1 And 2 Length = 196 Back     alignment and structure
>pdb|3ZRT|A Chain A, Crystal Structure Of Human Psd-95 Pdz1-2 Length = 199 Back     alignment and structure
>pdb|2KA9|A Chain A, Solution Structure Of Psd-95 Pdz12 Complexed With Cypin Peptide Length = 189 Back     alignment and structure
>pdb|1Z87|A Chain A, Solution Structure Of The Split Ph-Pdz Supramodule Of Alpha- Syntrophin Length = 263 Back     alignment and structure
>pdb|2PDZ|A Chain A, Solution Structure Of The Syntrophin Pdz Domain In Complex With The Peptide Gvkeslv, Nmr, 15 Structures Length = 86 Back     alignment and structure
>pdb|1QAV|A Chain A, Unexpected Modes Of Pdz Domain Scaffolding Revealed By Structure Of Nnos-Syntrophin Complex Length = 90 Back     alignment and structure
>pdb|1Z86|A Chain A, Solution Structure Of The Pdz Domain Of Alpha-Syntrophin Length = 87 Back     alignment and structure
>pdb|2DLS|A Chain A, Solution Structure Of The Pdz Domain Of Human Rho Guanine Nucleotide Exchange Factor 11 Length = 93 Back     alignment and structure
>pdb|1GQ5|A Chain A, Structural Determinants Of The Nherf Interaction With Beta2- Ar And Pdgfr Length = 91 Back     alignment and structure
>pdb|1I92|A Chain A, Structural Basis Of The Nherf Pdz1-Cftr Interaction Length = 91 Back     alignment and structure
>pdb|1GQ4|A Chain A, Structural Determinants Of The Nherf Interaction With Beta2ar And Pdgfr Length = 90 Back     alignment and structure
>pdb|2EDZ|A Chain A, Solution Structures Of The Pdz Domain Of Mus Musculus Pdz Domain-Containing Protein 1 Length = 114 Back     alignment and structure
>pdb|1V5Q|A Chain A, Solution Structure Of The Pdz Domain From Mouse Glutamate Receptor Interacting Protein 1a-L (Grip1) Homolog Length = 122 Back     alignment and structure
>pdb|1G9O|A Chain A, First Pdz Domain Of The Human Na+H+ EXCHANGER REGULATORY Factor Length = 91 Back     alignment and structure
>pdb|1P1E|A Chain A, Structural Insights Into The Inter-Domain Chaperoning Of Tandem Pdz Domains In Glutamate Receptor Interacting Proteins Length = 101 Back     alignment and structure
>pdb|4F8K|A Chain A, Molecular Analysis Of The Interaction Between The Prostacyclin Receptor And The First Pdz Domain Of Pdzk1 Length = 109 Back     alignment and structure
>pdb|3NGH|A Chain A, Molecular Analysis Of The Interaction Of The Hdl Receptor Sr-Bi With The Adaptor Protein Pdzk1 Length = 106 Back     alignment and structure
>pdb|2OMJ|A Chain A, Solution Structure Of Larg Pdz Domain Length = 89 Back     alignment and structure
>pdb|2O2T|A Chain A, The Crystal Structure Of The 1st Pdz Domain Of Mpdz Length = 117 Back     alignment and structure
>pdb|2OCS|A Chain A, The Crystal Structure Of The First Pdz Domain Of Human Nherf-2 (slc9a3r2) Length = 88 Back     alignment and structure
>pdb|1GM1|A Chain A, Second Pdz Domain (Pdz2) Of Ptp-Bl Length = 94 Back     alignment and structure
>pdb|1VJ6|A Chain A, Pdz2 From Ptp-Bl In Complex With The C-Terminal Ligand From The Apc Protein Length = 102 Back     alignment and structure
>pdb|2VPH|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase, Non-Receptor Type 4, Pdz Domain Length = 100 Back     alignment and structure
>pdb|3O46|A Chain A, Crystal Structure Of The Pdz Domain Of Mpp7 Length = 93 Back     alignment and structure
>pdb|3QDO|A Chain A, Crystal Structure Of Pdz Domain Of Sorting Nexin 27 (Snx27) Fused To The Gly-Gly Linker Followed By C-Terminal (Eseskv) Of Girk3 Length = 109 Back     alignment and structure
>pdb|3NFK|A Chain A, Crystal Structure Of The Ptpn4 Pdz Domain Complexed With The C- Terminus Of A Rabies Virus G Protein Length = 107 Back     alignment and structure
>pdb|2CS5|A Chain A, Solution Structure Of Pdz Domain Of Protein Tyrosine Phosphatase, Non-Receptor Type 4 Length = 119 Back     alignment and structure
>pdb|3CH8|A Chain A, The Crystal Structure Of Pdz-Fibronectin Fusion Protein Length = 195 Back     alignment and structure
>pdb|2QBW|A Chain A, The Crystal Structure Of Pdz-Fibronectin Fusion Protein Length = 195 Back     alignment and structure
>pdb|3QGL|A Chain A, Crystal Structure Of Pdz Domain Of Sorting Nexin 27 (Snx27) In Complex With The Eseskv Peptide Corresponding To The C-Terminal Tail Of Girk3 Length = 101 Back     alignment and structure
>pdb|1X5R|A Chain A, Solution Structure Of The Fourth Pdz Domain Of Glutamate Receptor Interacting Protein 2 Length = 112 Back     alignment and structure
>pdb|2BYG|A Chain A, 2nd Pdz Domain Of Discs Large Homologue 2 Length = 117 Back     alignment and structure
>pdb|1UHP|A Chain A, Solution Structure Of Rsgi Ruh-005, A Pdz Domain In Human Cdna, Kiaa1095 Length = 107 Back     alignment and structure
>pdb|1VB7|A Chain A, Solution Structure Of The Pdz Domain Of Pdz And Lim Domain 2 Length = 94 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query433
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 2e-31
3k1r_A192 Harmonin; protein-protein complex, alternative spl 2e-30
3k1r_A192 Harmonin; protein-protein complex, alternative spl 6e-11
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 2e-30
2eeh_A100 PDZ domain-containing protein 7; structural genomi 2e-29
2eeh_A100 PDZ domain-containing protein 7; structural genomi 8e-14
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 7e-28
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 1e-11
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 2e-27
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 3e-26
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 2e-12
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 1e-24
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 3e-18
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 5e-24
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 6e-06
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 1e-23
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 5e-07
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 2e-23
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 3e-06
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 4e-23
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 6e-07
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 6e-23
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 4e-08
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 7e-23
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 3e-09
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 2e-22
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 2e-06
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 2e-22
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 5e-08
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 3e-22
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 2e-06
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 3e-22
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 7e-07
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 5e-22
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 6e-06
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 6e-22
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 3e-18
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 1e-21
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 5e-07
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 1e-20
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 2e-06
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 2e-20
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 3e-07
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 3e-20
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 1e-05
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 3e-20
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 8e-07
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 3e-20
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 5e-12
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 3e-20
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 7e-08
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 4e-20
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 3e-04
2eaq_A90 LIM domain only protein 7; conserved hypothetical 4e-20
2eaq_A90 LIM domain only protein 7; conserved hypothetical 2e-11
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 5e-20
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 2e-06
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 6e-20
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 3e-08
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 7e-20
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 3e-05
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 2e-19
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 2e-05
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 2e-19
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 2e-04
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 3e-19
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 3e-06
2ego_A96 General receptor for phosphoinositides 1- associat 3e-19
2ego_A96 General receptor for phosphoinositides 1- associat 2e-05
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 5e-19
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 2e-11
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 6e-19
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 2e-05
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 6e-19
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 4e-06
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 7e-19
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 4e-06
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 8e-19
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 8e-19
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 1e-06
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 2e-18
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 4e-04
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 2e-18
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 2e-05
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 3e-18
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 8e-04
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 4e-18
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 2e-05
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 4e-18
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 1e-06
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 4e-18
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 6e-07
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 4e-18
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 4e-18
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 1e-07
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 4e-18
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 6e-07
2d90_A102 PDZ domain containing protein 1; structural genomi 5e-18
2d90_A102 PDZ domain containing protein 1; structural genomi 1e-04
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 5e-18
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 3e-06
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 5e-18
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 1e-04
2v90_A96 PDZ domain-containing protein 3; membrane, protein 5e-18
2v90_A96 PDZ domain-containing protein 3; membrane, protein 1e-05
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 5e-18
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 6e-07
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 6e-18
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 3e-11
2eei_A106 PDZ domain-containing protein 1; regulatory factor 7e-18
2eei_A106 PDZ domain-containing protein 1; regulatory factor 5e-05
3khf_A99 Microtubule-associated serine/threonine-protein ki 8e-18
3khf_A99 Microtubule-associated serine/threonine-protein ki 2e-04
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 8e-18
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 4e-07
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 1e-17
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 2e-06
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 1e-17
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 8e-04
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 2e-17
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 7e-09
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 3e-07
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 2e-17
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 2e-17
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 2e-05
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 2e-17
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 2e-05
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 2e-17
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 2e-06
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 2e-17
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 4e-07
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 3e-17
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 8e-07
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 3e-17
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 1e-05
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 4e-17
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 4e-04
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 4e-17
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 2e-05
2djt_A104 Unnamed protein product; PDZ domain, structural ge 5e-17
2djt_A104 Unnamed protein product; PDZ domain, structural ge 6e-04
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 5e-17
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 1e-05
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 6e-17
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 6e-17
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 7e-06
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 8e-17
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 2e-07
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 9e-17
2xkx_A721 Disks large homolog 4; structural protein, scaffol 2e-11
2xkx_A721 Disks large homolog 4; structural protein, scaffol 6e-11
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 1e-16
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 3e-07
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 1e-16
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 4e-04
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 1e-16
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 5e-04
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 1e-16
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 2e-08
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 2e-16
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 4e-08
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 2e-16
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 2e-05
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 2e-16
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 2e-05
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 2e-16
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 4e-06
2opg_A98 Multiple PDZ domain protein; structural protein, s 2e-16
2opg_A98 Multiple PDZ domain protein; structural protein, s 3e-06
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 2e-16
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 5e-05
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 2e-16
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 2e-16
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 2e-08
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 3e-16
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 3e-16
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 3e-16
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 3e-08
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 4e-16
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 8e-05
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 4e-16
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 1e-06
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 4e-16
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 6e-06
2awx_A105 Synapse associated protein 97; membrane protein, s 5e-16
2awx_A105 Synapse associated protein 97; membrane protein, s 3e-06
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 5e-16
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 3e-05
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 6e-16
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 5e-11
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 6e-16
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 3e-04
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 7e-16
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 8e-07
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 9e-16
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 1e-05
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 1e-15
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 8e-04
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 1e-15
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 1e-06
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 2e-15
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 1e-06
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 2e-15
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 2e-06
2byg_A117 Channel associated protein of synapse-110; DLG2, P 2e-15
2byg_A117 Channel associated protein of synapse-110; DLG2, P 7e-07
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 2e-15
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 2e-15
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 2e-15
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 3e-15
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 9e-05
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 3e-15
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 5e-04
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 4e-15
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 4e-06
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 4e-15
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 2e-07
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 5e-15
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 1e-05
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 5e-15
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 2e-05
2fne_A117 Multiple PDZ domain protein; structural protein, s 6e-15
2fne_A117 Multiple PDZ domain protein; structural protein, s 8e-08
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 7e-15
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 9e-06
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 7e-15
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 1e-06
2o2t_A117 Multiple PDZ domain protein; structural protein, s 8e-15
2o2t_A117 Multiple PDZ domain protein; structural protein, s 2e-10
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 8e-15
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 6e-07
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 9e-15
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 1e-06
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 1e-14
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 3e-07
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 1e-14
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 6e-07
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 1e-14
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 1e-04
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 1e-14
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 2e-07
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 1e-14
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 6e-05
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 2e-14
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 4e-04
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 2e-14
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 6e-06
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 2e-14
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 4e-05
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 3e-14
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 5e-05
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 4e-14
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 4e-14
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 4e-06
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 5e-14
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 1e-06
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 5e-14
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 2e-11
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 7e-14
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 2e-04
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 8e-14
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 8e-14
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 5e-05
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 9e-14
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 1e-05
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 1e-13
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 6e-05
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 2e-13
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 1e-04
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 2e-13
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 1e-06
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 2e-13
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 3e-07
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 3e-13
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 4e-05
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 3e-13
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 4e-06
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 3e-13
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 3e-09
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 4e-13
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 9e-06
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 4e-13
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 1e-07
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 5e-13
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 3e-06
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 1e-12
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 5e-05
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 2e-12
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 7e-05
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 4e-12
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 1e-04
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 4e-12
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 1e-06
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 4e-11
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 6e-11
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 3e-10
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 3e-06
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 3e-10
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 1e-09
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 3e-09
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 4e-09
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 3e-05
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 7e-09
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 8e-09
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 3e-08
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 7e-08
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 7e-08
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 3e-07
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 1e-06
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 6e-06
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 6e-06
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 9e-06
3k50_A403 Putative S41 protease; structural genomics, joint 9e-06
2kl1_A94 YLBL protein; structure genomics, structural genom 2e-05
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 2e-05
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 2e-05
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 3e-05
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 5e-05
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 1e-04
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 1e-04
2hga_A125 Conserved protein MTH1368; GFT structural genomics 2e-04
4fgm_A597 Aminopeptidase N family protein; structural genomi 2e-04
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 3e-04
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
 Score =  117 bits (296), Expect = 2e-31
 Identities = 40/197 (20%), Positives = 72/197 (36%), Gaps = 27/197 (13%)

Query: 3   NGTLGFSIRGGREHTTGVFVSNVEPKSEAERSG-LLIGDQIIRINGFPIEDATHSEVLQL 61
             TLG ++ GG +      VSN+     A RS  L +GD I  +NG  +    H E++ L
Sbjct: 18  GTTLGLTVSGGIDKDGKPRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAKFRHDEIISL 77

Query: 62  I-HSQNIISLKVRSVGMIPTKERDKSVTWKFVDTNKSNLNQNERFPVVPITLEVPPHGKL 120
           + +    + L+V           +                 +  F  V +TL    +   
Sbjct: 78  LKNVGERVVLEVE---------YELPPVSIQ--------GSSVMFRTVEVTLHKEGNT-F 119

Query: 121 GC----GICKGPQWKPGIFVQF-TKDACVAKDAGLKCGDQILACNGVKFSPDVTFEHAVS 175
           G     G          + +          ++  +K GD++L+ +G++     T   A+S
Sbjct: 120 GFVIRGGAHDDRNKSRPVVITCVRPGGPADREGTIKPGDRLLSVDGIRLL-GTTHAEAMS 178

Query: 176 VMKSSC-LLELLVHRGV 191
           ++K       LL+   V
Sbjct: 179 ILKQCGQEATLLIEYDV 195
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Length = 195 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Length = 113 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Length = 112 Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 3nwu_A 2ytw_A 2joa_A Length = 332 Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Length = 325 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Length = 324 Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Length = 318 Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Length = 345 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Length = 91 Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Length = 403 Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Length = 94 Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} Length = 209 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Length = 100 Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Length = 105 Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Length = 87 Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Length = 91 Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Length = 134 Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Length = 125 Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Length = 597 Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Length = 95 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query433
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.92
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.91
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.9
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.88
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.84
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 99.8
2xkx_A721 Disks large homolog 4; structural protein, scaffol 99.79
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 99.78
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 99.77
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 99.77
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 99.73
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 99.58
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 99.51
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.49
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 99.47
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.46
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 99.45
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.44
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 99.44
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 99.42
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.41
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 99.4
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 99.4
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 99.4
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.4
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.4
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.4
2eeh_A100 PDZ domain-containing protein 7; structural genomi 99.39
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 99.39
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 99.39
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.39
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.39
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.39
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 99.39
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.38
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.38
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.38
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.38
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 99.38
2awx_A105 Synapse associated protein 97; membrane protein, s 99.38
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 99.38
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 99.38
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.38
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.37
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 99.37
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.37
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 99.37
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 99.37
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 99.37
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.37
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.36
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 99.36
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.36
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 99.36
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 99.35
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 99.35
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.34
3k1r_A192 Harmonin; protein-protein complex, alternative spl 99.34
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.34
2ego_A96 General receptor for phosphoinositides 1- associat 99.34
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 99.34
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 99.34
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 99.34
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.33
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 99.33
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 99.33
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 99.33
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 99.33
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 99.33
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 99.33
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 99.33
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.33
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 99.33
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 99.33
2fne_A117 Multiple PDZ domain protein; structural protein, s 99.32
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 99.31
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.31
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.31
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 99.31
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.31
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 99.31
2djt_A104 Unnamed protein product; PDZ domain, structural ge 99.31
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.3
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 99.3
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 99.3
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 99.3
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 99.3
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 99.29
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 99.29
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.29
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 99.29
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 99.29
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.29
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 99.28
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.28
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 99.28
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 99.28
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 99.28
2o2t_A117 Multiple PDZ domain protein; structural protein, s 99.28
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 99.28
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 99.28
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 99.27
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.27
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 99.27
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 99.27
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 99.27
2eeh_A100 PDZ domain-containing protein 7; structural genomi 99.27
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 99.27
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 99.27
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 99.27
3khf_A99 Microtubule-associated serine/threonine-protein ki 99.26
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 99.26
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 99.26
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.26
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 99.26
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 99.26
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 99.26
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 99.26
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 99.26
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 99.26
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 99.26
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 99.25
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 99.25
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.25
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 99.25
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.25
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 99.25
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.25
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 99.25
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 99.24
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 99.24
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 99.23
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 99.22
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 99.22
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.22
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 99.22
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 99.22
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.21
2d90_A102 PDZ domain containing protein 1; structural genomi 99.21
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 99.21
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 99.21
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 99.21
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.21
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.21
2eei_A106 PDZ domain-containing protein 1; regulatory factor 99.2
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 99.2
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.2
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 99.2
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 99.2
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 99.2
2awx_A105 Synapse associated protein 97; membrane protein, s 99.2
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 99.2
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 99.2
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.2
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.2
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.2
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.19
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 99.19
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 99.19
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.19
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.19
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 99.19
2ego_A96 General receptor for phosphoinositides 1- associat 99.19
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.19
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 99.18
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 99.18
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 99.18
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.18
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.18
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.18
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 99.17
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 99.17
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 99.17
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.17
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 99.17
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 99.16
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.16
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 99.16
2fne_A117 Multiple PDZ domain protein; structural protein, s 99.16
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 99.16
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.16
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 99.16
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.16
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 99.16
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 98.78
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 99.15
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.15
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.15
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 99.15
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 99.15
2eaq_A90 LIM domain only protein 7; conserved hypothetical 99.15
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 99.15
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 99.15
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 99.15
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 99.15
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 99.15
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 99.14
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 99.14
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 99.14
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 99.14
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 99.14
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 99.14
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.14
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 99.14
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.14
2o2t_A117 Multiple PDZ domain protein; structural protein, s 99.14
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.14
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 99.13
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.13
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 99.13
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 99.13
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 99.13
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 99.13
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 99.13
2djt_A104 Unnamed protein product; PDZ domain, structural ge 99.13
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 99.13
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 99.12
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 99.12
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 99.12
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 99.12
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 99.12
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 99.12
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 99.12
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 99.11
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.11
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.11
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 99.11
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 99.11
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 99.11
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 99.1
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 99.1
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 99.1
3k1r_A192 Harmonin; protein-protein complex, alternative spl 99.1
1fc6_A388 Photosystem II D1 protease; D1 C-terminal processi 99.09
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 99.09
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 99.09
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 99.09
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 99.09
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 99.09
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 99.09
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 99.08
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 99.08
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.08
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.08
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 99.08
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 99.08
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 99.08
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 99.07
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 99.07
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 99.07
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 99.07
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 99.07
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 99.06
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.06
2d90_A102 PDZ domain containing protein 1; structural genomi 99.06
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 99.06
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 99.06
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 99.05
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 99.05
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 99.05
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 99.05
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 99.05
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 99.05
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 99.05
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 99.05
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 99.05
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 99.04
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 99.03
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 99.03
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 99.03
2eaq_A90 LIM domain only protein 7; conserved hypothetical 99.03
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 99.02
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 99.02
2eei_A106 PDZ domain-containing protein 1; regulatory factor 99.02
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 99.02
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 99.01
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 99.01
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 99.01
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.0
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 99.0
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.0
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.99
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 98.99
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 98.99
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 98.99
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 98.99
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 98.99
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 98.98
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 98.98
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 98.98
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 98.98
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 98.98
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.97
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 98.97
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 98.97
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 98.96
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 98.96
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 98.96
3khf_A99 Microtubule-associated serine/threonine-protein ki 98.94
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 98.94
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 98.94
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 98.93
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 98.92
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 98.92
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 98.92
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 98.92
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 98.92
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 98.91
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 98.91
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 98.91
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 98.91
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 98.9
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 98.42
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 98.89
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 98.89
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 98.88
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 98.87
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 98.86
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 98.86
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.86
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 98.85
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 98.84
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 98.83
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 98.82
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 98.79
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.79
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.78
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 98.77
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 98.77
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.75
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 98.74
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 98.73
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.73
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.73
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 98.73
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 98.73
2kl1_A94 YLBL protein; structure genomics, structural genom 98.73
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 98.71
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 98.69
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.69
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 98.68
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 98.68
2kl1_A94 YLBL protein; structure genomics, structural genom 98.66
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 98.66
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 98.65
3k50_A403 Putative S41 protease; structural genomics, joint 98.64
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 98.62
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 98.62
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 98.6
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.6
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.59
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.59
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.58
1fc6_A388 Photosystem II D1 protease; D1 C-terminal processi 98.58
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 98.58
4fgm_A597 Aminopeptidase N family protein; structural genomi 98.53
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.51
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 98.48
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 98.45
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 98.45
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.4
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 98.4
3k50_A403 Putative S41 protease; structural genomics, joint 98.4
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 98.35
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 98.35
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 98.34
2hga_A125 Conserved protein MTH1368; GFT structural genomics 98.34
2hga_A125 Conserved protein MTH1368; GFT structural genomics 98.34
4fgm_A597 Aminopeptidase N family protein; structural genomi 98.3
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 98.25
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 98.25
1k32_A1045 Tricorn protease; protein degradation, substrate g 98.24
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 98.15
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 98.15
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 97.94
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 97.78
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 97.7
1k32_A1045 Tricorn protease; protein degradation, substrate g 97.62
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
Probab=99.92  E-value=3.4e-24  Score=196.63  Aligned_cols=164  Identities=29%  Similarity=0.443  Sum_probs=133.1

Q ss_pred             CCeEeEEEEecCCC-----CCCeEEEEeCCCCHhHhCC-CCCCCEEEEECCEecCCCCHHHHHHHhcC-CcEEEEEEEEc
Q psy12296          3 NGTLGFSIRGGREH-----TTGVFVSNVEPKSEAERSG-LLIGDQIIRINGFPIEDATHSEVLQLIHS-QNIISLKVRSV   75 (433)
Q Consensus         3 ~~gLGfsI~gG~~~-----~~Gv~Vs~V~pgSpA~~aG-L~~GD~ILaVNG~~V~~~s~~eav~lL~~-g~~V~L~V~R~   75 (433)
                      +++|||+|.+|.+.     ..|++|..|.++|||+++| |++||+|++|||+++.++++.+++.+++. +..++|+|.|.
T Consensus        15 ~~~lG~~i~~g~~~~~~~~~~g~~V~~V~~~spA~~aG~l~~GD~I~~vng~~v~~~~~~~~~~~~~~~g~~v~l~v~r~   94 (196)
T 3gsl_A           15 NSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRR   94 (196)
T ss_dssp             TTBSSEEEECCTTSCTTSSCCCEEEEEECTTSHHHHHCCCCTTCEEEEETTEECTTCCHHHHHHHHHTSCSEEEEEEEEE
T ss_pred             CCCCCEEEEcccCCcccCCCCCEEEEEECCCChHHhcCCCCCCCEEEEECCEECCCCCHHHHHHHHHhCCCcEEEEEEec
Confidence            56899999998875     5699999999999999999 99999999999999999999888877765 78999999987


Q ss_pred             CcccCccccceeeeEeecCCCccCCCCCCCCccceEEeeCCCCCCCceeecCCC-----CCCceEEEEECCCChhhhcC-
Q psy12296         76 GMIPTKERDKSVTWKFVDTNKSNLNQNERFPVVPITLEVPPHGKLGCGICKGPQ-----WKPGIFVQFTKDACVAKDAG-  149 (433)
Q Consensus        76 g~~~~~~~~~~~sv~l~~~p~s~~~~~~~~~~~~v~L~~~~~~~LG~~l~gg~~-----~~~GV~V~~V~~gspA~~aG-  149 (433)
                      +..    ......+.+                     ... ...||+.+.++..     ...|++|..|.++++|+++| 
T Consensus        95 ~~~----~~~~~~v~l---------------------~~~-~~~lG~~~~~~~~~~~~~~~~gv~V~~V~~gs~A~~aG~  148 (196)
T 3gsl_A           95 KPP----AEKVMEIKL---------------------IKG-PKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGR  148 (196)
T ss_dssp             CCC----CEEEEEEEE---------------------EEB-TTBSCEEEEESBTSCSBTTBCCEEEEEECTTSHHHHHCC
T ss_pred             CCC----ccccEEEEE---------------------ecC-CCCceEEEEccCCCcCCCCCCCEEEEEECCCChHHhcCC
Confidence            621    111222222                     222 2357777765432     13589999999999999999 


Q ss_pred             CCCCCEEEEEccEecCChhhHHHHHHHhcCC-CeEEEEEEECCee
Q psy12296        150 LKCGDQILACNGVKFSPDVTFEHAVSVMKSS-CLLELLVHRGVGL  193 (433)
Q Consensus       150 L~~GD~Il~ING~~v~s~~s~~eav~~Lr~~-~~v~L~V~R~~~~  193 (433)
                      |++||+|++|||+++. ..++.+++..++.. +.+.|+|.|++..
T Consensus       149 L~~GD~Il~Vng~~v~-~~~~~~~~~~l~~~~~~v~l~v~R~~~~  192 (196)
T 3gsl_A          149 LQIGDKILAVNSVGLE-DVMHEDAVAALKNTYDVVYLKVAKPSNA  192 (196)
T ss_dssp             CCTTCEEEEETTEECS-SCBHHHHHHHHHSCCEEEEEEEEEESCC
T ss_pred             CCCCCEEEEECCCcCC-CCCHHHHHHHHHcCCCeEEEEEeCCCCc
Confidence            9999999999999999 67799999999876 7899999998754
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 433
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 8e-20
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 5e-09
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 9e-20
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 8e-10
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 3e-17
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 8e-08
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 3e-17
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 6e-06
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 6e-17
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 2e-11
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 8e-17
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 3e-13
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 2e-16
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 5e-10
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 4e-16
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 2e-07
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 8e-16
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 4e-09
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 8e-16
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 1e-15
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 7e-05
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 2e-15
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 6e-10
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 3e-15
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 6e-15
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 1e-09
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 7e-15
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 4e-07
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 1e-14
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 2e-04
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 1e-14
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 4e-06
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 2e-14
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 1e-05
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 2e-14
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 3e-08
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 4e-14
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 9e-05
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 4e-14
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 2e-07
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 5e-14
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 7e-07
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 5e-14
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 6e-07
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 6e-14
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 1e-05
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 8e-14
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-05
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 1e-13
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 1e-13
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 2e-13
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 2e-13
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 8e-06
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 2e-13
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 4e-05
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 3e-13
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 9e-06
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 4e-13
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 2e-07
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 5e-13
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 1e-07
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 5e-13
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 0.004
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 6e-13
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 6e-13
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 2e-04
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 7e-13
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 3e-06
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 1e-12
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 1e-12
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 8e-05
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 1e-12
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 3e-06
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 2e-12
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 2e-07
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 2e-12
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 2e-05
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 3e-12
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 3e-12
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 5e-05
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 5e-12
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 4e-05
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 6e-12
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 3e-04
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 6e-12
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 9e-12
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 1e-05
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 2e-11
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 0.004
d1vaea_111 b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T 5e-11
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 5e-11
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 8e-05
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 5e-11
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 2e-04
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 5e-11
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 8e-11
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 0.001
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-10
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 2e-10
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 3e-10
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 5e-06
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 7e-10
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 0.001
d1lcya1100 b.36.1.4 (A:226-325) Mitochondrial serine protease 2e-09
d1lcya1100 b.36.1.4 (A:226-325) Mitochondrial serine protease 0.001
d2z9ia188 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium 2e-09
d2z9ia188 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium 3e-05
d1r6ja_82 b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [Ta 1e-08
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 2e-08
d1ky9b288 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-t 4e-08
d2i6va187 b.36.1.5 (A:219-305) General secretion pathway pro 1e-07
d2i6va187 b.36.1.5 (A:219-305) General secretion pathway pro 7e-06
d1fc6a392 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal 3e-07
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 6e-07
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-05
d1k32a191 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Th 4e-04
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure

class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: KIAA1526 protein
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 82.7 bits (204), Expect = 8e-20
 Identities = 32/81 (39%), Positives = 50/81 (61%)

Query: 3   NGTLGFSIRGGREHTTGVFVSNVEPKSEAERSGLLIGDQIIRINGFPIEDATHSEVLQLI 62
             +LG +IRGG E+  G++++ V+P SEAE SGL +GDQI+ +NG    +  H E ++L+
Sbjct: 31  GRSLGLTIRGGAEYGLGIYITGVDPGSEAEGSGLKVGDQILEVNGRSFLNILHDEAVRLL 90

Query: 63  HSQNIISLKVRSVGMIPTKER 83
            S   + L V+ VG +P    
Sbjct: 91  KSSRHLILTVKDVGRLPHART 111
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 88 Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Length = 87 Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Length = 87 Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Length = 92 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 91 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query433
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.62
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.57
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.57
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.57
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.56
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.54
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.54
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.54
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.53
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.52
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.52
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.52
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.51
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.5
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.5
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.49
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.48
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.48
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.48
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 99.48
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.48
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.48
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.47
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.47
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 99.47
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.46
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 99.46
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.46
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 99.46
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.46
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.46
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.45
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.45
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.44
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.44
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.43
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 99.43
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.43
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.43
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.43
d1fc6a392 Photosystem II D1 C-terminal processing protease { 99.42
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 99.42
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 99.42
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.42
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.42
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.42
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 99.41
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.41
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.41
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.41
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.39
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.39
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 99.39
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.39
d1y7na179 Amyloid beta A4 precursor protein-binding family A 99.39
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.38
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.38
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.37
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.37
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.37
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.37
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.36
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 99.36
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.36
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.36
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.34
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.34
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.34
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.34
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.33
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 99.33
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.33
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.33
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.33
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.32
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 99.32
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.32
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.31
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.31
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.31
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 99.31
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.31
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 99.31
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 99.3
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.3
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.28
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.28
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.27
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.27
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.27
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 99.27
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.26
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.25
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 99.25
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 99.25
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.25
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 99.25
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.24
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.24
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.24
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.23
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.23
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.23
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.22
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 99.21
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.21
d1fc6a392 Photosystem II D1 C-terminal processing protease { 99.21
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.21
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.19
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 99.18
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.18
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.16
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.15
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 99.15
d1y7na179 Amyloid beta A4 precursor protein-binding family A 99.14
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.13
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 99.1
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 99.09
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 99.09
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 99.06
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.05
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 99.03
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.02
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.02
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 99.0
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 99.0
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 98.95
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.88
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.86
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.86
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.84
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 98.81
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.79
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.77
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 98.76
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 98.7
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 98.69
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.47
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Zasp (Cypher, Oracle 1)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.62  E-value=3.5e-16  Score=124.79  Aligned_cols=74  Identities=30%  Similarity=0.504  Sum_probs=69.4

Q ss_pred             CCeEeEEEEecCCCCCCeEEEEeCCCCHhHhCCCCCCCEEEEECCEecCCCCHHHHHHHhcC-CcEEEEEEEEcC
Q psy12296          3 NGTLGFSIRGGREHTTGVFVSNVEPKSEAERSGLLIGDQIIRINGFPIEDATHSEVLQLIHS-QNIISLKVRSVG   76 (433)
Q Consensus         3 ~~gLGfsI~gG~~~~~Gv~Vs~V~pgSpA~~aGL~~GD~ILaVNG~~V~~~s~~eav~lL~~-g~~V~L~V~R~g   76 (433)
                      +++|||+|.+|.+...++||..|.++|||+++||++||+|++|||+++.++++.+++.+|+. ++.|+|+|+|.+
T Consensus        10 ~~~~Gf~i~gg~~~~~~v~V~~v~~gs~A~~~~L~~GD~Il~VNg~~v~~~s~~ev~~~i~~~~~~v~L~V~R~~   84 (85)
T d1rgwa_          10 PGPWGFRLQGGKDFNMPLTISRITPGSKAAQSQLSQGDLVVAIDGVNTDTMTHLEAQNKIKSASYNLSLTLQKSK   84 (85)
T ss_dssp             SSCCCEEECCCGGGTSCCBEEEECTTSHHHHSSCCCCSBEEEETTEECTTCCHHHHHHHHTTCSSCEEEEEESCC
T ss_pred             CCCCCEEEEeecCCCCCEEEEEecCCChHHhCCCCCCCEEEEECCEECCCCCHHHHHHHHHcCCCEEEEEEEECC
Confidence            57899999999988889999999999999999999999999999999999999999999986 678999998865
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure