Psyllid ID: psy12348

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MAYFNSQWGFSNEAEYIAAQGPKADTVADFWTMGFSNEAEYIAAQGPKADTVADFWTMVLQHQVVKIVMLCSFVEKGRVKCEKYFPDRVNEYFVFNNIRVGCTEQEVGSHHTCTHLRITRDSEVLEVKHFHLHDWQDFSIPGGPDVLVNFCHLVRNSTPTSQLSVVHCRHLFTQLKEF
ccccccEEEEccccHHHccccccccEEcccccccccccccEEEccccccccccHHHHHHEEccccEEEEEcccEEccccccccccccccccEEEEEcEEEEEEEEEEcccEEEEEEEEEEccEEEEEEEEEcccccccccccccHHHHHHHHHHHHcccccccEEEEccccccccccc
ccccccEEEEEccccEEEcccccccEEEEEEccEccEEEEEEEEccccHHHHHHHHHHHHHccccEEEEccccEEccEEcccccccccEEEEEEEccEEEEEccccccccEEEEEEEEEccccEEEEEEEEEccccccccccccHHHHHHHHHHHHHccccccEEEEEcccccccccc
mayfnsqwgfsnEAEYIaaqgpkadtvaDFWTMGFSNEAEYIaaqgpkadtVADFWTMVLQHQVVKIVMLCSFVekgrvkcekyfpdrvneyfvfnnirvgcteqevgshhtcthlriTRDSEVLEVKHfhlhdwqdfsipggpdvLVNFCHlvrnstptsqlsvVHCRHLFTQLKEF
mayfnsqwGFSNEAEYIAAQGPKADTVADFWTMGFSNEAEYIAAQGPKADTVADFWTMVLQHQVVKIVMLCSFVEKGRVKCEKYFPDRVNEYFVFNNIRVGCTEQEVGSHHTCTHLRITRDSEVLEVKHFHLHDWQDFSIPGGPDVLVNFCHLVRNstptsqlsvvHCRHLFTQLKEF
MAYFNSQWGFSNEAEYIAAQGPKADTVADFWTMGFSNEAEYIAAQGPKADTVADFWTMVLQHQVVKIVMLCSFVEKGRVKCEKYFPDRVNEYFVFNNIRVGCTEQEVGSHHTCTHLRITRDSEVLEVKHFHLHDWQDFSIPGGPDVLVNFCHLVRNSTPTSQLSVVHCRHLFTQLKEF
***FNSQWGFSNEAEYIAAQGPKADTVADFWTMGFSNEAEYIAAQGPKADTVADFWTMVLQHQVVKIVMLCSFVEKGRVKCEKYFPDRVNEYFVFNNIRVGCTEQEVGSHHTCTHLRITRDSEVLEVKHFHLHDWQDFSIPGGPDVLVNFCHLVRNSTPTSQLSVVHCRHLFTQ****
MAYFNSQWGFSNEAEYIAAQGPKADTVADFWTMGFSNEAEYIAAQGPKADTVADFWTMVLQHQVVKIVMLCSFVEKGRVKCEKYFPDRVNEYFVFNNIRVGCTEQEVGSHHTCTHLRITRDSEVLEVKHFHLHDWQDFSIPGGPDVLVNFCHLVRNSTPTSQLSVVHCRHLFTQLKE*
MAYFNSQWGFSNEAEYIAAQGPKADTVADFWTMGFSNEAEYIAAQGPKADTVADFWTMVLQHQVVKIVMLCSFVEKGRVKCEKYFPDRVNEYFVFNNIRVGCTEQEVGSHHTCTHLRITRDSEVLEVKHFHLHDWQDFSIPGGPDVLVNFCHLVRNSTPTSQLSVVHCRHLFTQLKEF
MAYFNSQWGFSNEAEYIAAQGPKADTVADFWTMGFSNEAEYIAAQGPKADTVADFWTMVLQHQVVKIVMLCSFVEKGRVKCEKYFPDRVNEYFVFNNIRVGCTEQEVGSHHTCTHLRITRDSEVLEVKHFHLHDWQDFSIPGGPDVLVNFCHLVRNSTPTSQLSVVHCRHL*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAYFNSQWGFSNEAEYIAAQGPKADTVADFWTMGFSNEAEYIAAQGPKADTVADFWTMVLQHQVVKIVMLCSFVEKGRVKCEKYFPDRVNEYFVFNNIRVGCTEQEVGSHHTCTHLRITRDSEVLEVKHFHLHDWQDFSIPGGPDVLVNFCHLVRNSTPTSQLSVVHCRHLFTQLKEF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query178 2.2.26 [Sep-21-2011]
Q15262 1439 Receptor-type tyrosine-pr yes N/A 0.808 0.100 0.373 4e-20
P35822 1457 Receptor-type tyrosine-pr yes N/A 0.769 0.094 0.393 2e-19
Q9W6V51406 Receptor-type tyrosine-pr no N/A 0.741 0.093 0.340 2e-18
Q168271216 Receptor-type tyrosine-pr no N/A 0.808 0.118 0.351 2e-18
Q9BMN8 2200 Tyrosine-protein phosphat no N/A 0.898 0.072 0.323 5e-18
Q644551238 Receptor-type tyrosine-pr no N/A 0.747 0.107 0.35 8e-18
Q129131337 Receptor-type tyrosine-pr no N/A 0.741 0.098 0.354 1e-17
P28827 1452 Receptor-type tyrosine-pr no N/A 0.837 0.102 0.314 3e-17
Q9HD431115 Receptor-type tyrosine-pr no N/A 0.820 0.130 0.328 3e-17
B1AUH1 1446 Receptor-type tyrosine-pr no N/A 0.808 0.099 0.326 4e-17
>sp|Q15262|PTPRK_HUMAN Receptor-type tyrosine-protein phosphatase kappa OS=Homo sapiens GN=PTPRK PE=1 SV=2 Back     alignment and function desciption
 Score = 97.4 bits (241), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 78/150 (52%), Gaps = 6/150 (4%)

Query: 22   PKADTVADFWTMGFSNEAEYIAAQGPKADTVADFWTMVLQHQVVKIVMLCSFVEKGRVKC 81
            P +D +   +  G+   + YIA QGP  +TV DFW M+ Q Q   IVM+ + VE GRVKC
Sbjct: 936  PSSDYINANYIDGYQRPSHYIATQGPVHETVYDFWRMIWQEQSACIVMVTNLVEVGRVKC 995

Query: 82   EKYFPDRVNEYFVFNNIRVGCTEQEVGSHHTCTHLRITRD--SEVLEVKHFHLHDWQDFS 139
             KY+PD      V+ + +V C E E  + +      + R   +E+ EVK FH   W D  
Sbjct: 996  YKYWPDDTE---VYGDFKVTCVEMEPLAEYVVRTFTLERRGYNEIREVKQFHFTGWPDHG 1052

Query: 140  IPGGPDVLVNFCHLVRNSTPTSQLS-VVHC 168
            +P     L++F   V+ S P S    VVHC
Sbjct: 1053 VPYHATGLLSFIRRVKLSNPPSAGPIVVHC 1082
Regulation of processes involving cell contact and adhesion such as growth control, tumor invasion, and metastasis. Negative regulator of EGFR signaling pathway. Forms complexes with beta-catenin and gamma-catenin/plakoglobin. Beta-catenin may be a substrate for the catalytic activity of PTPRK/PTP-kappa.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8
>sp|P35822|PTPRK_MOUSE Receptor-type tyrosine-protein phosphatase kappa OS=Mus musculus GN=Ptprk PE=1 SV=1 Back     alignment and function description
>sp|Q9W6V5|PTPRJ_CHICK Receptor-type tyrosine-protein phosphatase eta OS=Gallus gallus GN=PTPRJ PE=2 SV=2 Back     alignment and function description
>sp|Q16827|PTPRO_HUMAN Receptor-type tyrosine-protein phosphatase O OS=Homo sapiens GN=PTPRO PE=1 SV=2 Back     alignment and function description
>sp|Q9BMN8|LAR_CAEEL Tyrosine-protein phosphatase Lar-like OS=Caenorhabditis elegans GN=ptp-3 PE=1 SV=1 Back     alignment and function description
>sp|Q64455|PTPRJ_MOUSE Receptor-type tyrosine-protein phosphatase eta OS=Mus musculus GN=Ptprj PE=1 SV=2 Back     alignment and function description
>sp|Q12913|PTPRJ_HUMAN Receptor-type tyrosine-protein phosphatase eta OS=Homo sapiens GN=PTPRJ PE=1 SV=3 Back     alignment and function description
>sp|P28827|PTPRM_HUMAN Receptor-type tyrosine-protein phosphatase mu OS=Homo sapiens GN=PTPRM PE=1 SV=2 Back     alignment and function description
>sp|Q9HD43|PTPRH_HUMAN Receptor-type tyrosine-protein phosphatase H OS=Homo sapiens GN=PTPRH PE=1 SV=3 Back     alignment and function description
>sp|B1AUH1|PTPRU_MOUSE Receptor-type tyrosine-protein phosphatase U OS=Mus musculus GN=Ptpru PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query178
156550925 1306 PREDICTED: hypothetical protein LOC10011 0.898 0.122 0.339 4e-23
340715383 2067 PREDICTED: receptor-type tyrosine-protei 0.915 0.078 0.333 9e-23
383862040 1156 PREDICTED: tyrosine-protein phosphatase 0.898 0.138 0.351 1e-22
307171753 1270 Receptor-type tyrosine-protein phosphata 0.898 0.125 0.333 1e-22
332025578 1288 Receptor-type tyrosine-protein phosphata 0.820 0.113 0.358 8e-22
307214971 1398 Phosphotidylinositol phosphatase PTPRQ [ 0.898 0.114 0.339 1e-21
340380969 1544 PREDICTED: receptor-type tyrosine-protei 0.741 0.085 0.404 4e-21
390358741 619 PREDICTED: receptor-type tyrosine-protei 0.848 0.243 0.372 7e-21
350414660 1274 PREDICTED: receptor-type tyrosine-protei 0.898 0.125 0.327 8e-21
242001776 434 receptor tyrosine phosphatase type r2b, 0.775 0.317 0.386 2e-20
>gi|156550925|ref|XP_001603077.1| PREDICTED: hypothetical protein LOC100119280 [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  113 bits (282), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 55/162 (33%), Positives = 84/162 (51%), Gaps = 2/162 (1%)

Query: 8    WGFSNEAEYIAAQGPKADTVADFWTMGFSNEAEYIAAQGPKADTVADFWTMVLQHQVVKI 67
            + FS     +    P  D +   +  G+S   EYIA QGPK DT  DFW M+ Q+ V  I
Sbjct: 923  YDFSRVKLEVIDNDPNTDYINASFIRGYSGNEEYIACQGPKEDTTYDFWRMIDQYDVKMI 982

Query: 68   VMLCSFVEKGRVKCEKYFPDRVNEYFVFNNIRVGCTEQEVGSHHTCTHLRITRDSEVLEV 127
            +ML   VEKG+ KC +Y+P  + E F +  + + CT +    + T   L + +D +   +
Sbjct: 983  LMLTQLVEKGKEKCHQYYPT-IRETFNYEKLSIRCTSELDYRNFTQRTLVLQKDDKRRTI 1041

Query: 128  KHFHLHDWQDFSIPGGPDVLVNFCHLVRNSTPTSQ-LSVVHC 168
             H H  DW D  +P   D +++FC + R    T + L+V+HC
Sbjct: 1042 THLHFKDWPDHDVPDDFDAMIHFCQIFRKQFSTVKGLAVIHC 1083

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|340715383|ref|XP_003396194.1| PREDICTED: receptor-type tyrosine-protein phosphatase delta-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|383862040|ref|XP_003706492.1| PREDICTED: tyrosine-protein phosphatase 10D-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307171753|gb|EFN63464.1| Receptor-type tyrosine-protein phosphatase beta [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332025578|gb|EGI65741.1| Receptor-type tyrosine-protein phosphatase beta [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307214971|gb|EFN89816.1| Phosphotidylinositol phosphatase PTPRQ [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|340380969|ref|XP_003388994.1| PREDICTED: receptor-type tyrosine-protein phosphatase delta-like [Amphimedon queenslandica] Back     alignment and taxonomy information
>gi|390358741|ref|XP_003729329.1| PREDICTED: receptor-type tyrosine-protein phosphatase kappa-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|350414660|ref|XP_003490381.1| PREDICTED: receptor-type tyrosine-protein phosphatase delta-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|242001776|ref|XP_002435531.1| receptor tyrosine phosphatase type r2b, putative [Ixodes scapularis] gi|215498867|gb|EEC08361.1| receptor tyrosine phosphatase type r2b, putative [Ixodes scapularis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query178
UNIPROTKB|F1M833 797 Ptpra "Receptor-type tyrosine- 0.814 0.181 0.305 9.5e-15
UNIPROTKB|F1NPE8 808 PTPRA "Uncharacterized protein 0.814 0.179 0.311 3.6e-15
UNIPROTKB|F1P3M5 809 PTPRA "Uncharacterized protein 0.814 0.179 0.311 3.6e-15
MGI|MGI:97808 829 Ptpra "protein tyrosine phosph 0.814 0.174 0.305 1e-14
UNIPROTKB|F1LQM5 831 Ptpra "Receptor-type tyrosine- 0.814 0.174 0.305 1e-14
UNIPROTKB|E2R5J7 793 PTPRA "Uncharacterized protein 0.814 0.182 0.311 7.4e-15
UNIPROTKB|J3KP22 658 PTPRA "Receptor-type tyrosine- 0.814 0.220 0.305 1.1e-14
UNIPROTKB|F1S8A4 799 PTPRA "Uncharacterized protein 0.814 0.181 0.311 7.5e-15
UNIPROTKB|P18433 802 PTPRA "Receptor-type tyrosine- 0.814 0.180 0.305 1.6e-14
UNIPROTKB|B7Z2A4 813 PTPRA "Receptor-type tyrosine- 0.814 0.178 0.305 1.6e-14
UNIPROTKB|F1M833 Ptpra "Receptor-type tyrosine-protein phosphatase alpha" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 199 (75.1 bits), Expect = 9.5e-15, P = 9.5e-15
 Identities = 47/154 (30%), Positives = 75/154 (48%)

Query:    22 PKADTVADFWTMGFSNEAEYIAAQGPKADTVADFWTMVLQHQVVKIVMLCSFVEKGRVKC 81
             P +D +   +  G+  + ++IAAQGPK +TV DFW M+ +     IVM+ +  E+   KC
Sbjct:   286 PDSDYINASFINGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKECKC 345

Query:    82 EKYFPDRVNEYFVFNNIRVGCTEQEVGSHHTCTHLRITRDSEVLEVK------HFHLHDW 135
              +Y+PD+    + + N+RV   +  V   +T     I +  +V   K       FH   W
Sbjct:   346 AQYWPDQ--GCWTYGNVRVSVEDVTVLVDYTVRKFCIQQVGDVTNRKPQRLITQFHFTSW 403

Query:   136 QDFSIPGGPDVLVNFCHLVRNSTPT-SQLSVVHC 168
              DF +P  P  ++ F   V+   P  +   VVHC
Sbjct:   404 PDFGVPFTPIGMLKFLKKVKACNPQYAGAIVVHC 437
GO:0004725 "protein tyrosine phosphatase activity" evidence=IEA
UNIPROTKB|F1NPE8 PTPRA "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P3M5 PTPRA "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:97808 Ptpra "protein tyrosine phosphatase, receptor type, A" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1LQM5 Ptpra "Receptor-type tyrosine-protein phosphatase alpha" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2R5J7 PTPRA "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J3KP22 PTPRA "Receptor-type tyrosine-protein phosphatase alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S8A4 PTPRA "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P18433 PTPRA "Receptor-type tyrosine-protein phosphatase alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B7Z2A4 PTPRA "Receptor-type tyrosine-protein phosphatase alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
smart00194259 smart00194, PTPc, Protein tyrosine phosphatase, ca 5e-44
pfam00102233 pfam00102, Y_phosphatase, Protein-tyrosine phospha 1e-41
cd00047231 cd00047, PTPc, Protein tyrosine phosphatases (PTP) 3e-41
PHA02738320 PHA02738, PHA02738, hypothetical protein; Provisio 8e-16
PHA02742303 PHA02742, PHA02742, protein tyrosine phosphatase; 1e-15
COG5599302 COG5599, PTP2, Protein tyrosine phosphatase [Signa 9e-15
PHA02747312 PHA02747, PHA02747, protein tyrosine phosphatase; 3e-12
PHA02746323 PHA02746, PHA02746, protein tyrosine phosphatase; 1e-10
smart00404105 smart00404, PTPc_motif, Protein tyrosine phosphata 2e-06
smart00012105 smart00012, PTPc_DSPc, Protein tyrosine phosphatas 2e-06
>gnl|CDD|214550 smart00194, PTPc, Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information 
 Score =  145 bits (369), Expect = 5e-44
 Identities = 54/142 (38%), Positives = 71/142 (50%), Gaps = 3/142 (2%)

Query: 31  WTMGFSNEAEYIAAQGPKADTVADFWTMVLQHQVVKIVMLCSFVEKGRVKCEKYFPDRVN 90
           +  G +    YIA QGP   TV DFW MV + +V  IVML   VEKGR KC +Y+PD   
Sbjct: 61  YIDGPNGPKAYIATQGPLPSTVEDFWRMVWEQKVTVIVMLTELVEKGREKCAQYWPDEEG 120

Query: 91  EYFVFNNIRVGCTEQEVGSHHTCTHLRITR--DSEVLEVKHFHLHDWQDFSIPGGPDVLV 148
           E   + +I V     E    +T   L +T    SE   V H+H  +W D  +P  P+ ++
Sbjct: 121 EPLTYGDITVTLKSVEKVDDYTIRTLEVTNTGCSETRTVTHYHYTNWPDHGVPESPESIL 180

Query: 149 NFCHLVRNSTPTSQLS-VVHCR 169
           +    VR S  TS    VVHC 
Sbjct: 181 DLIRAVRKSQSTSTGPIVVHCS 202

Length = 259
>gnl|CDD|215717 pfam00102, Y_phosphatase, Protein-tyrosine phosphatase Back     alignment and domain information
>gnl|CDD|238006 cd00047, PTPc, Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>gnl|CDD|222923 PHA02738, PHA02738, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|165109 PHA02742, PHA02742, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|227886 COG5599, PTP2, Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|165114 PHA02747, PHA02747, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165113 PHA02746, PHA02746, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|214649 smart00404, PTPc_motif, Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>gnl|CDD|214469 smart00012, PTPc_DSPc, Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 178
PHA02742303 protein tyrosine phosphatase; Provisional 100.0
PHA02740298 protein tyrosine phosphatase; Provisional 100.0
PHA02747312 protein tyrosine phosphatase; Provisional 100.0
PHA02738320 hypothetical protein; Provisional 100.0
PHA02746323 protein tyrosine phosphatase; Provisional 100.0
smart00194258 PTPc Protein tyrosine phosphatase, catalytic domai 100.0
cd00047231 PTPc Protein tyrosine phosphatases (PTP) catalyze 100.0
KOG4228|consensus 1087 100.0
KOG0790|consensus 600 100.0
KOG0792|consensus1144 100.0
KOG0791|consensus374 100.0
PF00102235 Y_phosphatase: Protein-tyrosine phosphatase; Inter 100.0
COG5599302 PTP2 Protein tyrosine phosphatase [Signal transduc 100.0
KOG0793|consensus1004 100.0
PRK15375535 pathogenicity island 1 effector protein StpP; Prov 100.0
KOG4228|consensus1087 100.0
KOG0789|consensus415 100.0
smart00404105 PTPc_motif Protein tyrosine phosphatase, catalytic 99.56
smart00012105 PTPc_DSPc Protein tyrosine phosphatase, catalytic 99.56
PTZ00242166 protein tyrosine phosphatase; Provisional 99.28
PTZ00393241 protein tyrosine phosphatase; Provisional 99.05
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr 98.63
KOG2836|consensus173 98.52
COG2453180 CDC14 Predicted protein-tyrosine phosphatase [Sign 98.12
KOG1720|consensus225 98.04
smart00195138 DSPc Dual specificity phosphatase, catalytic domai 98.04
PF05706168 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) 97.99
PF00782133 DSPc: Dual specificity phosphatase, catalytic doma 97.77
PF03162164 Y_phosphatase2: Tyrosine phosphatase family; Inter 97.56
PF14566149 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 97.17
PRK12361 547 hypothetical protein; Provisional 96.87
COG5350172 Predicted protein tyrosine phosphatase [General fu 96.73
KOG2283|consensus 434 96.62
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 96.4
KOG1718|consensus198 96.39
KOG1717|consensus343 95.99
PF13350164 Y_phosphatase3: Tyrosine phosphatase family; PDB: 95.91
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 95.64
KOG1716|consensus 285 95.45
KOG1719|consensus183 95.29
PLN02727 986 NAD kinase 95.21
COG2365249 Protein tyrosine/serine phosphatase [Signal transd 94.53
KOG4471|consensus 717 92.66
PHA02747312 protein tyrosine phosphatase; Provisional 92.5
PHA02742303 protein tyrosine phosphatase; Provisional 90.39
PHA02738320 hypothetical protein; Provisional 89.21
PHA02746323 protein tyrosine phosphatase; Provisional 89.03
PHA02740298 protein tyrosine phosphatase; Provisional 88.62
smart00194258 PTPc Protein tyrosine phosphatase, catalytic domai 85.0
KOG2386|consensus 393 84.94
cd00047231 PTPc Protein tyrosine phosphatases (PTP) catalyze 81.91
>PHA02742 protein tyrosine phosphatase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=4.9e-57  Score=349.63  Aligned_cols=171  Identities=22%  Similarity=0.420  Sum_probs=158.3

Q ss_pred             cCCCCcchhhhccCCCCcccccceeecccCCcceEEecCCCCCcHHHHhhHhhhCCccEEEEcccceeCCeecccccCCC
Q psy12348          8 WGFSNEAEYIAAQGPKADTVADFWTMGFSNEAEYIAAQGPKADTVADFWTMVLQHQVVKIVMLCSFVEKGRVKCEKYFPD   87 (178)
Q Consensus         8 ~~~~~~~~~~~~~~~~~dyinAs~i~g~~~~~~~I~~Q~P~~~t~~~FW~mv~~~~v~~IV~l~~~~e~~~~~~~~ywP~   87 (178)
                      .+|++.|+.|......+||||||||+|+..+++||+||+|+++|++|||+||||++|.+||||++..|.++.+|.+|||.
T Consensus        62 ~~~D~tRV~L~~~~~~~dYINAsyI~g~~~~~~fIatQ~Pl~~T~~dFW~MVw~~~~~vIVmLt~~~E~g~~kc~~YWp~  141 (303)
T PHA02742         62 PCFDRNRVILKIEDGGDDFINASYVDGHNAKGRFICTQAPLEETALDFWQAIFQDQVRVIVMITKIMEDGKEACYPYWMP  141 (303)
T ss_pred             CCCCCCEEEeCCCCCCCCcEEEeeecCCCCCCeEEEECCCCcccHHHHHHHHhhcCCCeEEEcchhhhCCeeeccccCCC
Confidence            48999988888777789999999999998889999999999999999999999999999999999999999999999998


Q ss_pred             CCCceEEEecEEEEEeEEEeccceeEEEEEEEeC--CceEEEEEEeccCccCCCCCCChhHHHHHHHHHHhhCC------
Q psy12348         88 RVNEYFVFNNIRVGCTEQEVGSHHTCTHLRITRD--SEVLEVKHFHLHDWQDFSIPGGPDVLVNFCHLVRNSTP------  159 (178)
Q Consensus        88 ~~~~~~~~g~~~V~~~~~~~~~~~~~r~l~l~~~--~~~~~v~~~~~~~W~~~~~p~~~~~l~~~i~~v~~~~~------  159 (178)
                      .++....+|+|+|++.++....++..+.|.|++.  +++|.|+||||++|||+++|.++..+++|+..|++.+.      
T Consensus       142 ~~~~~~~~g~~~V~~~~~~~~~~~~~~~l~l~~~~~~~~r~V~h~~y~~Wpd~gvP~~~~~~l~~i~~v~~~~~~~~~~~  221 (303)
T PHA02742        142 HERGKATHGEFKIKTKKIKSFRNYAVTNLCLTDTNTGASLDIKHFAYEDWPHGGLPRDPNKFLDFVLAVREADLKADVDI  221 (303)
T ss_pred             CCCCceEEEEEEEEEEEEEEcCCEEEEEEEEEECCCCceEEEEEEEECCCCCCCcCCCHHHHHHHHHHHHHHhhhccccc
Confidence            7677789999999999999889999999999983  58999999999999999999999999999999986431      


Q ss_pred             ------CCCcEEEEcCCCCCCcccC
Q psy12348        160 ------TSQLSVVHCRHLFTQLKEF  178 (178)
Q Consensus       160 ------~~~pivVhc~~G~gRsg~F  178 (178)
                            ..+|||||||+|+||||+|
T Consensus       222 ~~~~~~~~~PIvVHCsaGvGRTGtF  246 (303)
T PHA02742        222 KGENIVKEPPILVHCSAGLDRAGAF  246 (303)
T ss_pred             cccccCCCCCeEEECCCCCchhHHH
Confidence                  2489999999999999997

>PHA02740 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02747 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02738 hypothetical protein; Provisional Back     alignment and domain information
>PHA02746 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>smart00194 PTPc Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>KOG0790|consensus Back     alignment and domain information
>KOG0792|consensus Back     alignment and domain information
>KOG0791|consensus Back     alignment and domain information
>PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0793|consensus Back     alignment and domain information
>PRK15375 pathogenicity island 1 effector protein StpP; Provisional Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>KOG0789|consensus Back     alignment and domain information
>smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>PTZ00242 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PTZ00393 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>KOG2836|consensus Back     alignment and domain information
>COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1720|consensus Back     alignment and domain information
>smart00195 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species Back     alignment and domain information
>PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B Back     alignment and domain information
>PRK12361 hypothetical protein; Provisional Back     alignment and domain information
>COG5350 Predicted protein tyrosine phosphatase [General function prediction only] Back     alignment and domain information
>KOG2283|consensus Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>KOG1718|consensus Back     alignment and domain information
>KOG1717|consensus Back     alignment and domain information
>PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>KOG1716|consensus Back     alignment and domain information
>KOG1719|consensus Back     alignment and domain information
>PLN02727 NAD kinase Back     alignment and domain information
>COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4471|consensus Back     alignment and domain information
>PHA02747 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02742 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02738 hypothetical protein; Provisional Back     alignment and domain information
>PHA02746 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02740 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>smart00194 PTPc Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>KOG2386|consensus Back     alignment and domain information
>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
2c7s_A313 Crystal Structure Of Human Protein Tyrosine Phospha 3e-21
2g59_A297 Crystal Structure Of The Catalytic Domain Of Protei 1e-19
2gjt_A295 Crystal Structure Of The Human Receptor Phosphatase 1e-19
3i36_A342 Crystal Structure Of Rat Protein Tyrosine Phosphata 6e-19
1nwl_A298 Crystal Structure Of The Ptp1b Complexed With Sp734 2e-18
1rpm_A278 Human Receptor Protein Tyrosine Phosphatase Mu, Dom 2e-18
2nz6_A316 Crystal Structure Of The Ptprj Inactivating Mutant 5e-18
2fjm_A310 The Structure Of Phosphotyrosine Phosphatase 1b In 6e-18
1bzh_A298 Cyclic Peptide Inhibitor Of Human Ptp1b Length = 29 9e-18
1g7g_A298 Human Ptp1b Catalytic Domain Complexes With Pnu1793 9e-18
2cm2_A304 Structure Of Protein Tyrosine Phosphatase 1b (P2121 9e-18
2azr_A299 Crystal Structure Of Ptp1b With Bicyclic Thiophene 9e-18
1bzj_A297 Human Ptp1b Complexed With Tpicooh Length = 297 9e-18
2nt7_A299 Crystal Structure Of Ptp1b-inhibitor Complex Length 1e-17
4i8n_A354 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-17
3sme_A300 Structure Of Ptp1b Inactivated By H2o2BICARBONATE L 1e-17
1g7f_A298 Human Ptp1b Catalytic Domain Complexed With Pnu1774 1e-17
2f6f_A302 The Structure Of The S295f Mutant Of Human Ptp1b Le 1e-17
1bzc_A321 Human Ptp1b Catalytic Domain Complexed With Tpi Len 1e-17
2cma_A327 Structural Basis For Inhibition Of Protein Tyrosine 1e-17
1nl9_A321 Potent, Selective Protein Tyrosine Phosphatase 1b I 1e-17
3cwe_A290 Ptp1b In Complex With A Phosphonic Acid Inhibitor L 1e-17
1q6j_A310 The Structure Of Phosphotyrosine Phosphatase 1b In 1e-17
2ooq_A286 Crystal Structure Of The Human Receptor Phosphatase 1e-17
1lqf_A295 Structure Of Ptp1b In Complex With A Peptidic Bisph 1e-17
2cfv_A316 Crystal Structure Of Human Protein Tyrosine Phospha 2e-17
1c86_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 2e-17
1ecv_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 2e-17
1l8g_A321 Crystal Structure Of Ptp1b Complexed With 7-(1,1-di 2e-17
1gfy_A298 Residue 259 Is A Key Determinant Of Substrate Speci 2e-17
1g1f_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 8e-17
3zv2_A320 Human Protein-Tyrosine Phosphatase 1b C215a, S216a 8e-17
3s3e_A307 Crystal Structure Of The Catalytic Domain Of Ptp10d 9e-17
1een_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-16
1aax_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-16
1a5y_A 330 Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate 1e-16
1oeo_X321 Ptp1b With The Catalytic Cysteine Oxidized To Sulfo 1e-16
3eu0_A327 Crystal Structure Of The S-Nitrosylated Cys215 Of P 1e-16
3sr9_A 583 Crystal Structure Of Mouse Ptpsigma Length = 583 1e-16
1i57_A310 Crystal Structure Of Apo Human Ptp1b (C215s) Mutant 1e-16
1pa1_A310 Crystal Structure Of The C215d Mutant Of Protein Ty 1e-16
3a5k_A304 Crystal Structure Of Protein-Tyrosine Phosphatase 1 1e-16
3qkp_A321 Protein Tyrosine Phosphatase 1b - Apo W179f Mutant 2e-16
2pi7_A312 Structure Of The Catalytic Domain Of The Chick Reti 2e-16
1yfo_A302 Receptor Protein Tyrosine Phosphatase Alpha, Domain 2e-16
1ptu_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 2e-16
1ptv_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 2e-16
2pa5_A314 Crystal Structure Of Human Protein Tyrosine Phospha 3e-16
2fh7_A 595 Crystal Structure Of The Phosphatase Domains Of Hum 5e-16
1lar_A 575 Crystal Structure Of The Tandem Phosphatase Domains 1e-15
2ahs_A295 Crystal Structure Of The Catalytic Domain Of Human 1e-15
1l8k_A314 T Cell Protein-Tyrosine Phosphatase Structure Lengt 1e-15
2h02_A313 Structural Studies Of Protein Tyrosine Phosphatase 1e-15
2qcj_A313 Native Structure Of Lyp Length = 313 2e-15
2p6x_A309 Crystal Structure Of Human Tyrosine Phosphatase Ptp 3e-15
3h2x_A302 Crystal Structure Of The Human Lymphoid Tyrosine Ph 3e-15
3olr_A313 Ptpn22 In Complex With Consensus Phospho-Tyrosine P 3e-15
2h03_A291 Structural Studies Of Protein Tyrosine Phosphatase 4e-15
2jjd_A 599 Protein Tyrosine Phosphatase, Receptor Type, E Isof 6e-15
1p15_A253 Crystal Structure Of The D2 Domain Of Rptpa Length 2e-14
3brh_A310 Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To 3e-14
2nv5_A299 Crystal Structure Of A C-Terminal Phosphatase Domai 6e-14
3b7o_A316 Crystal Structure Of The Human Tyrosine Phosphatase 2e-12
2shp_A525 Tyrosine Phosphatase Shp-2 Length = 525 2e-12
3o5x_A276 Crystal Structure Of The Oncogenic Tyrosine Phospha 3e-12
2gp0_A309 Heptp Catalytic Domain (Residues 44-339), S225d Mut 4e-12
1wch_A315 Crystal Structure Of Ptpl1 Human Tyrosine Phosphata 4e-12
3o4s_A308 Crystal Structure Of Heptp With A Closed Wpd Loop A 6e-12
1zc0_A309 Crystal Structure Of Human Hematopoietic Tyrosine P 6e-12
2a3k_A296 Crystal Structure Of The Human Protein Tyrosine Pho 7e-12
2b49_A287 Crystal Structure Of The Catalytic Domain Of Protei 9e-12
2h4v_A320 Crystal Structure Of The Human Tyrosine Receptor Ph 1e-11
2nlk_A 627 Crystal Structure Of D1 And D2 Catalytic Domains Of 1e-11
2pbn_A313 Crystal Structure Of The Human Tyrosine Receptor Ph 1e-11
3qcb_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 1e-11
3qcl_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 2e-11
3qcm_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 2e-11
2hvl_A309 Crystal Structure Of The Heptp Catalytic Domain C27 2e-11
3d42_A308 Crystal Structure Of Heptp In Complex With A Monoph 3e-11
2qdc_A309 Crystal Structure Of The Heptp Catalytic Domain D23 5e-11
1ygr_A 610 Crystal Structure Of The Tandem Phosphatase Domain 6e-11
2qep_A304 Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2be 1e-10
2qdm_A309 Crystal Structure Of The Heptp Catalytic Domain C27 2e-10
2i75_A320 Crystal Structure Of Human Protein Tyrosine Phospha 3e-10
1jln_A297 Crystal Structure Of The Catalytic Domain Of Protei 5e-10
2oc3_A303 Crystal Structure Of The Catalytic Domain Of Human 7e-10
2hy3_A313 Crystal Structure Of The Human Tyrosine Receptor Ph 9e-10
2cjz_A305 Crystal Structure Of The C472s Mutant Of Human Prot 1e-09
2bij_A305 Crystal Structure Of The Human Protein Tyrosine Pho 1e-09
2bv5_A282 Crystal Structure Of The Human Protein Tyrosine Pho 1e-09
4gs0_A308 Crystal Structure Of Shp1 Catalytic Domain With Jak 1e-09
1gwz_A299 Crystal Structure Of The Catalytic Domain Of The Pr 1e-09
2b3o_A532 Crystal Structure Of Human Tyrosine Phosphatase Shp 2e-09
2a8b_A283 Crystal Structure Of The Catalytic Domain Of Human 2e-09
2i1y_A301 Crystal Structure Of The Phosphatase Domain Of Huma 2e-09
4gry_A288 Crystal Structure Of Shp1 Catalytic Domain With Jak 2e-08
1fpr_A284 Crystal Structure Of The Complex Formed Between The 2e-08
3ps5_A 595 Crystal Structure Of The Full-Length Human Protein 2e-08
4az1_A302 Crystal Structure Of The Trypanosoma Cruzi Protein 3e-07
3m4u_A306 Crystal Structure Of Trypanosoma Brucei Protein Tyr 7e-06
2bzl_A325 Crystal Structure Of The Human Protein Tyrosine Pho 4e-05
>pdb|2C7S|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Kappa At 1.95a Resolution Length = 313 Back     alignment and structure 
Iteration: 1

 Score = 97.8 bits (242), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 78/150 (52%), Gaps = 6/150 (4%)
Query: 22  PKADTVADFWTMGFSNEAEYIAAQGPKADTVADFWTMVLQHQVVKIVMLCSFVEKGRVKC 81
           P +D +   +  G+   + YIA QGP  +TV DFW M+ Q Q   IVM+ + VE GRVKC
Sbjct: 95  PSSDYINANYIDGYQRPSHYIATQGPVHETVYDFWRMIWQEQSACIVMVTNLVEVGRVKC 154
Query: 82  EKYFPDRVNEYFVFNNIRVGCTEQEVGSHHTCTHLRITRD--SEVLEVKHFHLHDWQDFS 139
            KY+PD      V+ + +V C E E  + +      + R   +E+ EVK FH   W D  
Sbjct: 155 YKYWPDDTE---VYGDFKVTCVEMEPLAEYVVRTFTLERRGYNEIREVKQFHFTGWPDHG 211
Query: 140 IPGGPDVLVNFCHLVRNSTPTSQLS-VVHC 168
           +P     L++F   V+ S P S    VVHC
Sbjct: 212 VPYHATGLLSFIRRVKLSNPPSAGPIVVHC 241
>pdb|2G59|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase From Homo Sapiens Length = 297 Back     alignment and structure
>pdb|2GJT|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptpro Length = 295 Back     alignment and structure
>pdb|3I36|A Chain A, Crystal Structure Of Rat Protein Tyrosine Phosphatase Eta Catalytic Domain Length = 342 Back     alignment and structure
>pdb|1NWL|A Chain A, Crystal Structure Of The Ptp1b Complexed With Sp7343-Sp7964, A Ptyr Mimetic Length = 298 Back     alignment and structure
>pdb|1RPM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Mu, Domain 1 Length = 278 Back     alignment and structure
>pdb|2NZ6|A Chain A, Crystal Structure Of The Ptprj Inactivating Mutant C1239s Length = 316 Back     alignment and structure
>pdb|2FJM|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 Back     alignment and structure
>pdb|1BZH|A Chain A, Cyclic Peptide Inhibitor Of Human Ptp1b Length = 298 Back     alignment and structure
>pdb|1G7G|A Chain A, Human Ptp1b Catalytic Domain Complexes With Pnu179326 Length = 298 Back     alignment and structure
>pdb|2CM2|A Chain A, Structure Of Protein Tyrosine Phosphatase 1b (P212121) Length = 304 Back     alignment and structure
>pdb|2AZR|A Chain A, Crystal Structure Of Ptp1b With Bicyclic Thiophene Inhibitor Length = 299 Back     alignment and structure
>pdb|1BZJ|A Chain A, Human Ptp1b Complexed With Tpicooh Length = 297 Back     alignment and structure
>pdb|2NT7|A Chain A, Crystal Structure Of Ptp1b-inhibitor Complex Length = 299 Back     alignment and structure
>pdb|4I8N|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b In Complex With An Inhibitor [(4-{(2s)-2-(1,3-Benzoxazol-2-Yl)-2-[(4-Fluorophenyl) Sulfamoyl]ethyl}phenyl)amino](Oxo)acetic Acid Length = 354 Back     alignment and structure
>pdb|3SME|A Chain A, Structure Of Ptp1b Inactivated By H2o2BICARBONATE Length = 300 Back     alignment and structure
>pdb|1G7F|A Chain A, Human Ptp1b Catalytic Domain Complexed With Pnu177496 Length = 298 Back     alignment and structure
>pdb|2F6F|A Chain A, The Structure Of The S295f Mutant Of Human Ptp1b Length = 302 Back     alignment and structure
>pdb|1BZC|A Chain A, Human Ptp1b Catalytic Domain Complexed With Tpi Length = 321 Back     alignment and structure
>pdb|2CMA|A Chain A, Structural Basis For Inhibition Of Protein Tyrosine Phosphatase 1b By Isothiazolidinone Heterocyclic Phosphonate Mimetics Length = 327 Back     alignment and structure
>pdb|1NL9|A Chain A, Potent, Selective Protein Tyrosine Phosphatase 1b Inhibitor Compound 12 Using A Linked-Fragment Strategy Length = 321 Back     alignment and structure
>pdb|3CWE|A Chain A, Ptp1b In Complex With A Phosphonic Acid Inhibitor Length = 290 Back     alignment and structure
>pdb|1Q6J|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 Back     alignment and structure
>pdb|2OOQ|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptprt Length = 286 Back     alignment and structure
>pdb|1LQF|A Chain A, Structure Of Ptp1b In Complex With A Peptidic Bisphosphonate Inhibitor Length = 295 Back     alignment and structure
>pdb|2CFV|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Receptor Type J Length = 316 Back     alignment and structure
>pdb|1C86|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b (R47v, D48n) Complexed With 2-(Oxalyl-Amino-4,7-Dihydro-5h- Thieno[2,3-C]pyran-3-Carboxylic Acid Length = 298 Back     alignment and structure
>pdb|1ECV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With 5-Iodo-2-(Oxalyl-Amino)-Benzoic Acid Length = 298 Back     alignment and structure
>pdb|1L8G|A Chain A, Crystal Structure Of Ptp1b Complexed With 7-(1,1-dioxo-1h- Benzo[d]isothiazol-3-yloxymethyl)-2-(oxalyl-amino)-4,7- Dihydro-5h-thieno[2,3-c]pyran-3-carboxylic Acid Length = 321 Back     alignment and structure
>pdb|1GFY|A Chain A, Residue 259 Is A Key Determinant Of Substrate Specificity Of Protein-Tyrosine Phosphatase 1b And Alpha Length = 298 Back     alignment and structure
>pdb|1G1F|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With A Tri-Phosphorylated Peptide (Rdi(Ptr) Etd(Ptr)(Ptr)rk) From The Insulin Receptor Kinase Length = 298 Back     alignment and structure
>pdb|3ZV2|A Chain A, Human Protein-Tyrosine Phosphatase 1b C215a, S216a Mutant Length = 320 Back     alignment and structure
>pdb|3S3E|A Chain A, Crystal Structure Of The Catalytic Domain Of Ptp10d From Drosophila Melanogaster Length = 307 Back     alignment and structure
>pdb|1EEN|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Acetyl-D-A-D-Bpa-Ptyr-L-I-P-Q-Q-G Length = 321 Back     alignment and structure
>pdb|1AAX|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Two Bis(Para-Phosphophenyl)methane (Bppm) Molecules Length = 321 Back     alignment and structure
>pdb|1A5Y|A Chain A, Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate Intermediate Length = 330 Back     alignment and structure
>pdb|1OEO|X Chain X, Ptp1b With The Catalytic Cysteine Oxidized To Sulfonic Acid Length = 321 Back     alignment and structure
>pdb|3EU0|A Chain A, Crystal Structure Of The S-Nitrosylated Cys215 Of Ptp1b Length = 327 Back     alignment and structure
>pdb|3SR9|A Chain A, Crystal Structure Of Mouse Ptpsigma Length = 583 Back     alignment and structure
>pdb|1I57|A Chain A, Crystal Structure Of Apo Human Ptp1b (C215s) Mutant Length = 310 Back     alignment and structure
>pdb|1PA1|A Chain A, Crystal Structure Of The C215d Mutant Of Protein Tyrosine Phosphatase 1b Length = 310 Back     alignment and structure
>pdb|3A5K|A Chain A, Crystal Structure Of Protein-Tyrosine Phosphatase 1b Length = 304 Back     alignment and structure
>pdb|3QKP|A Chain A, Protein Tyrosine Phosphatase 1b - Apo W179f Mutant With Open Wpd-Loop Length = 321 Back     alignment and structure
>pdb|2PI7|A Chain A, Structure Of The Catalytic Domain Of The Chick Retinal Neurite Inhibitor-Receptor Protein Tyrosine Phosphatase Cryp-2CPTPRO Length = 312 Back     alignment and structure
>pdb|1YFO|A Chain A, Receptor Protein Tyrosine Phosphatase Alpha, Domain 1 From Mouse Length = 302 Back     alignment and structure
>pdb|1PTU|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine-Containing Hexa-Peptide (Dadepyl-Nh2) Length = 321 Back     alignment and structure
>pdb|1PTV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine Length = 321 Back     alignment and structure
>pdb|2PA5|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Ptpn9 Length = 314 Back     alignment and structure
>pdb|2FH7|A Chain A, Crystal Structure Of The Phosphatase Domains Of Human Ptp Sigma Length = 595 Back     alignment and structure
>pdb|1LAR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domains Of Rptp Lar Length = 575 Back     alignment and structure
>pdb|2AHS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Receptor Phosphatase Beta Length = 295 Back     alignment and structure
>pdb|1L8K|A Chain A, T Cell Protein-Tyrosine Phosphatase Structure Length = 314 Back     alignment and structure
>pdb|2H02|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 313 Back     alignment and structure
>pdb|2QCJ|A Chain A, Native Structure Of Lyp Length = 313 Back     alignment and structure
>pdb|2P6X|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Ptpn22 Length = 309 Back     alignment and structure
>pdb|3H2X|A Chain A, Crystal Structure Of The Human Lymphoid Tyrosine Phosphatase Catalytic Domain Length = 302 Back     alignment and structure
>pdb|3OLR|A Chain A, Ptpn22 In Complex With Consensus Phospho-Tyrosine Peptide 1 Length = 313 Back     alignment and structure
>pdb|2H03|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 291 Back     alignment and structure
>pdb|2JJD|A Chain A, Protein Tyrosine Phosphatase, Receptor Type, E Isoform Length = 599 Back     alignment and structure
>pdb|1P15|A Chain A, Crystal Structure Of The D2 Domain Of Rptpa Length = 253 Back     alignment and structure
>pdb|3BRH|A Chain A, Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To The Mono-Phosphorylated Lck Active Site Peptide Length = 310 Back     alignment and structure
>pdb|2NV5|A Chain A, Crystal Structure Of A C-Terminal Phosphatase Domain Of Rattus Norvegicus Ortholog Of Human Protein Tyrosine Phosphatase, Receptor Type, D (Ptprd) Length = 299 Back     alignment and structure
>pdb|3B7O|A Chain A, Crystal Structure Of The Human Tyrosine Phosphatase Shp2 (Ptpn11) With An Accessible Active Site Length = 316 Back     alignment and structure
>pdb|2SHP|A Chain A, Tyrosine Phosphatase Shp-2 Length = 525 Back     alignment and structure
>pdb|3O5X|A Chain A, Crystal Structure Of The Oncogenic Tyrosine Phosphatase Shp2 Complexed With A Salicylic Acid-Based Small Molecule Inhibitor Length = 276 Back     alignment and structure
>pdb|2GP0|A Chain A, Heptp Catalytic Domain (Residues 44-339), S225d Mutant Length = 309 Back     alignment and structure
>pdb|1WCH|A Chain A, Crystal Structure Of Ptpl1 Human Tyrosine Phosphatase Mutated In Colorectal Cancer - Evidence For A Second Phosphotyrosine Substrate Recognition Pocket Length = 315 Back     alignment and structure
>pdb|3O4S|A Chain A, Crystal Structure Of Heptp With A Closed Wpd Loop And An Ordered E- Loop Length = 308 Back     alignment and structure
>pdb|1ZC0|A Chain A, Crystal Structure Of Human Hematopoietic Tyrosine Phosphatase (heptp) Catalytic Domain Length = 309 Back     alignment and structure
>pdb|2A3K|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase, Ptpn7 (Heptp, Hematopoietic Protein Tyrosine Phosphatase) Length = 296 Back     alignment and structure
>pdb|2B49|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase, Non-Receptor Type 3 Length = 287 Back     alignment and structure
>pdb|2H4V|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphatase Gamma Length = 320 Back     alignment and structure
>pdb|2NLK|A Chain A, Crystal Structure Of D1 And D2 Catalytic Domains Of Human Protein Tyrosine Phosphatase Gamma (D1+d2 Ptprg) Length = 627 Back     alignment and structure
>pdb|2PBN|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma Length = 313 Back     alignment and structure
>pdb|3QCB|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, Apo Length = 310 Back     alignment and structure
>pdb|3QCL|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-(4-Hydroxybut-1-Yn-1- Yl)benzoic Acid Length = 310 Back     alignment and structure
>pdb|3QCM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-{[3-({n-[2- (Methylamino)ethyl]glycyl}amino)phenyl]ethynyl}benzoic Acid Length = 310 Back     alignment and structure
>pdb|2HVL|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270s Mutant Length = 309 Back     alignment and structure
>pdb|3D42|A Chain A, Crystal Structure Of Heptp In Complex With A Monophosphorylated Erk2 Peptide Length = 308 Back     alignment and structure
>pdb|2QDC|A Chain A, Crystal Structure Of The Heptp Catalytic Domain D236a Mutant Length = 309 Back     alignment and structure
>pdb|1YGR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domain Of Rptp Cd45 Length = 610 Back     alignment and structure
>pdb|2QEP|A Chain A, Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2beta) Length = 304 Back     alignment and structure
>pdb|2QDM|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270sD236AQ314A Mutant Length = 309 Back     alignment and structure
>pdb|2I75|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase N4 (Ptpn4) Length = 320 Back     alignment and structure
>pdb|1JLN|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase Ptp-SlBR7 Length = 297 Back     alignment and structure
>pdb|2OC3|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Protein Tyrosine Phosphatase Non-Receptor Type 18 Length = 303 Back     alignment and structure
>pdb|2HY3|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma In Complex With Vanadate Length = 313 Back     alignment and structure
>pdb|2CJZ|A Chain A, Crystal Structure Of The C472s Mutant Of Human Protein Tyrosine Phosphatase Ptpn5 (Step, Striatum Enriched Phosphatase) In Complex With Phosphotyrosine Length = 305 Back     alignment and structure
>pdb|2BIJ|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase Ptpn5 (step, Striatum Enriched Enriched Phosphatase) Length = 305 Back     alignment and structure
>pdb|2BV5|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase Ptpn5 At 1.8a Resolution Length = 282 Back     alignment and structure
>pdb|4GS0|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 308 Back     alignment and structure
>pdb|1GWZ|A Chain A, Crystal Structure Of The Catalytic Domain Of The Protein Tyrosine Phosphatase Shp-1 Length = 299 Back     alignment and structure
>pdb|2B3O|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Shp-1 Length = 532 Back     alignment and structure
>pdb|2A8B|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Phosphatase Receptor, Type R Length = 283 Back     alignment and structure
>pdb|2I1Y|A Chain A, Crystal Structure Of The Phosphatase Domain Of Human Ptp Ia-2 Length = 301 Back     alignment and structure
>pdb|4GRY|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 288 Back     alignment and structure
>pdb|1FPR|A Chain A, Crystal Structure Of The Complex Formed Between The Catalytic Domain Of Shp-1 And An In Vitro Peptide Substrate Py469 Derived From Shps-1 Length = 284 Back     alignment and structure
>pdb|3PS5|A Chain A, Crystal Structure Of The Full-Length Human Protein Tyrosine Phosphatase Shp-1 Length = 595 Back     alignment and structure
>pdb|4AZ1|A Chain A, Crystal Structure Of The Trypanosoma Cruzi Protein Tyrosine Phosphatase Tcptp1, A Potential Therapeutic Target For Chagas' Disease Length = 302 Back     alignment and structure
>pdb|3M4U|A Chain A, Crystal Structure Of Trypanosoma Brucei Protein Tyrosine Phosphatase Tbptp1 Length = 306 Back     alignment and structure
>pdb|2BZL|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase N14 At 1.65 A Resolution Length = 325 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 2e-44
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 2e-44
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 8e-44
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 1e-43
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 2e-43
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 2e-43
2pa5_A314 Tyrosine-protein phosphatase non-receptor type 9; 3e-43
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 4e-43
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 6e-43
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 8e-43
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 3e-42
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 7e-42
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 8e-42
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 1e-41
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 2e-41
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 3e-41
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 1e-39
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 3e-41
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 6e-41
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 7e-41
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 8e-41
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 1e-40
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 2e-39
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 2e-40
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 2e-40
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 5e-40
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 6e-40
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 7e-40
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 6e-39
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 1e-39
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 7e-38
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 5e-34
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 8e-38
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 6e-37
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 7e-37
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 2e-33
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 2e-32
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Length = 287 Back     alignment and structure
 Score =  147 bits (374), Expect = 2e-44
 Identities = 38/142 (26%), Positives = 61/142 (42%), Gaps = 3/142 (2%)

Query: 29  DFWTMGFSNEAEYIAAQGPKADTVADFWTMVLQHQVVKIVMLCSFVEKGRVKCEKYFPDR 88
           +      +   +YIA QGP   T A FW +V   ++  IVML +  E+GR KC +Y+PD 
Sbjct: 76  NMEIPAANLVNKYIATQGPLPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDP 135

Query: 89  VNEYFVFNNIRVGCTEQEVGSHHTCTHLRITR--DSEVLEVKHFHLHDWQDFSIPGGPDV 146
             +        + C  ++    +    + +T     E   V H     W D  +P     
Sbjct: 136 -PDVMNHGGFHIQCQSEDCTIAYVSREMLVTNTQTGEEHTVTHLQYVAWPDHGVPDDSSD 194

Query: 147 LVNFCHLVRNSTPTSQLSVVHC 168
            + F + VR+    S+  +VHC
Sbjct: 195 FLEFVNYVRSLRVDSEPVLVHC 216
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Length = 309 Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Length = 307 Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Length = 314 Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Length = 253 Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 303 Back     alignment and structure
>2pa5_A Tyrosine-protein phosphatase non-receptor type 9; protein tyrosine phosphatase, MEG2, PTPN9, structural genomi structural genomics consortium, SGC; 1.60A {Homo sapiens} Length = 314 Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Length = 291 Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Length = 295 Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Length = 304 Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Length = 315 Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Length = 286 Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Length = 342 Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Length = 316 Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Length = 320 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Length = 297 Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Length = 306 Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Length = 284 Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Length = 302 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Length = 309 Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Length = 301 Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Length = 305 Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Length = 325 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Length = 320 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Length = 383 Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Length = 306 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query178
4ge6_A314 Tyrosine-protein phosphatase non-receptor type 9; 100.0
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 100.0
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 100.0
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 100.0
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 100.0
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 100.0
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 100.0
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 100.0
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 100.0
4grz_A288 Tyrosine-protein phosphatase non-receptor type 6; 100.0
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 100.0
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 100.0
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 100.0
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 100.0
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 100.0
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 100.0
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 100.0
4i8n_A354 Tyrosine-protein phosphatase non-receptor type 1; 100.0
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 100.0
4az1_A302 Tyrosine specific protein phosphatase; hydrolase, 100.0
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 100.0
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 100.0
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 100.0
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 100.0
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 100.0
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 100.0
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 100.0
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 100.0
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 100.0
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 100.0
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 100.0
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 100.0
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 100.0
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 100.0
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 100.0
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 100.0
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 100.0
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 100.0
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 100.0
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 100.0
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 99.93
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 99.8
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 99.77
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 99.39
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 99.04
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 98.67
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 98.66
2q05_A195 Late protein H1, dual specificity protein phosphat 98.66
1d5r_A 324 Phosphoinositide phosphotase PTEN; C2 domain, phos 98.63
3cm3_A176 Late protein H1, dual specificity protein phosphat 98.62
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 98.55
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 98.55
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 98.49
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 98.43
3n0a_A 361 Tyrosine-protein phosphatase auxilin; phosphatase- 98.43
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 98.38
3v0d_A 339 Voltage-sensor containing phosphatase; PTP, hydrol 98.34
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 98.24
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 98.23
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 98.23
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 98.2
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 98.12
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 98.12
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 98.1
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 98.1
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 98.08
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 98.07
2oud_A177 Dual specificity protein phosphatase 10; A central 98.03
2hcm_A164 Dual specificity protein phosphatase; structural g 98.02
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 97.99
1xri_A151 AT1G05000; structural genomics, protein structure 97.97
2hxp_A155 Dual specificity protein phosphatase 9; human phos 97.87
2g6z_A 211 Dual specificity protein phosphatase 5; alpha/beta 97.86
3emu_A161 Leucine rich repeat and phosphatase domain contain 97.77
3f41_A 629 Phytase; tandem repeat, protein tyrosine phosphata 97.69
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 97.68
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphata 97.66
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 97.62
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 97.59
3nme_A 294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 97.09
2f46_A156 Hypothetical protein; structural genomics, joint c 96.58
1ywf_A 296 Phosphotyrosine protein phosphatase PTPB; four str 95.79
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 89.68
4ge6_A314 Tyrosine-protein phosphatase non-receptor type 9; 89.37
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 89.02
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 88.7
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 88.68
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 88.56
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 88.42
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 87.16
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 86.91
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 86.78
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 86.43
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 86.04
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 85.99
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 85.23
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 84.28
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 84.26
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 83.93
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 83.76
4i8n_A354 Tyrosine-protein phosphatase non-receptor type 1; 83.74
4az1_A302 Tyrosine specific protein phosphatase; hydrolase, 83.13
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 82.9
4grz_A288 Tyrosine-protein phosphatase non-receptor type 6; 82.5
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 82.17
>4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* Back     alignment and structure
Probab=100.00  E-value=9.4e-59  Score=360.24  Aligned_cols=175  Identities=27%  Similarity=0.496  Sum_probs=160.3

Q ss_pred             eccccCCCCcchhhhcc--CCCCcccccceeecccCCcceEEecCCCCCcHHHHhhHhhhCCccEEEEcccceeCCeecc
Q psy12348          4 FNSQWGFSNEAEYIAAQ--GPKADTVADFWTMGFSNEAEYIAAQGPKADTVADFWTMVLQHQVVKIVMLCSFVEKGRVKC   81 (178)
Q Consensus         4 ~n~~~~~~~~~~~~~~~--~~~~dyinAs~i~g~~~~~~~I~~Q~P~~~t~~~FW~mv~~~~v~~IV~l~~~~e~~~~~~   81 (178)
                      |....+|++.|+.|...  .+++||||||||+|+..+++||+||+|+++|++|||+||||+++.+||||+...|.++.+|
T Consensus        58 y~dI~pyD~tRV~L~~~~~~~~sdYINAs~I~g~~~~~~yIaTQgPl~~T~~dFW~MVwe~~~~~IVmLt~~~E~g~~kC  137 (314)
T 4ge6_A           58 YGDVPCLDQTRVKLTKRSGHTQTDYINASFMDGYKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTRFEEGGRRKC  137 (314)
T ss_dssp             CTTCCCCTTTBCCCCCCSSSCCCSCCSEEEEEETTEEEEEEEECCCCGGGHHHHHHHHHHTTCCEEEECSCSEETTEECC
T ss_pred             CCCcCCCcCcEEEccCCCCCCCCceEEeecccCCCCCCeEEEECCCcHHHHHHHHHHHHhcCCceEEEcccccccceecc
Confidence            33446999998888753  3578999999999999889999999999999999999999999999999999999999999


Q ss_pred             cccCCCCCCceEEEecEEEEEeEEEeccceeEEEEEEEeC--CceEEEEEEeccCccCCCCCCChhHHHHHHHHHHhhCC
Q psy12348         82 EKYFPDRVNEYFVFNNIRVGCTEQEVGSHHTCTHLRITRD--SEVLEVKHFHLHDWQDFSIPGGPDVLVNFCHLVRNSTP  159 (178)
Q Consensus        82 ~~ywP~~~~~~~~~g~~~V~~~~~~~~~~~~~r~l~l~~~--~~~~~v~~~~~~~W~~~~~p~~~~~l~~~i~~v~~~~~  159 (178)
                      .+|||.+.++.+.+|.++|++.++....+++.|.|.+...  ++.|.|+||||++|||+++|.++..+++|++.|++.+.
T Consensus       138 ~~YwP~~~~~~~~~g~~~V~~~~~~~~~~~~~r~l~~~~~~~~~~r~V~h~~y~~WPd~gvP~~~~~ll~~i~~v~~~~~  217 (314)
T 4ge6_A          138 GQYWPLEKDSRIRFGFLTVTNLGVENMNHYKKTTLEIHNTEERQKRQVTHFQFLSWPDYGVPSSAASLIDFLRVVRNQQS  217 (314)
T ss_dssp             CCCSCCSTTCEEEETTEEEEEEEEEECSSEEEEEEEEEETTTTEEEEEEEEEECCSCSSSCCSCSHHHHHHHHHHHHHHH
T ss_pred             cccCcCCCCCceecccEEEEEEEEEEcCCceEEEEeeecccCCcceEEEEEEeCCCCCCCCCCCHHHHHHHHHHHHHHHh
Confidence            9999998788889999999999999999999999999984  38999999999999999999999999999999986431


Q ss_pred             --------------CCCcEEEEcCCCCCCcccC
Q psy12348        160 --------------TSQLSVVHCRHLFTQLKEF  178 (178)
Q Consensus       160 --------------~~~pivVhc~~G~gRsg~F  178 (178)
                                    ..+|||||||||+||||+|
T Consensus       218 ~~~~~~~~~~~~~~~~~PivVHCSaGvGRTGtf  250 (314)
T 4ge6_A          218 LAVSNMGARSKGQCPEPPIVVHCSAGIGRTGTF  250 (314)
T ss_dssp             HHHHHSCCC----CCSCCEEEECSSSSHHHHHH
T ss_pred             hhhccccccccccCCCCCEEEECCCCCcHHHHH
Confidence                          4689999999999999997
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Back     alignment and structure
>4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Back     alignment and structure
>4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Back     alignment and structure
>4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Back     alignment and structure
>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Back     alignment and structure
>3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Back     alignment and structure
>4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Back     alignment and structure
>4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} Back     alignment and structure
>4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Back     alignment and structure
>4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 178
d1g4us2243 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, ca 4e-31
d1lara1317 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapie 7e-27
d2f71a1297 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Ho 2e-26
d1rpma_278 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 1e-25
d1l8ka_273 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 2e-23
d1p15a_245 c.45.1.2 (A:) Protein-tyrosine phosphatase alpha { 3e-23
d2shpa1307 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human ( 3e-23
d1yfoa_288 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 9e-23
d1fpra_284 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 9e-22
d1jlna_297 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 1e-21
d1lyva_283 c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, c 1e-21
d1lara2249 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapie 3e-21
d1wcha_308 c.45.1.2 (A:) Tyrosine-protein phosphatase, non-re 2e-18
d2pt0a1313 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho 5e-09
d1rxda_152 c.45.1.1 (A:) Protein tyrosine phosphatase type IV 2e-04
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Length = 243 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Higher-molecular-weight phosphotyrosine protein phosphatases
domain: SptP tyrosine phosphatase, catalytic domain
species: Salmonella typhimurium [TaxId: 90371]

 Score =  110 bits (276), Expect = 4e-31
 Identities = 24/147 (16%), Positives = 50/147 (34%), Gaps = 12/147 (8%)

Query: 35  FSNEAEYIAAQGPK--ADTVADFWTMVLQHQVVKIVMLCSFVEKGRVKCEKYFPDRVNEY 92
           F  +   +A   PK   D +     M+L+ +   +V+L S  +    +   YF      +
Sbjct: 42  FDGKPVALAGSYPKNTPDALEAHMKMLLEKECSCLVVLTSEDQMQAKQLPPYFRGS-YTF 100

Query: 93  FVFNNIRVGCTEQEVGSHHTCTHLRITRDSEVLEVKHFHLHDWQDFSIPGGPDVLVNFCH 152
              +      +    G      +++++   +   +   H+ +W D       D L     
Sbjct: 101 GEVHTNSQKVSSASQGEAIDQYNMQLSCGEKRYTIPVLHVKNWPDHQPLPSTDQLEYLAD 160

Query: 153 LVRNS---------TPTSQLSVVHCRH 170
            V+NS         +    L ++HC  
Sbjct: 161 RVKNSNQNGAPGRSSSDKHLPMIHCLG 187
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Length = 278 Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 245 Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Length = 307 Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Length = 288 Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Length = 297 Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Length = 283 Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 249 Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query178
d1p15a_245 Protein-tyrosine phosphatase alpha {Mouse (Mus mus 100.0
d2shpa1307 Tyrosine phosphatase {Human (Homo sapiens), shp-2 100.0
d2f71a1297 Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta 100.0
d1lara1317 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1l8ka_273 Tyrosine phosphatase {Human (Homo sapiens), T-cell 100.0
d1wcha_308 Tyrosine-protein phosphatase, non-receptor type 13 100.0
d1jlna_297 Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl 100.0
d1fpra_284 Tyrosine phosphatase {Human (Homo sapiens), shp-1 100.0
d1lara2249 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1yfoa_288 Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 100.0
d1rpma_278 Tyrosine phosphatase {Human (Homo sapiens), mu [Ta 100.0
d1g4us2243 SptP tyrosine phosphatase, catalytic domain {Salmo 100.0
d1lyva_283 Protein-tyrosine phosphatase YopH, catalytic domai 100.0
d1rxda_152 Protein tyrosine phosphatase type IVa {Human (Homo 99.8
d2pt0a1313 Myo-inositol hexaphosphate phosphohydrolase (phyta 99.55
d1ohea2182 Proline directed phosphatase CDC14b2 {Human (Homo 99.21
d1d5ra2174 Phoshphoinositide phosphatase Pten (Pten tumor sup 98.88
d1fpza_176 Kinase associated phosphatase (kap) {Human (Homo s 98.77
d1i9sa_194 mRNA capping enzyme, triphosphatase domain {Mouse 98.47
d1m3ga_145 Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax 97.95
d1mkpa_144 Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp 97.95
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 97.79
d1vhra_178 VH1-related dual-specificity phosphatase, VHR {Hum 97.72
d1ywfa1 272 Phosphotyrosine protein phosphatase PtpB {Mycobact 93.31
d1p15a_245 Protein-tyrosine phosphatase alpha {Mouse (Mus mus 87.06
d1lara2249 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 84.77
d2f71a1297 Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta 83.11
d1yfoa_288 Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 83.04
d1l8ka_273 Tyrosine phosphatase {Human (Homo sapiens), T-cell 82.73
d1zsqa2 387 Myotubularin-related protein 2, C-terminal domain 82.44
d1lara1317 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 82.34
d1jlna_297 Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl 81.28
d1fpra_284 Tyrosine phosphatase {Human (Homo sapiens), shp-1 80.53
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Higher-molecular-weight phosphotyrosine protein phosphatases
domain: Protein-tyrosine phosphatase alpha
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=1.1e-54  Score=325.91  Aligned_cols=170  Identities=25%  Similarity=0.498  Sum_probs=156.5

Q ss_pred             ccCCCCcchhhhccC--CCCcccccceeecccCCcceEEecCCCCCcHHHHhhHhhhCCccEEEEcccceeCCeeccccc
Q psy12348          7 QWGFSNEAEYIAAQG--PKADTVADFWTMGFSNEAEYIAAQGPKADTVADFWTMVLQHQVVKIVMLCSFVEKGRVKCEKY   84 (178)
Q Consensus         7 ~~~~~~~~~~~~~~~--~~~dyinAs~i~g~~~~~~~I~~Q~P~~~t~~~FW~mv~~~~v~~IV~l~~~~e~~~~~~~~y   84 (178)
                      ..+|++.|+.|....  +.+||||||||+|+..+++||+||+|+++|++|||+||||+++++||||++..|.++.+|.+|
T Consensus        18 i~p~D~sRV~L~~~~~~~~~dYINAs~V~g~~~~~~yI~tQ~P~~~T~~dFW~Mv~~~~~~~IVmL~~~~e~~~~~~~~y   97 (245)
T d1p15a_          18 IIPYEFNRVIIPVKRGEENTDYVNASFIDGYRQKDSYIASQGPLLHTIEDFWRMIWEWKSCSIVMLTELEERGQEKCAQY   97 (245)
T ss_dssp             CCCCTTSBCCCCCCSSSSSTTCCSEEEECCSSCTTCEEEECCCCSSSHHHHHHHHHHTTCCEEEECSCSCSSSSCCSCCC
T ss_pred             CCCCcCCEEEecCCCCCCCCceEEEEeecCCCCCCeeEEECCCCccchhhHhhheecCCCCEEEEEeccccCCCcccccc
Confidence            459999888887543  468999999999999889999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCceEEEecEEEEEeEEEeccceeEEEEEEEeC--CceEEEEEEeccCccCCCCCCChhHHHHHHHHHHhhCC--C
Q psy12348         85 FPDRVNEYFVFNNIRVGCTEQEVGSHHTCTHLRITRD--SEVLEVKHFHLHDWQDFSIPGGPDVLVNFCHLVRNSTP--T  160 (178)
Q Consensus        85 wP~~~~~~~~~g~~~V~~~~~~~~~~~~~r~l~l~~~--~~~~~v~~~~~~~W~~~~~p~~~~~l~~~i~~v~~~~~--~  160 (178)
                      ||.+ + ...+|+++|++.++....+++.|++.|...  +++|.|+||||++||++++|.++..+++|+..+++...  .
T Consensus        98 ~p~~-~-~~~~~~~~v~~~~~~~~~~~~~r~l~l~~~~~~~~~~v~~~~y~~Wpd~~~P~~~~~~l~~~~~v~~~~~~~~  175 (245)
T d1p15a_          98 WPSD-G-LVSYGDITVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGMINIIAAVQKQQQQSG  175 (245)
T ss_dssp             SCSS-S-CCEETTEECCSCCCEECSSEEEEEEEEECSSCCEEEEEEEEEECCSCSSSCCSSSCSHHHHHHHHHHHTTTTT
T ss_pred             cCCC-C-ceEeccEEEEEEEEEEcCCceEEEEEEEECCCCceEEEEEEEecCCCccCCCCCHHHHHHHHHHHHhhhccCC
Confidence            9986 3 558999999999999999999999999874  48999999999999999999999999999999988765  6


Q ss_pred             CCcEEEEcCCCCCCcccC
Q psy12348        161 SQLSVVHCRHLFTQLKEF  178 (178)
Q Consensus       161 ~~pivVhc~~G~gRsg~F  178 (178)
                      .+||||||++|+||||+|
T Consensus       176 ~~PivVHCs~G~gRsg~f  193 (245)
T d1p15a_         176 NHPITVHCSAGAGRTGTF  193 (245)
T ss_dssp             SCCEEEESSSSSHHHHHH
T ss_pred             CCCEEEEcCCCCccccHH
Confidence            689999999999999997
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Back     information, alignment and structure
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Back     information, alignment and structure
>d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Back     information, alignment and structure