Psyllid ID: psy12425


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-
MPNALYIPEGDNTKVKIFYAGDQPMEVSLTKNGRVVQSDDRFKFTVLDDYIIIFIKEIRKEDAGDYTVNLSNSSGSVSGTFTINITGLPGPPIGPLDVSEITKHTCTLHWNPPKYDGGLKVTHYVVERRDISMPHWICISTTCHDTTFIVQGLTEGQEYLFHVMAVNENGMGPPLEGINPIKAKSPYDKPSPPGIPVVTQVGGDFVNLSWDKPLDDGGSRIQGYWIDKHEVGSDAWQRVNVAICAPSQINIPNLIEGRQYEFRVYAQNEAGLSLPSSASNSVQIKDPMAAKAPEIIVPLRNANAIQNHNAQFQCTITGCPKPTISWLKGSREITPSARHHIFAEGDTYTLIINSVYGVDADEYVCRAVNKGGVKSTKAELIIMTAPKFNVPPRFRDTAYFDKGENVVVKIPFTGYPKPKITWYRDNEVIESGGHFHVETSERHAILTIRDASNVDTAPYRVVAENDLGMDSAIVKIQISDRPDPPQFPTVEDIGHDSLALVWRAPIWDGGSNITNYIVEKREHPMSSWIRVGNTRFTTMAITGLSPGHQYEFRVYAENVYGRSDPSTTSDLITTYGELLSGMEAPISLITL
ccccEEEcccccEEEEEEEEEccccEEEEEEccEEEcccccEEEEEEccEEEEEEccccccccEEEEEEEEcccEEEEEEEEEEEEcccccccccEEEEEEccccEEEEEEcccccccccEEEEEEEEEEcccccEEEEEEEccccEEEEcccccccEEEEEEEEEccccccccccccccEEccccccccccccccEEEEEEccEEEEEEEcccccccccccEEEEEEEEcccccEEEEEEEEccccEEEEcccccccEEEEEEEEEEcccccccccccccEEEccccccccccEEEcccccEEEEccEEEEEEEEEEEEccEEEEEEccccccccccEEEEEEccEEEEEEccccccccEEEEEEEEccccccccEEEEEEEEcccccccccccccEEEEcccEEEEEEEEEEccccEEEEEEccEEEcccccEEEEEEccEEEEEEccccccccEEEEEEEEEccccEEEEEEEEEEcccccccccEEEEEEccEEEEEEEccccccccccccEEEEEEEcccccEEEEccEEEEEEEEcccccccEEEEEEEEEccccccccccccccEEEccccccccccccEEEEc
ccccEEEEcccEEEEEEEEEcccccEEEEEEccEEEccccEEEEEEcccEEEEEEEccEccccEEEEEEEEEcccccccEEEEEEcccccccccccEEEEEEccEEEEEEEcccccccccEEEEEEEcEEcccccEEEEEEcccEEEEEEEcccccccEEEEEEEEEcccccccccccEEEEccccccccccccccEEEEEEcccEEEEEEcccccccccEEEEEEEEEccccccEEEEEEEcccEEEEEEEccccccEEEEEEEEEEcccccccccccccEEccccccccccccccccccEEEEccccEEEEEccccccccEEEEEEccEEEccccEEEEEEcccEEEEEEEcccccccEEEEEEEEEccccccccEEEEEEccccccccccccccEEEEcccEEEEEEEcccccccEEEEEEccEEEccccEEEEEEcccEEEEEEEcccccccEEEEEEEEEcccccccEEEEEEEcccccccccEEEEEcccEEEEEEEcccccccccEEEEEEEEEcccccEEEEEEcccEEEEEEEccccccEEEEEEEEEEcccccccccccccEEccccccccccccccEEEc
mpnalyipegdntkvkifyagdqpmevsltkngrvvqsddrfkftvlDDYIIIFIKEIrkedagdytvnlsnssgsvsgtftinitglpgppigpldvseitkhtctlhwnppkydgglkvTHYVVErrdismphwicisttchdTTFIVQGLTEGQEYLFHVMAVnengmgppleginpikakspydkpsppgipvvtqvggdfvnlswdkplddggsriqgywidkhevgsdaWQRVNVAicapsqinipnliegrQYEFRVYAQneaglslpssasnsvqikdpmaakapeiiVPLRNANAIQNHNAQfqctitgcpkptiswlkgsreitpsarhhifaegdTYTLIINSvygvdadeyVCRAvnkggvkstkAELIIMtapkfnvpprfrdtayfdkgenvvvkipftgypkpkitwyrdneviesgghfhvetSERHAILTIrdasnvdtapyrvvaendlgmdSAIVKIQisdrpdppqfptvedighdSLALVWrapiwdggsnitNYIVEKrehpmsswirvgntrfttmaitglspghqyEFRVYAEnvygrsdpsttsDLITTYGELlsgmeapislitl
mpnalyipegdnTKVKIFYAGDQpmevsltkngrvvqsddrfkftvldDYIIIFIKEIRKEDAGDYTVNLSNSSGSVSGTFTINITGLPGPPIGPLDVSEITKHTCTlhwnppkydggLKVTHYVVERRDISMPHWICISTTCHDTTFIVQGLTEGQEYLFHVMAVNENGMGPPLEGINPIKAKSPYDKPSPPGIPVVTQVGGDFVNLSWDKPLDDGGSRIQGYWIDKHEVGSDAWQRVNVAICAPSQINIPNLIEGRQYEFRVYAQNEAGLSLPSSASNSVQIKDPMAAKAPEIIVPLRNANAIQNHNAQFQCTITGCPKPTISWLKGSREITPSARHHIFAEGDTYTLIINSVYGVDADEYVCRAVNkggvkstkaeliimtapkfnvpprfrdtayfdkgenvvvkipftgypkpkiTWYRDNEVIESGGHFHVETSERHAILtirdasnvdtAPYRVVAENDLGMDSAIVKIQISDRPDPPQFPTVEDIGHDSLALVWRAPIWDGGSNITNYIVEKREHPMSSWIRVGNTRFTTMAITGLSPGHQYEFRVYAENvygrsdpsttSDLITTYGellsgmeapislitl
MPNALYIPEGDNTKVKIFYAGDQPMEVSLTKNGRVVQSDDRFKFTVLDDYIIIFIKEIRKEDAGDYtvnlsnssgsvsgtFtinitglpgppigplDVSEITKHTCTLHWNPPKYDGGLKVTHYVVERRDISMPHWICISTTCHDTTFIVQGLTEGQEYLFHVMAVNENGMGPPLEGINPIKAKSPYDKPSPPGIPVVTQVGGDFVNLSWDKPLDDGGSRIQGYWIDKHEVGSDAWQRVNVAICAPSQINIPNLIEGRQYEFRVYAQNEAGLSLPSSASNSVQIKDPMAAKAPEIIVPLRNANAIQNHNAQFQCTITGCPKPTISWLKGSREITPSARHHIFAEGDTYTLIINSVYGVDADEYVCRAVNKGGVKSTKAELIIMTAPKFNVPPRFRDTAYFDKGENVVVKIPFTGYPKPKITWYRDNEVIESGGHFHVETSERHAILTIRDASNVDTAPYRVVAENDLGMDSAIVKIQISDRPDPPQFPTVEDIGHDSLALVWRAPIWDGGSNITNYIVEKREHPMSSWIRVGNTRFTTMAITGLSPGHQYEFRVYAENVYGRSDPSTTSDLITTYGELLSGMEAPISLITL
******I***DNTKVKIFYAGDQPMEVSLTKNGRVVQSDDRFKFTVLDDYIIIFIKEIRKEDAGDYTVNLSNSSGSVSGTFTINITGLPGPPIGPLDVSEITKHTCTLHWNPPKYDGGLKVTHYVVERRDISMPHWICISTTCHDTTFIVQGLTEGQEYLFHVMAVNEN*************************IPVVTQVGGDFVNLSWDKPLDDGGSRIQGYWIDKHEVGSDAWQRVNVAICAPSQINIPNLIEGRQYEFRVYAQN************************PEIIVPLRNANAIQNHNAQFQCTITGCPKPTISWLKGSREITPSARHHIFAEGDTYTLIINSVYGVDADEYVCRAVNKGGVKSTKAELIIMTAPKFNVPPRFRDTAYFDKGENVVVKIPFTGYPKPKITWYRDNEVIESGGHFHVETSERHAILTIRDASNVDTAPYRVVAENDLGMDSAIVKIQI********FPTVEDIGHDSLALVWRAPIWDGGSNITNYIVEKREHPMSSWIRVGNTRFTTMAITGLSPGHQYEFRVYAENVYGRS****TSDLITTYGELLS***********
MPNALYIPEGDNTKVKIFYAGDQPMEVSLTKNGRVVQSDDRFKFTVLDDYIIIFIKEIRKEDAGDYTVNLSNSSGSVSGTFTINITGLPGPPIGPLDVSEITKHTCTLHWNPPKYDGGLKVTHYVVERRDISMPHWICISTTCHDTTFIVQGLTEGQEYLFHVMAVNENGMGPPLEGINPIKAKSPYDKPSPPGIPVVTQVGGDFVNLSWDKPLDDGGSRIQGYWIDKHEVGSDAWQRVNVAICAPSQINIPNLIEGRQYEFRVYAQNEAGLSLPSSASN*VQI****AAKAPEIIVPLRNANAIQNHNAQFQCTITGCPKPTISWLKGSREITPSARHHIFAEGDTYTLIINSVYGVDADEYVCRAVNKGGVKSTKAELIIMTAPKFNVPPRFRDTAYFDKGENVVVKIPFTGYPKPKITWYRDNEVIESGGHFHVETSERHAILTIRDASNVDTAPYRVVAENDLGMDSAIVKIQISDRPDPPQFPTVEDIGHDSLALVWRAPIWDGGSNITNYIVEKREHPMSSWIRVGNTRFTTMAITGLSPGHQYEFRVYAENVYGRSDPSTTSDLIT****************TL
MPNALYIPEGDNTKVKIFYAGDQPMEVSLTKNGRVVQSDDRFKFTVLDDYIIIFIKEIRKEDAGDYTVNLSNSSGSVSGTFTINITGLPGPPIGPLDVSEITKHTCTLHWNPPKYDGGLKVTHYVVERRDISMPHWICISTTCHDTTFIVQGLTEGQEYLFHVMAVNENGMGPPLEGINPIKAKSPYDKPSPPGIPVVTQVGGDFVNLSWDKPLDDGGSRIQGYWIDKHEVGSDAWQRVNVAICAPSQINIPNLIEGRQYEFRVYAQNEAGLSLPSSASNSVQIKDPMAAKAPEIIVPLRNANAIQNHNAQFQCTITGCPKPTISWLKGSREITPSARHHIFAEGDTYTLIINSVYGVDADEYVCRAVNKGGVKSTKAELIIMTAPKFNVPPRFRDTAYFDKGENVVVKIPFTGYPKPKITWYRDNEVIESGGHFHVETSERHAILTIRDASNVDTAPYRVVAENDLGMDSAIVKIQISDRPDPPQFPTVEDIGHDSLALVWRAPIWDGGSNITNYIVEKREHPMSSWIRVGNTRFTTMAITGLSPGHQYEFRVYAENVYGRSDPSTTSDLITTYGELLSGMEAPISLITL
*PNALYIPEGDNTKVKIFYAGDQPMEVSLTKNGRVVQSDDRFKFTVLDDYIIIFIKEIRKEDAGDYTVNLSNSSGSVSGTFTINITGLPGPPIGPLDVSEITKHTCTLHWNPPKYDGGLKVTHYVVERRDISMPHWICISTTCHDTTFIVQGLTEGQEYLFHVMAVNENGMGPPLEGINPIKAKSPYDKPSPPGIPVVTQVGGDFVNLSWDKPLDDGGSRIQGYWIDKHEVGSDAWQRVNVAICAPSQINIPNLIEGRQYEFRVYAQNEAGLSLPSSASNSVQIKDPMAAKAPEIIVPLRNANAIQNHNAQFQCTITGCPKPTISWLKGSREITPSARHHIFAEGDTYTLIINSVYGVDADEYVCRAVNKGGVKSTKAELIIMTAPKFNVPPRFRDTAYFDKGENVVVKIPFTGYPKPKITWYRDNEVIESGGHFHVETSERHAILTIRDASNVDTAPYRVVAENDLGMDSAIVKIQISDRPDPPQFPTVEDIGHDSLALVWRAPIWDGGSNITNYIVEKREHPMSSWIRVGNTRFTTMAITGLSPGHQYEFRVYAENVYGRSDPSTTSDLITTYGELLSGMEAPISLIT*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPNALYIPEGDNTKVKIFYAGDQPMEVSLTKNGRVVQSDDRFKFTVLDDYIIIFIKEIRKEDAGDYTVNLSNSSGSVSGTFTINITGLPGPPIGPLDVSEITKHTCTLHWNPPKYDGGLKVTHYVVERRDISMPHWICISTTCHDTTFIVQGLTEGQEYLFHVMAVNENGMGPPLEGINPIKAKSPYDKPSPPGIPVVTQVGGDFVNLSWDKPLDDGGSRIQGYWIDKHEVGSDAWQRVNVAICAPSQINIPNLIEGRQYEFRVYAQNEAGLSLPSSASNSVQIKDPMAAKAPEIIVPLRNANAIQNHNAQFQCTITGCPKPTISWLKGSREITPSARHHIFAEGDTYTLIINSVYGVDADEYVCRAVNKGGVKSTKAELIIMTAPKFNVPPRFRDTAYFDKGENVVVKIPFTGYPKPKITWYRDNEVIESGGHFHVETSERHAILTIRDASNVDTAPYRVVAENDLGMDSAIVKIQISDRPDPPQFPTVEDIGHDSLALVWRAPIWDGGSNITNYIVEKREHPMSSWIRVGNTRFTTMAITGLSPGHQYEFRVYAENVYGRSDPSTTSDLITTYGELLSGMEAPISLITL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query591 2.2.26 [Sep-21-2011]
Q23551 7158 Twitchin OS=Caenorhabditi yes N/A 0.952 0.078 0.411 1e-131
A2ASS6 35213 Titin OS=Mus musculus GN= no N/A 0.969 0.016 0.337 4e-90
Q8WZ42 34350 Titin OS=Homo sapiens GN= no N/A 0.969 0.016 0.337 5e-89
Q3KNY02849 Immunoglobulin-like and f no N/A 0.912 0.189 0.284 1e-50
Q86VF21251 Immunoglobulin-like and f no N/A 0.917 0.433 0.273 2e-45
Q008721141 Myosin-binding protein C, no N/A 0.878 0.454 0.280 3e-43
Q906881272 Myosin-binding protein C, no N/A 0.695 0.323 0.281 7e-39
Q143241141 Myosin-binding protein C, no N/A 0.874 0.453 0.244 6e-35
P164191132 Myosin-binding protein C, no N/A 0.886 0.462 0.255 1e-34
Q9I7U4 18141 Titin OS=Drosophila melan no N/A 0.639 0.020 0.281 2e-34
>sp|Q23551|UNC22_CAEEL Twitchin OS=Caenorhabditis elegans GN=unc-22 PE=1 SV=3 Back     alignment and function desciption
 Score =  470 bits (1210), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 233/566 (41%), Positives = 336/566 (59%), Gaps = 3/566 (0%)

Query: 1    MPNALYIPEGDNTKVKIFYAGDQPMEVSLTKNGRVVQSDD-RFKFTVLDDYIIIFIKEIR 59
            +PN + +P GD  ++KI+++G  P   SL  N   +  D    +    DD+I+I I  + 
Sbjct: 5632 VPNTI-LPSGDLVRLKIYFSGTAPFRHSLVLNREEIDMDHPTIRIVEFDDHILITIPALS 5690

Query: 60   KEDAGDYTVNLSNSSGSVSGTFTINITGLPGPPIGPLDVSEITKHTCTLHWNPPKYDGGL 119
              +AG Y   +SN SG  +  F +N+TGLP  P GPL +S I   T TL W PP  DGG 
Sbjct: 5691 VREAGRYEYTVSNDSGEATTGFWLNVTGLPEAPQGPLHISNIGPSTATLSWRPPVTDGGS 5750

Query: 120  KVTHYVVERRDISMPHWICISTTCHDTTFIVQGLTEGQEYLFHVMAVNENGMGPPLEGIN 179
            K+T YVVE+RD+S   W+ +++   D  +IV GL E  EY F V A NENG+G PL   +
Sbjct: 5751 KITSYVVEKRDLSKDEWVTVTSNVKDMNYIVTGLFENHEYEFRVSAQNENGIGAPLVSEH 5810

Query: 180  PIKAKSPYDKPSPPGIPVVTQVGGDFVNLSWDKPLDDGGSRIQGYWIDKHEVGSDAWQRV 239
            PI A+ P+D P+ P    + QVGGD+V LSW +PL DGG R++GY ++K E   D W R 
Sbjct: 5811 PIIARLPFDPPTSPLNLEIVQVGGDYVTLSWQRPLSDGGGRLRGYIVEKQEEEHDEWFRC 5870

Query: 240  NVAICAPSQINIPNLIEGRQYEFRVYAQNEAGLSLPSSASNSVQIKDPMAAKAPEIIVPL 299
            N     P+  N+PNLI+GR+Y +RV+A N+AGLS  +    ++  +   + + P+I+ PL
Sbjct: 5871 NQNPSPPNNYNVPNLIDGRKYRYRVFAVNDAGLSDLAELDQTL-FQASGSGEGPKIVSPL 5929

Query: 300  RNANAIQNHNAQFQCTITGCPKPTISWLKGSREITPSARHHIFAEGDTYTLIINSVYGVD 359
             + N        F+C I+G P+P   W KG +E+  ++++ +  +GD   LIIN +   D
Sbjct: 5930 SDLNEEVGRCVTFECEISGSPRPEYRWFKGCKELVDTSKYTLINKGDKQVLIINDLTSDD 5989

Query: 360  ADEYVCRAVNKGGVKSTKAELIIMTAPKFNVPPRFRDTAYFDKGENVVVKIPFTGYPKPK 419
            ADEY CRA N  G +ST+A L I T P+  +PP++       KGE + +KIP+  YP+ +
Sbjct: 5990 ADEYTCRATNSSGTRSTRANLRIKTKPRVFIPPKYHGGYEAQKGETIELKIPYKAYPQGE 6049

Query: 420  ITWYRDNEVIESGGHFHVETSERHAILTIRDASNVDTAPYRVVAENDLGMDSAIVKIQIS 479
              W +D E IE+   F + T ++ A L I +AS  D   YRVV EN +G DS  V + ++
Sbjct: 6050 ARWTKDGEKIENNSKFSITTDDKFATLRISNASREDYGEYRVVVENSVGSDSGTVNVTVA 6109

Query: 480  DRPDPPQFPTVEDIGHDSLALVWRAPIWDGGSNITNYIVEKREHPMSSWIRVGNTRFTTM 539
            D P+PP+FP +E+I  +++ L W+ P  DGGS +TNY +EKRE    SW     +R+T  
Sbjct: 6110 DVPEPPRFPIIENILDEAVILSWKPPALDGGSLVTNYTIEKREAMGGSWSPCAKSRYTYT 6169

Query: 540  AITGLSPGHQYEFRVYAENVYGRSDP 565
             I GL  G QYEFR+ AEN +G+S P
Sbjct: 6170 TIEGLRAGKQYEFRIIAENKHGQSKP 6195




Regulator of muscle contraction and relaxation. Senses mechanical strain that occurs during muscle activity by unfolding in clearly resolvable steps at differing forces.
Caenorhabditis elegans (taxid: 6239)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|A2ASS6|TITIN_MOUSE Titin OS=Mus musculus GN=Ttn PE=1 SV=1 Back     alignment and function description
>sp|Q8WZ42|TITIN_HUMAN Titin OS=Homo sapiens GN=TTN PE=1 SV=4 Back     alignment and function description
>sp|Q3KNY0|IGFN1_MOUSE Immunoglobulin-like and fibronectin type III domain-containing protein 1 OS=Mus musculus GN=Igfn1 PE=1 SV=3 Back     alignment and function description
>sp|Q86VF2|IGFN1_HUMAN Immunoglobulin-like and fibronectin type III domain-containing protein 1 OS=Homo sapiens GN=IGFN1 PE=1 SV=2 Back     alignment and function description
>sp|Q00872|MYPC1_HUMAN Myosin-binding protein C, slow-type OS=Homo sapiens GN=MYBPC1 PE=1 SV=2 Back     alignment and function description
>sp|Q90688|MYPC3_CHICK Myosin-binding protein C, cardiac-type OS=Gallus gallus GN=MYBPC3 PE=1 SV=3 Back     alignment and function description
>sp|Q14324|MYPC2_HUMAN Myosin-binding protein C, fast-type OS=Homo sapiens GN=MYBPC2 PE=1 SV=2 Back     alignment and function description
>sp|P16419|MYPC2_CHICK Myosin-binding protein C, fast-type OS=Gallus gallus GN=MYBPC2 PE=1 SV=3 Back     alignment and function description
>sp|Q9I7U4|TITIN_DROME Titin OS=Drosophila melanogaster GN=sls PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query591
328710146 8645 PREDICTED: twitchin-like [Acyrthosiphon 0.978 0.066 0.744 0.0
383852204 8627 PREDICTED: twitchin-like [Megachile rotu 0.901 0.061 0.711 0.0
340710318 8715 PREDICTED: twitchin-like [Bombus terrest 0.928 0.062 0.707 0.0
350413804 8700 PREDICTED: twitchin-like [Bombus impatie 0.901 0.061 0.707 0.0
307200525 5935 Titin [Harpegnathos saltator] 0.893 0.088 0.718 0.0
189233817 8838 PREDICTED: similar to CG32019-PA [Tribol 0.952 0.063 0.717 0.0
270014673 8877 hypothetical protein TcasGA2_TC004721 [T 0.952 0.063 0.717 0.0
380026625 8679 PREDICTED: LOW QUALITY PROTEIN: twitchin 0.898 0.061 0.703 0.0
242010244 8829 titin, putative [Pediculus humanus corpo 0.976 0.065 0.704 0.0
328789682 8619 PREDICTED: LOW QUALITY PROTEIN: twitchin 0.898 0.061 0.692 0.0
>gi|328710146|ref|XP_003244179.1| PREDICTED: twitchin-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  932 bits (2410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/579 (74%), Positives = 493/579 (85%), Gaps = 1/579 (0%)

Query: 1    MPNALYIPEGDNTKVKIFYAGDQPMEVSLTKNGRVVQSDDRFKFTVLDDYIIIFIKEIRK 60
            MPN++ +PEG+N+K+KIFY+GD   ++ L KNG  +   D FKFT+ DDY+IIF+KE +K
Sbjct: 7064 MPNSINVPEGENSKIKIFYSGDSLEDIVLEKNGTTIPQSDHFKFTIFDDYVIIFLKEAKK 7123

Query: 61   EDAGDYTVNLSNSSGSVSGTFTINITGLPGPPIGPLDVSEITKHTCTLHWNPPKYDGGLK 120
             DA DYTV L N SGS SG+FTINI+G PGPPIGPL VSEITKHTC+L WNPPKYDGGLK
Sbjct: 7124 NDASDYTVTLRNPSGSTSGSFTINISGYPGPPIGPLGVSEITKHTCSLSWNPPKYDGGLK 7183

Query: 121  VTHYVVERRDISMPHWICISTTCHDTTFIVQGLTEGQEYLFHVMAVNENGMGPPLEGINP 180
            +THY+VERRDI+  HWICISTTC DT FIVQGLTEG EY+F ++AVN+NG+ PPLEG+NP
Sbjct: 7184 ITHYIVERRDITSNHWICISTTCKDTHFIVQGLTEGNEYVFRIIAVNDNGLSPPLEGVNP 7243

Query: 181  IKAKSPYDKPSPPGIPVVTQVGGDFVNLSWDKPLDDGGSRIQGYWIDKHEVGSDAWQRVN 240
            IKAKSPYDKPSPPGIP VT++GGDFVNLSW+KP+DDGGSRIQGY IDK E+ SD WQRVN
Sbjct: 7244 IKAKSPYDKPSPPGIPTVTEIGGDFVNLSWEKPIDDGGSRIQGYLIDKREIDSDTWQRVN 7303

Query: 241  VAICAPSQINIPNLIEGRQYEFRVYAQNEAGLSLPSSASNSVQIKDPMAAKAPEIIVPLR 300
             AIC  +QINI NLIEGRQY FRV+AQNEAGLSLPS ASN+V IKDP+ A+ PEII PL 
Sbjct: 7304 AAICVTTQINISNLIEGRQYVFRVFAQNEAGLSLPSQASNTVTIKDPLTAQPPEIIKPLG 7363

Query: 301  NANAIQNHNAQFQCTITGCPKPTISWLKGSREITPSARHHIFAEGDTYTLIINSVYGVDA 360
               AIQN NAQFQC ITG PKPTI+W KG+REITPSARHH+F EGD++TLIIN VYG D+
Sbjct: 7364 RVQAIQNQNAQFQCVITGVPKPTITWYKGAREITPSARHHMFNEGDSHTLIINGVYGADS 7423

Query: 361  DEYVCRAVNKGGVKSTKAELIIMTAPKFNVPPRFRDTAYFDKGENVVVKIPFTGYPKPKI 420
            DEYVCRA NKGG+KST+ EL IMT PK NVPPRFRDTA+FDKGENVV+KIPFTG+PKPKI
Sbjct: 7424 DEYVCRASNKGGIKSTRGELFIMTPPKLNVPPRFRDTAFFDKGENVVIKIPFTGFPKPKI 7483

Query: 421  TWYRDNEVIESGGHFHVETSERHAILTIRDASNVDTAPYRVVAENDLGMDSAIVKIQISD 480
             WYR+NEVIESG HF VE SERHAILTIRD S  D++PYRV+AENDLG+DSAI+KIQISD
Sbjct: 7484 KWYRENEVIESGSHFAVEVSERHAILTIRDVSKYDSSPYRVLAENDLGVDSAIIKIQISD 7543

Query: 481  RPDPPQFPTVEDIGHDSLALVWRAPIWDGGSNITNYIVEKREHPMSSWIRVGNTRFTTMA 540
             PDPP   ++EDIG DSL L W AP WDGGSNITNY++EKRE PMSSWIRVGNTRFT+ A
Sbjct: 7544 HPDPPFSLSIEDIGQDSLILNWNAPTWDGGSNITNYLIEKREIPMSSWIRVGNTRFTSTA 7603

Query: 541  ITGLSPGHQYEFRVYAENVYGRSDPSTTSDLITTYGELL 579
            +TGLSPGH+YEFRVYAENVYGRS PS  S ++ T  ELL
Sbjct: 7604 VTGLSPGHEYEFRVYAENVYGRSKPSEVSPVVKT-KELL 7641




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383852204|ref|XP_003701618.1| PREDICTED: twitchin-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|340710318|ref|XP_003393739.1| PREDICTED: twitchin-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350413804|ref|XP_003490119.1| PREDICTED: twitchin-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307200525|gb|EFN80687.1| Titin [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|189233817|ref|XP_971502.2| PREDICTED: similar to CG32019-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270014673|gb|EFA11121.1| hypothetical protein TcasGA2_TC004721 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|380026625|ref|XP_003697047.1| PREDICTED: LOW QUALITY PROTEIN: twitchin-like [Apis florea] Back     alignment and taxonomy information
>gi|242010244|ref|XP_002425880.1| titin, putative [Pediculus humanus corporis] gi|212509846|gb|EEB13142.1| titin, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|328789682|ref|XP_003251305.1| PREDICTED: LOW QUALITY PROTEIN: twitchin [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query591
FB|FBgn0005666 8933 bt "bent" [Drosophila melanoga 0.969 0.064 0.633 1.3e-207
WB|WBGene00006759 7158 unc-22 [Caenorhabditis elegans 0.952 0.078 0.388 1.8e-112
MGI|MGI:9886435 Ttn "titin" [Mus musculus (tax 0.954 16.11 0.322 3e-81
UNIPROTKB|F1N75734 F1N757 "Uncharacterized protei 0.956 16.61 0.322 1.2e-80
UNIPROTKB|Q8WZ4234 TTN "Titin" [Homo sapiens (tax 0.947 16.47 0.325 1.6e-80
UNIPROTKB|F1PV4535 F1PV45 "Uncharacterized protei 0.949 16.02 0.321 1.5e-79
ZFIN|ZDB-GENE-030113-232 ttna "titin a" [Danio rerio (t 0.959 17.71 0.308 1.2e-70
ZFIN|ZDB-GENE-030616-41328 ttnb "titin b" [Danio rerio (t 0.808 17.07 0.326 1.3e-69
FB|FBgn0035410 1427 CG14964 [Drosophila melanogast 0.654 0.271 0.358 1.3e-60
WB|WBGene0000643618 ttn-1 [Caenorhabditis elegans 0.790 25.94 0.290 1.8e-47
FB|FBgn0005666 bt "bent" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 2029 (719.3 bits), Expect = 1.3e-207, P = 1.3e-207
 Identities = 365/576 (63%), Positives = 445/576 (77%)

Query:     2 PNALYIPEGDNTKVKIFYAGDQPMEVSLTKNGRVV--QSDD-RFKFTVLDDYIIIFIKEI 58
             P+ L +PEGDN+K+KIFY+GDQP+ V L KN  V+   +DD   K  + DDY+ I+I+ I
Sbjct:  7354 PSELKLPEGDNSKIKIFYSGDQPLTVILKKNNEVICDSNDDTHVKVNIFDDYVAIYIRNI 7413

Query:    59 RKEDAGDYXXXXXXXXXXXXXXFXXXXXXXXXXXXXXXDVSEITKHTCTLHWNPPKYDGG 118
              K D G Y              F                +S I K++C L+W PP YDGG
Sbjct:  7414 VKSDGGPYQIEFTNESGSATGEFYVHITGMPSAPTGPMGISYINKNSCMLNWRPPSYDGG 7473

Query:   119 LKVTHYVVERRDISMPHWICISTTCHDTTFIVQGLTEGQEYLFHVMAVNENGMGPPLEGI 178
             LKV+HYV+ER+D+S PHWI +S+TC DT F VQGL E QEY+F VMAVNENGMGPPLEG+
Sbjct:  7474 LKVSHYVIERKDVSSPHWITVSSTCKDTAFNVQGLIENQEYIFRVMAVNENGMGPPLEGL 7533

Query:   179 NPIKAKSPYDKPSPPGIPVVTQVGGDFVNLSWDKPLDDGGSRIQGYWIDKHEVGSDAWQR 238
             NPI+AK P D PSPPG P +T++GGDFV+L W+KP  DGG+ IQGYWIDK EVGS+ WQR
Sbjct:  7534 NPIRAKDPIDPPSPPGSPQITEIGGDFVHLEWEKPESDGGAHIQGYWIDKREVGSNTWQR 7593

Query:   239 VNVAICAPSQINIPNLIEGRQYEFRVYAQNEAGLSLPSSASNSVQIKDPMAAKAPEIIVP 298
             VN  ICA +QIN  NLIEGRQYEFR++AQN AGLS  SSAS +V+I DP AA  P I+ P
Sbjct:  7594 VNATICAANQINCINLIEGRQYEFRIFAQNVAGLSTESSASQAVKIIDPQAASPPLIVKP 7653

Query:   299 LRNANAIQNHNAQFQCTITGCPKPTISWLKGSREITPSARHHIFAEGDTYTLIINSVYGV 358
             LR+AN IQNHNAQF CTI G PKPTISW KG+REI+  AR+H+++EGD + L IN V+G 
Sbjct:  7654 LRDANCIQNHNAQFTCTINGVPKPTISWYKGAREISNGARYHMYSEGDNHFLNINDVFGE 7713

Query:   359 DADEYVCRAVNKGGVKSTKAELIIMTAPKFNVPPRFRDTAYFDKGENVVVKIPFTGYPKP 418
             DADEYVCRAVNK G KST+A L IMTAPK NVPPRFRDTAYFDKGENVV+KIPFTG+PKP
Sbjct:  7714 DADEYVCRAVNKAGAKSTRATLAIMTAPKLNVPPRFRDTAYFDKGENVVIKIPFTGFPKP 7773

Query:   419 KITWYRDNEVIESGGHFHVETSERHAILTIRDASNVDTAPYRVVAENDLGMDSAIVKIQI 478
             +I W RD E IESGGH+ VE  ERHA+L IRD S++D+ PYR+ AEN+LG D+AI+++QI
Sbjct:  7774 RIHWVRDGENIESGGHYTVEVKERHAVLIIRDGSHLDSGPYRITAENELGSDTAIIQVQI 7833

Query:   479 SDRPDPPQFPTVEDIGHDSLALVWRAPIWDGGSNITNYIVEKREHPMSSWIRVGNTRFTT 538
             SDRPDPP+FP +E IG +SL+L W+AP+WDG S+ITNY VE+REHP+SSWIRVGNTRFT+
Sbjct:  7834 SDRPDPPRFPLIESIGTESLSLSWKAPVWDGCSDITNYYVERREHPLSSWIRVGNTRFTS 7893

Query:   539 MAITGLSPGHQYEFRVYAENVYGRSDPSTTSDLITT 574
             MA++GL+PG +Y+FR++A+NVYGRSD S TS LI T
Sbjct:  7894 MAVSGLTPGKEYDFRIFADNVYGRSDASDTSTLIKT 7929


GO:0005737 "cytoplasm" evidence=ISS
GO:0004687 "myosin light chain kinase activity" evidence=NAS
GO:0005200 "structural constituent of cytoskeleton" evidence=ISS
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;NAS
GO:0006468 "protein phosphorylation" evidence=IEA;NAS
GO:0007498 "mesoderm development" evidence=IEP
GO:0005524 "ATP binding" evidence=IEA
GO:0008307 "structural constituent of muscle" evidence=IDA
GO:0030018 "Z disc" evidence=IDA
GO:0045214 "sarcomere organization" evidence=IMP
WB|WBGene00006759 unc-22 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
MGI|MGI:98864 Ttn "titin" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1N757 F1N757 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WZ42 TTN "Titin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PV45 F1PV45 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030113-2 ttna "titin a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030616-413 ttnb "titin b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0035410 CG14964 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00006436 ttn-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query591
pfam0767990 pfam07679, I-set, Immunoglobulin I-set domain 4e-25
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 9e-21
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 4e-20
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 5e-19
smart0006083 smart00060, FN3, Fibronectin type 3 domain 3e-16
smart0006083 smart00060, FN3, Fibronectin type 3 domain 3e-15
cd0574874 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like d 5e-15
smart0006083 smart00060, FN3, Fibronectin type 3 domain 1e-14
pfam0767990 pfam07679, I-set, Immunoglobulin I-set domain 1e-13
pfam0004184 pfam00041, fn3, Fibronectin type III domain 1e-12
smart0041085 smart00410, IG_like, Immunoglobulin like 6e-12
smart0040985 smart00409, IG, Immunoglobulin 6e-12
smart0041085 smart00410, IG_like, Immunoglobulin like 8e-12
smart0040985 smart00409, IG, Immunoglobulin 8e-12
pfam0004184 pfam00041, fn3, Fibronectin type III domain 1e-11
cd0009674 cd00096, Ig, Immunoglobulin domain 2e-10
cd0574574 cd05745, Ig3_Peroxidasin, Third immunoglobulin (Ig 2e-10
pfam0004184 pfam00041, fn3, Fibronectin type III domain 3e-10
pfam0767990 pfam07679, I-set, Immunoglobulin I-set domain 8e-10
cd0574874 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like d 2e-08
smart0041085 smart00410, IG_like, Immunoglobulin like 2e-08
smart0040985 smart00409, IG, Immunoglobulin 2e-08
cd0576298 cd05762, Ig8_MLCK, Eighth immunoglobulin (Ig)-like 3e-08
cd0573095 cd05730, Ig3_NCAM-1_like, Third immunoglobulin (Ig 5e-08
cd0496973 cd04969, Ig5_Contactin_like, Fifth Ig domain of co 5e-08
cd0009674 cd00096, Ig, Immunoglobulin domain 7e-08
cd0573676 cd05736, Ig2_Follistatin_like, Second immunoglobul 2e-07
cd0589486 cd05894, Ig_C5_MyBP-C, C5 immunoglobulin (Ig) doma 3e-07
cd0572569 cd05725, Ig3_Robo, Third immunoglobulin (Ig)-like 4e-07
cd0572985 cd05729, Ig2_FGFR_like, Second immunoglobulin (Ig) 6e-07
cd0574669 cd05746, Ig4_Peroxidasin, Fourth immunoglobulin (I 7e-07
smart0040863 smart00408, IGc2, Immunoglobulin C-2 Type 8e-07
cd0497181 cd04971, Ig_TrKABC_d5, Fifth domain (immunoglobuli 1e-06
cd0573095 cd05730, Ig3_NCAM-1_like, Third immunoglobulin (Ig 2e-06
cd0572690 cd05726, Ig4_Robo, Third immunoglobulin (Ig)-like 4e-06
cd0497671 cd04976, Ig2_VEGFR, Second immunoglobulin (Ig)-lik 5e-06
cd0572371 cd05723, Ig4_Neogenin, Fourth immunoglobulin (Ig)- 7e-06
cd0573792 cd05737, Ig_Myomesin_like_C, C-temrinal immunoglob 8e-06
cd0574669 cd05746, Ig4_Peroxidasin, Fourth immunoglobulin (I 1e-05
smart0040863 smart00408, IGc2, Immunoglobulin C-2 Type 1e-05
cd0585785 cd05857, Ig2_FGFR, Second immunoglobulin (Ig)-like 1e-05
cd0497290 cd04972, Ig_TrkABC_d4, Fourth domain (immunoglobul 3e-05
cd0574378 cd05743, Ig_Perlecan_D2_like, Immunoglobulin (Ig)- 3e-05
pfam1389580 pfam13895, Ig_2, Immunoglobulin domain 3e-05
cd0573296 cd05732, Ig5_NCAM-1_like, Fifth immunoglobulin (Ig 3e-05
cd0574792 cd05747, Ig5_Titin_like, M5, fifth immunoglobulin 4e-05
cd0573792 cd05737, Ig_Myomesin_like_C, C-temrinal immunoglob 6e-05
cd0576375 cd05763, Ig_1, Subgroup of the immunoglobulin (Ig) 6e-05
cd0585273 cd05852, Ig5_Contactin-1, Fifth Ig domain of conta 7e-05
cd0574874 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like d 8e-05
pfam1389580 pfam13895, Ig_2, Immunoglobulin domain 9e-05
cd0586470 cd05864, Ig2_VEGFR-2, Second immunoglobulin (Ig)-l 9e-05
cd0009674 cd00096, Ig, Immunoglobulin domain 3e-04
cd0574792 cd05747, Ig5_Titin_like, M5, fifth immunoglobulin 3e-04
cd0575075 cd05750, Ig_Pro_neuregulin, Immunoglobulin (Ig)-li 0.001
cd0589192 cd05891, Ig_M-protein_C, C-terminal immunoglobulin 0.002
cd0589192 cd05891, Ig_M-protein_C, C-terminal immunoglobulin 0.002
cd0572486 cd05724, Ig2_Robo, Second immunoglobulin (Ig)-like 0.002
cd07693100 cd07693, Ig1_Robo, First immunoglobulin (Ig)-like 0.002
cd0576077 cd05760, Ig2_PTK7, Second immunoglobulin (Ig)-like 0.002
cd0573792 cd05737, Ig_Myomesin_like_C, C-temrinal immunoglob 0.003
cd0585579 cd05855, Ig_TrkB_d5, Fifth domain (immunoglobulin- 0.003
>gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain Back     alignment and domain information
 Score = 98.9 bits (247), Expect = 4e-25
 Identities = 32/90 (35%), Positives = 47/90 (52%)

Query: 293 PEIIVPLRNANAIQNHNAQFQCTITGCPKPTISWLKGSREITPSARHHIFAEGDTYTLII 352
           P+     ++    +  +A+F CT+TG P PT+SW K  + +  S R  +  EG TYTL I
Sbjct: 1   PKFTQKPKDVEVQEGESARFTCTVTGDPDPTVSWFKDGQPLRSSDRFKVTYEGGTYTLTI 60

Query: 353 NSVYGVDADEYVCRAVNKGGVKSTKAELII 382
           ++V   D  +Y C A N  G     AEL +
Sbjct: 61  SNVQPDDEGKYTCVATNSAGEAEASAELTV 90


Length = 90

>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information
>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information
>gnl|CDD|143225 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information
>gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information
>gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like Back     alignment and domain information
>gnl|CDD|214652 smart00409, IG, Immunoglobulin Back     alignment and domain information
>gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like Back     alignment and domain information
>gnl|CDD|214652 smart00409, IG, Immunoglobulin Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information
>gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143222 cd05745, Ig3_Peroxidasin, Third immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information
>gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain Back     alignment and domain information
>gnl|CDD|143225 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like Back     alignment and domain information
>gnl|CDD|214652 smart00409, IG, Immunoglobulin Back     alignment and domain information
>gnl|CDD|143239 cd05762, Ig8_MLCK, Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) Back     alignment and domain information
>gnl|CDD|143207 cd05730, Ig3_NCAM-1_like, Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>gnl|CDD|143170 cd04969, Ig5_Contactin_like, Fifth Ig domain of contactin Back     alignment and domain information
>gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143213 cd05736, Ig2_Follistatin_like, Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>gnl|CDD|143302 cd05894, Ig_C5_MyBP-C, C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) Back     alignment and domain information
>gnl|CDD|143202 cd05725, Ig3_Robo, Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>gnl|CDD|143206 cd05729, Ig2_FGFR_like, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>gnl|CDD|143223 cd05746, Ig4_Peroxidasin, Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>gnl|CDD|197706 smart00408, IGc2, Immunoglobulin C-2 Type Back     alignment and domain information
>gnl|CDD|143172 cd04971, Ig_TrKABC_d5, Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>gnl|CDD|143207 cd05730, Ig3_NCAM-1_like, Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>gnl|CDD|143203 cd05726, Ig4_Robo, Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>gnl|CDD|143177 cd04976, Ig2_VEGFR, Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) Back     alignment and domain information
>gnl|CDD|212460 cd05723, Ig4_Neogenin, Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>gnl|CDD|143214 cd05737, Ig_Myomesin_like_C, C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>gnl|CDD|143223 cd05746, Ig4_Peroxidasin, Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>gnl|CDD|197706 smart00408, IGc2, Immunoglobulin C-2 Type Back     alignment and domain information
>gnl|CDD|143265 cd05857, Ig2_FGFR, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>gnl|CDD|143173 cd04972, Ig_TrkABC_d4, Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>gnl|CDD|143220 cd05743, Ig_Perlecan_D2_like, Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 Back     alignment and domain information
>gnl|CDD|206066 pfam13895, Ig_2, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143209 cd05732, Ig5_NCAM-1_like, Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins Back     alignment and domain information
>gnl|CDD|143224 cd05747, Ig5_Titin_like, M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>gnl|CDD|143214 cd05737, Ig_Myomesin_like_C, C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>gnl|CDD|143240 cd05763, Ig_1, Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>gnl|CDD|143260 cd05852, Ig5_Contactin-1, Fifth Ig domain of contactin-1 Back     alignment and domain information
>gnl|CDD|143225 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>gnl|CDD|206066 pfam13895, Ig_2, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143272 cd05864, Ig2_VEGFR-2, Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) Back     alignment and domain information
>gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143224 cd05747, Ig5_Titin_like, M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>gnl|CDD|143227 cd05750, Ig_Pro_neuregulin, Immunoglobulin (Ig)-like domain in neuregulins (NRGs) Back     alignment and domain information
>gnl|CDD|143299 cd05891, Ig_M-protein_C, C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) Back     alignment and domain information
>gnl|CDD|143299 cd05891, Ig_M-protein_C, C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) Back     alignment and domain information
>gnl|CDD|143201 cd05724, Ig2_Robo, Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>gnl|CDD|143317 cd07693, Ig1_Robo, First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
>gnl|CDD|143237 cd05760, Ig2_PTK7, Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>gnl|CDD|143214 cd05737, Ig_Myomesin_like_C, C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>gnl|CDD|143263 cd05855, Ig_TrkB_d5, Fifth domain (immunoglobulin-like) of Trk receptor TrkB Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 591
KOG3513|consensus 1051 100.0
KOG3513|consensus 1051 100.0
KOG4221|consensus 1381 100.0
KOG4222|consensus 1281 100.0
KOG4221|consensus 1381 100.0
KOG4222|consensus 1281 100.0
KOG4194|consensus873 99.93
PHA02785326 IL-beta-binding protein; Provisional 99.91
PHA02785326 IL-beta-binding protein; Provisional 99.88
KOG4194|consensus873 99.88
cd0576298 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of 99.83
KOG3515|consensus 741 99.82
PHA02826227 IL-1 receptor-like protein; Provisional 99.79
cd0573792 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- 99.76
cd0589486 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card 99.74
cd0576298 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of 99.72
cd04975101 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma 99.7
PF0767990 I-set: Immunoglobulin I-set domain; InterPro: IPR0 99.69
cd0574792 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like 99.69
cd0573588 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down 99.69
cd0589192 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like 99.68
cd0497290 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o 99.68
cd0585188 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig 99.67
cd0589275 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like 99.67
cd0585273 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig 99.66
cd0586596 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o 99.66
cd0574574 Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom 99.66
cd0574874 Ig_Titin_like Immunoglobulin (Ig)-like domain of t 99.65
cd0586692 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o 99.65
cd0589375 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like 99.64
cd0572885 Ig4_Contactin-2-like Fourth Ig domain of the neura 99.64
cd05859101 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do 99.63
cd0587098 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o 99.63
cd0573095 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom 99.63
cd0585785 Ig2_FGFR Second immunoglobulin (Ig)-like domain of 99.62
cd0585485 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig 99.62
cd0586876 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o 99.62
KOG3515|consensus741 99.62
cd0574378 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai 99.61
cd0586776 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do 99.61
cd0497379 Ig1_FGFR First immunoglobulin (Ig)-like domain of 99.61
cd0574475 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain 99.61
cd0586367 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain 99.61
cd0573588 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down 99.6
cd0572371 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai 99.6
cd0585188 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig 99.6
cd0574091 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai 99.59
cd0496888 Ig3_Contactin_like Third Ig domain of contactin. I 99.59
cd0589486 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card 99.59
cd0573296 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom 99.59
cd0586997 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o 99.59
cd0496973 Ig5_Contactin_like Fifth Ig domain of contactin. I 99.58
cd0497876 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like 99.58
cd0573792 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- 99.57
cd0585579 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T 99.57
cd0574792 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like 99.57
cd0497181 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of 99.56
PHA02826227 IL-1 receptor-like protein; Provisional 99.55
PF0767990 I-set: Immunoglobulin I-set domain; InterPro: IPR0 99.55
cd0585385 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig 99.55
cd0586470 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain 99.55
cd0497671 Ig2_VEGFR Second immunoglobulin (Ig)-like domain o 99.55
cd0576077 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of 99.55
cd04975101 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma 99.55
cd0497085 Ig6_Contactin_like Sixth Ig domain of contactin. I 99.55
cd0589275 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like 99.55
cd05773109 Ig8_hNephrin_like Eighth immunoglobulin-like domai 99.54
cd0575694 Ig1_IL1R_like First immunoglobulin (Ig)-like domai 99.54
cd05773109 Ig8_hNephrin_like Eighth immunoglobulin-like domai 99.54
cd0573676 Ig2_Follistatin_like Second immunoglobulin (Ig)-li 99.54
cd0574669 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do 99.54
cd0497792 Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom 99.53
cd0574874 Ig_Titin_like Immunoglobulin (Ig)-like domain of t 99.53
cd0584894 Ig1_Contactin-5 First Ig domain of contactin-5. Ig 99.53
cd0573969 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li 99.53
cd0585273 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig 99.53
cd0585094 Ig1_Contactin-2 First Ig domain of contactin-2. Ig 99.53
cd0576375 Ig_1 Subgroup of the immunoglobulin (Ig) superfami 99.52
cd0572486 Ig2_Robo Second immunoglobulin (Ig)-like domain in 99.52
cd0587671 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o 99.52
cd0572295 Ig1_Neogenin First immunoglobulin (Ig)-like domain 99.52
cd0574574 Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom 99.51
cd0585682 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do 99.51
cd0574981 Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom 99.5
cd05859101 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do 99.5
cd0585890 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o 99.5
cd0589375 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like 99.5
cd0572690 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in 99.5
cd0497290 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o 99.49
cd0585485 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig 99.49
cd0575898 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do 99.49
cd0573874 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l 99.49
cd07693100 Ig1_Robo First immunoglobulin (Ig)-like domain in 99.49
cd0497490 Ig3_FGFR Third immunoglobulin (Ig)-like domain of 99.48
cd0576474 Ig_2 Subgroup of the immunoglobulin (Ig) superfami 99.48
KOG0613|consensus 1205 99.47
cd0572569 Ig3_Robo Third immunoglobulin (Ig)-like domain in 99.47
cd0574378 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai 99.47
cd0586367 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain 99.47
cd0587098 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o 99.47
cd0586692 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o 99.47
cd0770272 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain 99.46
cd0575075 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain 99.46
cd0573095 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom 99.46
cd0586596 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o 99.46
cd0574475 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain 99.46
cd0589192 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like 99.46
cd0573377 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom 99.46
cd0496888 Ig3_Contactin_like Third Ig domain of contactin. I 99.45
cd0572371 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai 99.45
cd0573171 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom 99.45
cd0770195 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- 99.45
cd0586997 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o 99.45
cd0584993 Ig1_Contactin-1 First Ig domain of contactin-1. Ig 99.44
cd0587477 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of 99.44
cd0572885 Ig4_Contactin-2-like Fourth Ig domain of the neura 99.44
cd0585385 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig 99.44
cd0586876 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o 99.43
cd0587577 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li 99.43
cd0585579 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T 99.43
cd0576581 Ig_3 Subgroup of the immunoglobulin (Ig) superfami 99.43
cd0496973 Ig5_Contactin_like Fifth Ig domain of contactin. I 99.43
cd0573296 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom 99.42
cd0585785 Ig2_FGFR Second immunoglobulin (Ig)-like domain of 99.42
cd0497181 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of 99.42
cd0586776 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do 99.42
cd0574669 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do 99.41
KOG0196|consensus 996 99.41
cd0497876 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like 99.41
cd0497085 Ig6_Contactin_like Sixth Ig domain of contactin. I 99.41
cd0497989 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of 99.4
cd0575278 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do 99.4
cd0587387 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of 99.39
cd0586470 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain 99.39
cd0586184 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like 99.39
cd0497671 Ig2_VEGFR Second immunoglobulin (Ig)-like domain o 99.39
cd0574284 Ig1_VEGFR_like First immunoglobulin (Ig)-like doma 99.38
cd0573676 Ig2_Follistatin_like Second immunoglobulin (Ig)-li 99.38
cd07693100 Ig1_Robo First immunoglobulin (Ig)-like domain in 99.38
cd0496791 Ig1_Contactin First Ig domain of contactin. Ig1_Co 99.37
cd0588295 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- 99.37
cd0572985 Ig2_FGFR_like Second immunoglobulin (Ig)-like doma 99.37
cd0589576 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai 99.36
cd0573969 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li 99.36
cd0587671 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o 99.36
cd0584894 Ig1_Contactin-5 First Ig domain of contactin-5. Ig 99.36
cd0576077 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of 99.36
cd0575485 Ig3_Perlecan_like Third immunoglobulin (Ig)-like d 99.36
cd0574091 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai 99.35
cd0576375 Ig_1 Subgroup of the immunoglobulin (Ig) superfami 99.35
cd0589898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain 99.35
cd0585890 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o 99.34
cd0584993 Ig1_Contactin-1 First Ig domain of contactin-1. Ig 99.34
cd0572690 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in 99.34
cd0585094 Ig1_Contactin-2 First Ig domain of contactin-2. Ig 99.33
cd0572569 Ig3_Robo Third immunoglobulin (Ig)-like domain in 99.32
cd0497379 Ig1_FGFR First immunoglobulin (Ig)-like domain of 99.31
cd0573874 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l 99.31
cd0573377 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom 99.31
cd0576474 Ig_2 Subgroup of the immunoglobulin (Ig) superfami 99.31
cd0575792 Ig2_IL1R_like Second immunoglobulin (Ig)-like doma 99.3
cd0573171 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom 99.3
cd0497490 Ig3_FGFR Third immunoglobulin (Ig)-like domain of 99.3
cd0575898 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do 99.3
cd0575075 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain 99.29
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 99.29
cd0587477 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of 99.29
cd0497792 Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom 99.28
cd0571795 Ig1_Necl-1-3_like First (N-terminal) immunoglobuli 99.28
cd0585682 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do 99.28
cd0573479 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain 99.28
cd0587577 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li 99.28
cd0572486 Ig2_Robo Second immunoglobulin (Ig)-like domain in 99.27
cd0572295 Ig1_Neogenin First immunoglobulin (Ig)-like domain 99.26
cd0769094 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I 99.24
smart0041086 IG_like Immunoglobulin like. IG domains that canno 99.24
smart0040986 IG Immunoglobulin. 99.24
cd0575694 Ig1_IL1R_like First immunoglobulin (Ig)-like domai 99.24
cd0576581 Ig_3 Subgroup of the immunoglobulin (Ig) superfami 99.24
cd0574981 Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom 99.23
cd0770272 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain 99.23
cd0575383 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like 99.23
cd05771139 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain 99.22
cd0572796 Ig2_Contactin-2-like Second Ig domain of the neura 99.22
cd05860101 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of 99.2
KOG0196|consensus 996 99.18
cd0587191 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do 99.17
cd0588195 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- 99.17
cd0589576 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai 99.16
cd0574284 Ig1_VEGFR_like First immunoglobulin (Ig)-like doma 99.16
smart0040863 IGc2 Immunoglobulin C-2 Type. 99.14
PF1389580 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V 99.14
cd0496791 Ig1_Contactin First Ig domain of contactin. Ig1_Co 99.14
cd0586184 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like 99.13
cd0573479 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain 99.13
cd0575278 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do 99.13
cd0589898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain 99.13
cd05896104 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like 99.13
cd0586286 Ig1_VEGFR First immunoglobulin (Ig)-like domain of 99.13
cd0584595 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do 99.12
cd0572985 Ig2_FGFR_like Second immunoglobulin (Ig)-like doma 99.11
cd0589795 Ig2_IL1R2_like Second immunoglobulin (Ig)-like dom 99.09
cd0770195 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- 99.08
cd0587387 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of 99.05
PF0004764 ig: Immunoglobulin domain The Prosite family only 99.03
cd0575485 Ig3_Perlecan_like Third immunoglobulin (Ig)-like d 99.02
cd0588295 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- 99.02
cd05860101 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of 99.0
cd0587285 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of 99.0
cd0497989 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of 99.0
cd0575792 Ig2_IL1R_like Second immunoglobulin (Ig)-like doma 99.0
cd05771139 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain 98.98
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 98.95
cd0588580 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain 98.93
cd04983109 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V 98.91
PHA03376221 BARF1; Provisional 98.91
cd0575383 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like 98.89
cd0575982 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like d 98.87
cd0572796 Ig2_Contactin-2-like Second Ig domain of the neura 98.86
cd05879116 Ig_P0 Immunoglobulin (Ig)-like domain of Protein z 98.85
cd05880115 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel 98.85
smart0040863 IGc2 Immunoglobulin C-2 Type. 98.84
cd0769094 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I 98.84
cd05714106 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho 98.82
cd05899110 IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma 98.82
cd04980106 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa 98.82
cd0584595 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do 98.82
cd05900112 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the 98.81
cd0586286 Ig1_VEGFR First immunoglobulin (Ig)-like domain of 98.81
cd0571795 Ig1_Necl-1-3_like First (N-terminal) immunoglobuli 98.81
PF1389580 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V 98.79
smart0040986 IG Immunoglobulin. 98.78
smart0041086 IG_like Immunoglobulin like. IG domains that canno 98.78
KOG4258|consensus1025 98.78
cd05713100 Ig_MOG_like Immunoglobulin (Ig)-like domain of mye 98.77
PF0004764 ig: Immunoglobulin domain The Prosite family only 98.77
cd0575191 Ig1_LILRB1_like First immunoglobulin (Ig)-like dom 98.77
cd00099105 IgV Immunoglobulin variable domain (IgV). IgV: Imm 98.76
cd05877106 Ig_LP_like Immunoglobulin (Ig)-like domain of huma 98.75
cd0577597 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig) 98.75
cd0498498 IgV_L_lambda Immunoglobulin (Ig) lambda light chai 98.74
cd0587191 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do 98.74
cd0588195 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- 98.74
cd05715116 Ig_P0-like Immunoglobulin (Ig)-like domain of Prot 98.72
cd0006393 FN3 Fibronectin type 3 domain; One of three types 98.72
cd05878110 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain o 98.71
cd0571898 Ig1_PVR_like First immunoglobulin (Ig) domain of p 98.71
cd05774105 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain 98.71
cd04982116 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) dom 98.71
PF07686114 V-set: Immunoglobulin V-set domain; InterPro: IPR0 98.69
cd0574192 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like d 98.66
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 98.64
cd0589795 Ig2_IL1R2_like Second immunoglobulin (Ig)-like dom 98.64
cd0587285 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of 98.61
PHA02987189 Ig domain OX-2-like protein; Provisional 98.6
cd0588580 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain 98.59
cd05902110 Ig_Neurocan Immunoglobulin (Ig)-like domain of the 98.59
cd0575982 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like d 98.57
cd05712119 Ig_Siglec_N Immunoglobulin (Ig) domain at the N te 98.57
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 98.57
cd05888100 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain 98.57
cd0588382 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain 98.54
cd05896104 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like 98.52
cd05901117 Ig_Versican Immunoglobulin (Ig)-like domain of the 98.51
cd07706116 IgV_TCR_delta Immunoglobulin (Ig) variable (V) dom 98.51
cd0571194 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of 98.5
PF1392775 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V 98.48
PF1392775 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V 98.47
KOG0613|consensus 1205 98.45
cd0588699 Ig1_Nectin-1_like First immunoglobulin (Ig) domain 98.45
cd04983109 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V 98.44
cd0770583 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain 98.43
cd0575191 Ig1_LILRB1_like First immunoglobulin (Ig)-like dom 98.42
cd0584697 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain 98.42
cd0571698 Ig_pIgR Immunoglobulin (Ig)-like domain in the pol 98.41
cd05774105 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain 98.4
cd05755100 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like do 98.39
cd05899110 IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma 98.38
cd07700107 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD 98.38
cd0769488 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. 98.36
cd04980106 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa 98.36
cd0576182 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like 98.36
cd0588796 Ig1_Nectin-3_like First immunoglobulin (Ig) domain 98.33
cd0009895 IgC Immunoglobulin Constant domain. IgC: Immunoglo 98.31
cd0588483 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain 98.31
cd00099105 IgV Immunoglobulin variable domain (IgV). IgV: Imm 98.31
cd05720104 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD 98.3
cd05714106 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho 98.26
cd05900112 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the 98.26
smart0006083 FN3 Fibronectin type 3 domain. One of three types 98.26
cd04982116 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) dom 98.25
PHA03376221 BARF1; Provisional 98.25
cd05877106 Ig_LP_like Immunoglobulin (Ig)-like domain of huma 98.21
cd0588382 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain 98.2
cd05713100 Ig_MOG_like Immunoglobulin (Ig)-like domain of mye 98.2
cd0498498 IgV_L_lambda Immunoglobulin (Ig) lambda light chai 98.19
cd0571898 Ig1_PVR_like First immunoglobulin (Ig) domain of p 98.12
cd04981117 IgV_H Immunoglobulin (Ig) heavy chain (H), variabl 98.11
cd0574192 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like d 98.09
cd05755100 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like do 98.09
cd0577597 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig) 98.03
cd0588996 Ig1_DNAM-1_like First immunoglobulin (Ig) domain o 98.03
cd0571194 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of 98.03
cd05878110 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain o 98.0
cd0009674 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) 98.0
cd05879116 Ig_P0 Immunoglobulin (Ig)-like domain of Protein z 98.0
KOG4802|consensus516 97.98
PF07686114 V-set: Immunoglobulin V-set domain; InterPro: IPR0 97.95
cd05880115 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel 97.95
cd0576182 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like 97.93
cd05772111 IgC_SIRP Signal-regulatory protein (SIRP) immunogl 97.92
cd0770583 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain 97.91
smart0040775 IGc1 Immunoglobulin C-Type. 97.9
cd0009895 IgC Immunoglobulin Constant domain. IgC: Immunoglo 97.89
PHA03271490 envelope glycoprotein C; Provisional 97.88
cd05715116 Ig_P0-like Immunoglobulin (Ig)-like domain of Prot 97.86
KOG4367|consensus 699 97.84
cd07706116 IgV_TCR_delta Immunoglobulin (Ig) variable (V) dom 97.83
cd0769488 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. 97.82
smart0040681 IGv Immunoglobulin V-Type. 97.81
cd05901117 Ig_Versican Immunoglobulin (Ig)-like domain of the 97.78
cd07700107 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD 97.78
cd0588483 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain 97.76
cd05902110 Ig_Neurocan Immunoglobulin (Ig)-like domain of the 97.75
cd05888100 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain 97.74
cd05720104 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD 97.73
cd0571698 Ig_pIgR Immunoglobulin (Ig)-like domain in the pol 97.71
PF0820589 C2-set_2: CD80-like C2-set immunoglobulin domain ; 97.71
cd0769265 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of 97.7
cd0588699 Ig1_Nectin-1_like First immunoglobulin (Ig) domain 97.69
cd0576694 IgC_MHC_II_beta Class II major histocompatibility 97.69
cd07699100 IgC_L Immunoglobulin Constant domain. IgC_L: Immun 97.66
PHA02987189 Ig domain OX-2-like protein; Provisional 97.66
cd0584794 IgC_CH2_IgE CH2 domain (second constant Ig domain 97.64
cd0584697 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain 97.63
cd05712119 Ig_Siglec_N Immunoglobulin (Ig) domain at the N te 97.62
cd0006393 FN3 Fibronectin type 3 domain; One of three types 97.58
cd0769893 IgC_MHC_I_alpha3 Class I major histocompatibility 97.58
cd0577093 IgC_beta2m Class I major histocompatibility comple 97.57
cd05769115 IgC_TCR_beta T cell receptor (TCR) beta chain cons 97.46
cd05721115 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic 97.46
PHA03270466 envelope glycoprotein C; Provisional 97.46
cd0769893 IgC_MHC_I_alpha3 Class I major histocompatibility 97.43
PHA03273486 envelope glycoprotein C; Provisional 97.43
cd0769796 IgC_TCR_gamma T cell receptor (TCR) gamma chain co 97.42
cd05768102 IgC_CH4 CH4 domain (fourth constant Ig domain of t 97.41
PF0765483 C1-set: Immunoglobulin C1-set domain; InterPro: IP 97.4
cd05772111 IgC_SIRP Signal-regulatory protein (SIRP) immunogl 97.4
cd0009674 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) 97.4
cd0588796 Ig1_Nectin-3_like First immunoglobulin (Ig) domain 97.39
cd0576794 IgC_MHC_II_alpha Class II major histocompatibility 97.39
cd04981117 IgV_H Immunoglobulin (Ig) heavy chain (H), variabl 97.31
PF0820589 C2-set_2: CD80-like C2-set immunoglobulin domain ; 97.3
PHA03269566 envelope glycoprotein C; Provisional 97.27
cd0769169 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain 97.25
cd0571995 Ig2_PVR_like Second immunoglobulin (Ig) domain of 97.25
smart0006083 FN3 Fibronectin type 3 domain. One of three types 97.21
smart0040681 IGv Immunoglobulin V-Type. 97.16
cd07699100 IgC_L Immunoglobulin Constant domain. IgC_L: Immun 97.15
smart0040775 IGc1 Immunoglobulin C-Type. 97.14
cd0770395 Ig2_Nectin-2_like Second immunoglobulin (Ig) domai 97.14
cd0576694 IgC_MHC_II_beta Class II major histocompatibility 97.13
cd0769696 IgC_CH3 CH3 domain (third constant Ig domain of th 97.13
PHA0263363 hypothetical protein; Provisional 97.1
KOG4802|consensus 516 97.05
PF01108107 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH 96.99
PF08204130 V-set_CD47: CD47 immunoglobulin-like domain; Inter 96.98
cd0768999 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain 96.95
cd0577093 IgC_beta2m Class I major histocompatibility comple 96.92
cd0576794 IgC_MHC_II_alpha Class II major histocompatibility 96.9
cd0769265 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of 96.87
cd0588996 Ig1_DNAM-1_like First immunoglobulin (Ig) domain o 96.83
PHA02982251 hypothetical protein; Provisional 96.8
cd0571995 Ig2_PVR_like Second immunoglobulin (Ig) domain of 96.79
cd0584794 IgC_CH2_IgE CH2 domain (second constant Ig domain 96.76
PHA02982251 hypothetical protein; Provisional 96.75
PF11465108 Receptor_2B4: Natural killer cell receptor 2B4; In 96.73
KOG4258|consensus1025 96.67
cd0770395 Ig2_Nectin-2_like Second immunoglobulin (Ig) domai 96.57
PF10179300 DUF2369: Uncharacterised conserved protein (DUF236 96.54
PF0765483 C1-set: Immunoglobulin C1-set domain; InterPro: IP 96.49
cd05769115 IgC_TCR_beta T cell receptor (TCR) beta chain cons 96.45
PF0392191 ICAM_N: Intercellular adhesion molecule (ICAM), N- 96.44
cd0769169 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain 96.43
cd05768102 IgC_CH4 CH4 domain (fourth constant Ig domain of t 96.41
KOG4367|consensus699 96.34
cd0769696 IgC_CH3 CH3 domain (third constant Ig domain of th 96.27
KOG4152|consensus830 96.22
cd0770497 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) dom 96.19
cd05721115 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic 96.13
cd0498595 IgC_CH1 CH1 domain (first constant Ig domain of th 96.12
KOG1480|consensus 909 96.11
cd0498699 IgC_CH2 CH2 domain (second constant Ig domain of t 95.98
cd0769796 IgC_TCR_gamma T cell receptor (TCR) gamma chain co 95.88
PF09294106 Interfer-bind: Interferon-alpha/beta receptor, fib 95.87
cd0498595 IgC_CH1 CH1 domain (first constant Ig domain of th 95.86
cd0768999 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain 95.8
cd0498699 IgC_CH2 CH2 domain (second constant Ig domain of t 95.78
PHA0305269 Hypothetical protein; Provisional 95.76
cd0770497 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) dom 95.68
PHA02914500 Immunoglobulin-like domain protein; Provisional 95.5
PHA03270466 envelope glycoprotein C; Provisional 95.44
KOG4597|consensus560 95.35
PHA0263363 hypothetical protein; Provisional 95.13
PHA03042286 CD47-like protein; Provisional 95.04
KOG1480|consensus 909 95.04
PF0632889 Lep_receptor_Ig: Ig-like C2-type domain; InterPro: 94.6
PHA03271490 envelope glycoprotein C; Provisional 94.44
PF08204130 V-set_CD47: CD47 immunoglobulin-like domain; Inter 94.35
PF0579080 C2-set: Immunoglobulin C2-set domain; InterPro: IP 94.32
PF07354271 Sp38: Zona-pellucida-binding protein (Sp38); Inter 94.22
KOG4597|consensus560 94.01
COG3401343 Fibronectin type 3 domain-containing protein [Gene 93.53
PF07354271 Sp38: Zona-pellucida-binding protein (Sp38); Inter 93.21
PHA03273486 envelope glycoprotein C; Provisional 93.1
COG4733952 Phage-related protein, tail component [Function un 93.09
PF10179300 DUF2369: Uncharacterised conserved protein (DUF236 92.93
PF0749566 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi 92.82
PHA02914500 Immunoglobulin-like domain protein; Provisional 92.7
PF11465108 Receptor_2B4: Natural killer cell receptor 2B4; In 92.64
KOG4152|consensus830 92.44
PHA03042286 CD47-like protein; Provisional 92.3
KOG1026|consensus 774 92.02
PHA03189348 UL14 tegument protein; Provisional 91.91
PLN02533 427 probable purple acid phosphatase 91.54
PF09067104 EpoR_lig-bind: Erythropoietin receptor, ligand bin 91.34
PHA03269566 envelope glycoprotein C; Provisional 90.9
PF02010440 REJ: REJ domain; InterPro: IPR002859 The REJ (Rece 90.35
PF02010440 REJ: REJ domain; InterPro: IPR002859 The REJ (Rece 90.18
PF01108107 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH 89.95
PF0683289 BiPBP_C: Penicillin-Binding Protein C-terminus Fam 89.9
COG4733 952 Phage-related protein, tail component [Function un 88.74
PRK14081667 triple tyrosine motif-containing protein; Provisio 87.68
PF1114166 DUF2914: Protein of unknown function (DUF2914); In 87.17
PF0632889 Lep_receptor_Ig: Ig-like C2-type domain; InterPro: 86.73
PHA02865338 MHC-like TNF binding protein; Provisional 86.31
PF0579080 C2-set: Immunoglobulin C2-set domain; InterPro: IP 82.4
PF0683289 BiPBP_C: Penicillin-Binding Protein C-terminus Fam 80.36
PF0392191 ICAM_N: Intercellular adhesion molecule (ICAM), N- 80.13
>KOG3513|consensus Back     alignment and domain information
Probab=100.00  E-value=2.3e-58  Score=441.32  Aligned_cols=547  Identities=23%  Similarity=0.290  Sum_probs=401.4

Q ss_pred             EEEEEEeccCCCceEEEEECCEEeecCCceeEEEeCCeEEEEEcccC-CCCceEEEEEEEcCCeee-EEEEEEEEecCCC
Q psy12425         13 TKVKIFYAGDQPMEVSLTKNGRVVQSDDRFKFTVLDDYIIIFIKEIR-KEDAGDYTVNLSNSSGSV-SGTFTINITGLPG   90 (591)
Q Consensus        13 ~~l~C~~~~~p~~~v~W~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~-~~d~g~Y~c~~~n~~g~~-~~~~~l~v~~~p~   90 (591)
                      +.|.|.+.|+|.|+++|+|||..+......++...++  +|.|.+.. ..|.|.|+|.|.|..|.. +..+.|.....+.
T Consensus        60 v~l~C~A~G~P~Psy~W~kng~~~d~~~~~~~~~~~G--~lvI~~p~~~~d~G~YqC~AsN~~Gta~S~~~~l~~~~i~~  137 (1051)
T KOG3513|consen   60 VTLNCEANGNPEPSYRWTKNGTEFDPTEYPRVSVLGG--TLVITNPDAALDQGIYQCFASNKLGTAVSREARLQFGFIPK  137 (1051)
T ss_pred             EEEEEEecCCCCceeEEEECCeecccccccceeeecC--ceEecCCcchhhcceeEEEeecccceeeccceeeccccccc
Confidence            9999999999999999999999887664444444433  67788777 789999999999999998 5568888888777


Q ss_pred             CCCCCc-ceEEecCceEEEEecCCCCCCCcceeeEEEEEEecCCCceEE--EEeecCcceEEEcCCcCCcEEEEEEEEEc
Q psy12425         91 PPIGPL-DVSEITKHTCTLHWNPPKYDGGLKVTHYVVERRDISMPHWIC--ISTTCHDTTFIVQGLTEGQEYLFHVMAVN  167 (591)
Q Consensus        91 ~p~~~~-~~~~~~~~~~~l~w~~p~~~~~~~~~~y~~~~~~~~~~~~~~--~~~~~~~~~~~i~~l~~~~~y~~~~~a~n  167 (591)
                      .+.... .+....+..+.|.|.||.   +.+-..|.+-...........  -........+-+..+...+...|.|.|.+
T Consensus       138 F~~e~~~~v~v~eG~~~~L~C~pP~---~~P~l~~~W~~~~~~~~~~~~~~r~~~~~~G~Lyfs~V~~~D~~~Y~C~a~~  214 (1051)
T KOG3513|consen  138 FKKEERSPVEVEEGDGVVLPCNPPA---HFPPLRYYWMLNEFPHFVQIDNRRVFSQENGNLYFSNVETSDFGNYICSATF  214 (1051)
T ss_pred             CccccCCcEEEEeCCceEEeCCCCC---CCCCccEEehhccCCcccccCcceeEecccceEEEeecchhhcCceEEEEEc
Confidence            664322 345567888999999988   333334444332221111000  11234566788888888888999999987


Q ss_pred             cCCCCCCCCccCcccc-cCC---CCCCCCCCC--CeEEeecCCeEEEEEecCCCCCCcceEEEEEEeeecCCCccEEEEe
Q psy12425        168 ENGMGPPLEGINPIKA-KSP---YDKPSPPGI--PVVTQVGGDFVNLSWDKPLDDGGSRIQGYWIDKHEVGSDAWQRVNV  241 (591)
Q Consensus       168 ~~g~~~~~~~~~~~~~-~~~---~~~p~~~~~--~~~~~~~~~~v~l~w~~~~~~~~~~~~~y~~~~~~~~~~~~~~~~~  241 (591)
                      ..-..........+.. ...   ...|..+..  .......|..+.|.|.+-..+- ..+.++     ..+...+..-..
T Consensus       215 ~~~~~~v~~~~~~L~~~~~~~~~~~~P~i~~~~p~~~~a~~G~~v~LECfA~G~P~-P~i~W~-----k~~g~~~~~r~~  288 (1051)
T KOG3513|consen  215 PSTQTIVQGPPFPLIVRSNNVMREYAPKILVPFPETETALKGQSVKLECFALGNPT-PQIKWR-----KVDGKPPPRRAT  288 (1051)
T ss_pred             hhhcccccCCceeEEEcccccccccCCccccCCCCcccccCCCeEEEEEEecCCCC-CcEEEE-----eCCCCCCCccee
Confidence            4322111111111111 000   011111111  1566678999999999853222 122222     223323333333


Q ss_pred             eecCCceeeecCcccCCcEEEEEEEEcCCCCCCCCCCcceEEEcCCCccCCCeEEeeccccceeccccEEEEEEEcCCCC
Q psy12425        242 AICAPSQINIPNLIEGRQYEFRVYAQNEAGLSLPSSASNSVQIKDPMAAKAPEIIVPLRNANAIQNHNAQFQCTITGCPK  321 (591)
Q Consensus       242 ~~~~~~~~~i~~l~~~~~~~y~c~a~n~~g~~~~s~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~g~~~~l~c~~~~~p~  321 (591)
                      .......|.|.++..+|+|.|+|.|.|..|..   .....+.+.     .+|.++..+++..+..|+++.|.|.+.|.|.
T Consensus       289 ~~~~~~vL~I~nv~~~D~G~Y~C~AeN~~G~~---~~~~~v~v~-----a~P~w~~~~~d~~~~~gs~v~~eC~a~g~P~  360 (1051)
T KOG3513|consen  289 YSNYGKVLKIPNVQYEDAGEYECIAENSRGSA---THSGHVTVY-----APPYWLQKPQDTEADTGSNVTLECKASGKPN  360 (1051)
T ss_pred             eeccccEEEecccCcCCCeEEEEEEecccccc---eeeEEEEEe-----cCchhhcccceeEecCCCCeEEEEEecCCCC
Confidence            34456789999999999999999999999843   245566665     6899999999999999999999999999999


Q ss_pred             CeeEEecCCccCCCCCc---eEEEEeCCeEEEEEcceecccceEEEEEEEeCCcceeeeeEEEEecC-CcccCCCCcccc
Q psy12425        322 PTISWLKGSREITPSAR---HHIFAEGDTYTLIINSVYGVDADEYVCRAVNKGGVKSTKAELIIMTA-PKFNVPPRFRDT  397 (591)
Q Consensus       322 ~~v~W~~~~~~~~~~~~---~~~~~~~~~~~l~i~~~~~~d~g~y~c~a~n~~g~~~~~~~l~v~~~-p~~~~~~~~~~~  397 (591)
                      |.+.|++||..+....+   +.+ .+|   .|+|.++...|+|.|.|.|+|..|.....+.|.|... |.+... .....
T Consensus       361 p~v~WlkNg~pl~~~~r~~~~~i-~~g---~L~is~v~~~dsg~YQC~A~Nk~G~i~anA~L~V~a~~P~f~~~-p~~~~  435 (1051)
T KOG3513|consen  361 PTVKWLKNGEPLEPAERDPRYKI-DDG---TLIISNVQESDSGVYQCIAENKYGTIYANAELKVLASAPVFPLN-PVERK  435 (1051)
T ss_pred             CceEEeeCCeecCccCCCcceEE-eCC---EEEEEecccccCeEEEeeeecccceEeeeeEEEEEccCCCCCCC-ccceE
Confidence            99999999999886665   544 333   7999999999999999999999999999999999987 554443 34455


Q ss_pred             eeecCCCeEEEEEeeeccCCCeEEEeeCCeEeeeccceEEEecCCeeEEEEeccCCCcceeEEEEEEcCCC---------
Q psy12425        398 AYFDKGENVVVKIPFTGYPKPKITWYRDNEVIESGGHFHVETSERHAILTIRDASNVDTAPYRVVAENDLG---------  468 (591)
Q Consensus       398 ~~~~~g~~~~l~c~~~~~p~~~v~W~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~~~g~y~c~a~n~~g---------  468 (591)
                      ..+..|..+.+.|...+.|.|.++|.+++..+..++++.+..   ..+|.|.+++.+|+|.|+|.|.|..|         
T Consensus       436 ~~a~~g~~v~i~C~~~asP~p~~~W~k~~~~~~~~~r~~i~e---dGtL~I~n~t~~DaG~YtC~A~N~~G~a~~~~~L~  512 (1051)
T KOG3513|consen  436 VMAVVGGTVTIDCKPFASPKPKVSWLKGGEKLLQSGRIRILE---DGTLEISNVTRSDAGKYTCVAENKLGKAESTGNLI  512 (1051)
T ss_pred             EEEEeCCeEEEeeccCCCCcceEEEEcCCcccccCceEEECC---CCcEEecccCcccCcEEEEEEEcccCccceEEEEE
Confidence            667899999999999999999999999988666667776653   33444444444444444444444444         


Q ss_pred             --------------------------------------------------------------------------------
Q psy12425        469 --------------------------------------------------------------------------------  468 (591)
Q Consensus       469 --------------------------------------------------------------------------------  468 (591)
                                                                                                      
T Consensus       513 Vkd~tri~~~P~~~~v~~g~~v~l~Ce~shD~~ld~~f~W~~nG~~id~~~~~~~~~~~~~~~~g~L~i~nv~l~~~G~Y  592 (1051)
T KOG3513|consen  513 VKDATRITLAPSNTDVKVGESVTLTCEASHDPSLDITFTWKKNGRPIDFNPDGDHFEINDGSDSGRLTIANVSLEDSGKY  592 (1051)
T ss_pred             EecCceEEeccchhhhccCceEEEEeecccCCCcceEEEEEECCEEhhccCCCCceEEeCCcCccceEEEeeccccCceE
Confidence                                                                                            


Q ss_pred             ---------ccceEEEEEecCCCCCCCCCeeeeecCCeeEEEeeccccCCCcceeeEEEEeeeCCCCceEEec--eeee-
Q psy12425        469 ---------MDSAIVKIQISDRPDPPQFPTVEDIGHDSLALVWRAPIWDGGSNITNYIVEKREHPMSSWIRVG--NTRF-  536 (591)
Q Consensus       469 ---------~~~~~~~~~v~~~p~~p~~~~~~~~~~~~v~l~W~~p~~~~~~~~~~y~v~~~~~~~~~~~~~~--~~~~-  536 (591)
                               +.+..+.+.|.++|.||.++.+...+.+++.|+|++.. |+.++|..|.++.+......|+.+.  .... 
T Consensus       593 ~C~aqT~~Ds~s~~A~l~V~gpPgpP~~v~~~~i~~t~~~lsW~~g~-dn~SpI~~Y~iq~rt~~~~~W~~v~~vp~~~~  671 (1051)
T KOG3513|consen  593 TCVAQTALDSASARADLLVRGPPGPPPDVHVDDISDTTARLSWSPGS-DNNSPIEKYTIQFRTPFPGKWKAVTTVPGNIT  671 (1051)
T ss_pred             EEEEEEeecchhcccceEEecCCCCCCceeEeeeccceEEEEeecCC-CCCCCceEEeEEecCCCCCcceEeeECCCccc
Confidence                     44444455556788999999999999999999999655 6667899999999999889998773  1111 


Q ss_pred             --eEEEEcCcccCceEEEEEEEEcCCcCCCCCCCcceEEeccccccCCCCCce
Q psy12425        537 --TTMAITGLSPGHQYEFRVYAENVYGRSDPSTTSDLITTYGELLSGMEAPIS  587 (591)
Q Consensus       537 --~~~~i~~l~~~~~Y~~~v~A~n~~G~~~~s~~~~~~~t~~~~p~~~~~~~~  587 (591)
                        .+.++.+|.|...|+|||+|.|.+|.|++|.++..++|.+++|...|.++.
T Consensus       672 ~~~sa~vv~L~Pwv~YeFRV~AvN~iG~gePS~pS~~~rT~ea~P~~~P~nv~  724 (1051)
T KOG3513|consen  672 GDESATVVNLSPWVEYEFRVVAVNSIGIGEPSPPSEKVRTPEAAPSVNPSNVK  724 (1051)
T ss_pred             CccceeEEccCCCcceEEEEEEEcccccCCCCCCccceecCCCCCccCCcccc
Confidence              357788999999999999999999999999999999999999999887663



>KOG3513|consensus Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) Back     alignment and domain information
>KOG3515|consensus Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) Back     alignment and domain information
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) Back     alignment and domain information
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins Back     alignment and domain information
>PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) Back     alignment and domain information
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 Back     alignment and domain information
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin Back     alignment and domain information
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 Back     alignment and domain information
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 Back     alignment and domain information
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 Back     alignment and domain information
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin Back     alignment and domain information
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha Back     alignment and domain information
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) Back     alignment and domain information
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 Back     alignment and domain information
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) Back     alignment and domain information
>KOG3515|consensus Back     alignment and domain information
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 Back     alignment and domain information
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin Back     alignment and domain information
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) Back     alignment and domain information
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 Back     alignment and domain information
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd04968 Ig3_Contactin_like Third Ig domain of contactin Back     alignment and domain information
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) Back     alignment and domain information
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins Back     alignment and domain information
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin Back     alignment and domain information
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) Back     alignment and domain information
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB Back     alignment and domain information
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 Back     alignment and domain information
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) Back     alignment and domain information
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) Back     alignment and domain information
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins Back     alignment and domain information
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin Back     alignment and domain information
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin Back     alignment and domain information
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin Back     alignment and domain information
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin Back     alignment and domain information
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins Back     alignment and domain information
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 Back     alignment and domain information
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 Back     alignment and domain information
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 Back     alignment and domain information
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) Back     alignment and domain information
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) Back     alignment and domain information
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha Back     alignment and domain information
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) Back     alignment and domain information
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin Back     alignment and domain information
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 Back     alignment and domain information
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins Back     alignment and domain information
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>KOG0613|consensus Back     alignment and domain information
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 Back     alignment and domain information
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) Back     alignment and domain information
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) Back     alignment and domain information
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 Back     alignment and domain information
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) Back     alignment and domain information
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) Back     alignment and domain information
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 Back     alignment and domain information
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin Back     alignment and domain information
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) Back     alignment and domain information
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd04968 Ig3_Contactin_like Third Ig domain of contactin Back     alignment and domain information
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 Back     alignment and domain information
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) Back     alignment and domain information
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 Back     alignment and domain information
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) Back     alignment and domain information
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) Back     alignment and domain information
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB Back     alignment and domain information
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin Back     alignment and domain information
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins Back     alignment and domain information
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) Back     alignment and domain information
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin Back     alignment and domain information
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin Back     alignment and domain information
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D Back     alignment and domain information
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) Back     alignment and domain information
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) Back     alignment and domain information
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) Back     alignment and domain information
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins Back     alignment and domain information
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
>cd04967 Ig1_Contactin First Ig domain of contactin Back     alignment and domain information
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 Back     alignment and domain information
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 Back     alignment and domain information
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins Back     alignment and domain information
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) Back     alignment and domain information
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) Back     alignment and domain information
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 Back     alignment and domain information
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 Back     alignment and domain information
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins Back     alignment and domain information
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) Back     alignment and domain information
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins Back     alignment and domain information
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) Back     alignment and domain information
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) Back     alignment and domain information
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) Back     alignment and domain information
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>smart00410 IG_like Immunoglobulin like Back     alignment and domain information
>smart00409 IG Immunoglobulin Back     alignment and domain information
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) Back     alignment and domain information
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) Back     alignment and domain information
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain Back     alignment and domain information
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin Back     alignment and domain information
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 Back     alignment and domain information
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins Back     alignment and domain information
>smart00408 IGc2 Immunoglobulin C-2 Type Back     alignment and domain information
>PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A Back     alignment and domain information
>cd04967 Ig1_Contactin First Ig domain of contactin Back     alignment and domain information
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) Back     alignment and domain information
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) Back     alignment and domain information
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) Back     alignment and domain information
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) Back     alignment and domain information
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2) Back     alignment and domain information
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D Back     alignment and domain information
>PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs Back     alignment and domain information
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins Back     alignment and domain information
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) Back     alignment and domain information
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B Back     alignment and domain information
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin Back     alignment and domain information
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) Back     alignment and domain information
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins Back     alignment and domain information
>PHA03376 BARF1; Provisional Back     alignment and domain information
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) Back     alignment and domain information
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) Back     alignment and domain information
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) Back     alignment and domain information
>smart00408 IGc2 Immunoglobulin C-2 Type Back     alignment and domain information
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins Back     alignment and domain information
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain Back     alignment and domain information
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain Back     alignment and domain information
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan Back     alignment and domain information
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) Back     alignment and domain information
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) Back     alignment and domain information
>PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A Back     alignment and domain information
>smart00409 IG Immunoglobulin Back     alignment and domain information
>smart00410 IG_like Immunoglobulin like Back     alignment and domain information
>KOG4258|consensus Back     alignment and domain information
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) Back     alignment and domain information
>PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs Back     alignment and domain information
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins Back     alignment and domain information
>cd00099 IgV Immunoglobulin variable domain (IgV) Back     alignment and domain information
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) Back     alignment and domain information
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like Back     alignment and domain information
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain Back     alignment and domain information
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin Back     alignment and domain information
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG) Back     alignment and domain information
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain Back     alignment and domain information
>PF07686 V-set: Immunoglobulin V-set domain; InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2) Back     alignment and domain information
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B Back     alignment and domain information
>PHA02987 Ig domain OX-2-like protein; Provisional Back     alignment and domain information
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) Back     alignment and domain information
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan Back     alignment and domain information
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) Back     alignment and domain information
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins) Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins Back     alignment and domain information
>cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) Back     alignment and domain information
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican Back     alignment and domain information
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain Back     alignment and domain information
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI Back     alignment and domain information
>PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C Back     alignment and domain information
>PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C Back     alignment and domain information
>KOG0613|consensus Back     alignment and domain information
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins Back     alignment and domain information
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins Back     alignment and domain information
>cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins Back     alignment and domain information
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins Back     alignment and domain information
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) Back     alignment and domain information
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain Back     alignment and domain information
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain Back     alignment and domain information
>cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain Back     alignment and domain information
>cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively) Back     alignment and domain information
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins Back     alignment and domain information
>cd00098 IgC Immunoglobulin Constant domain Back     alignment and domain information
>cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd00099 IgV Immunoglobulin variable domain (IgV) Back     alignment and domain information
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain Back     alignment and domain information
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins Back     alignment and domain information
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain Back     alignment and domain information
>PHA03376 BARF1; Provisional Back     alignment and domain information
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) Back     alignment and domain information
>cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) Back     alignment and domain information
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain Back     alignment and domain information
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain Back     alignment and domain information
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins Back     alignment and domain information
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like Back     alignment and domain information
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins Back     alignment and domain information
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI Back     alignment and domain information
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG) Back     alignment and domain information
>cd00096 Ig Immunoglobulin domain Back     alignment and domain information
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>PF07686 V-set: Immunoglobulin V-set domain; InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) Back     alignment and domain information
>cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively) Back     alignment and domain information
>cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain Back     alignment and domain information
>cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>smart00407 IGc1 Immunoglobulin C-Type Back     alignment and domain information
>cd00098 IgC Immunoglobulin Constant domain Back     alignment and domain information
>PHA03271 envelope glycoprotein C; Provisional Back     alignment and domain information
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain Back     alignment and domain information
>cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>smart00406 IGv Immunoglobulin V-Type Back     alignment and domain information
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican Back     alignment and domain information
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain Back     alignment and domain information
>cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan Back     alignment and domain information
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins Back     alignment and domain information
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain Back     alignment and domain information
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) Back     alignment and domain information
>PF08205 C2-set_2: CD80-like C2-set immunoglobulin domain ; InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain Back     alignment and domain information
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins Back     alignment and domain information
>cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain Back     alignment and domain information
>cd07699 IgC_L Immunoglobulin Constant domain Back     alignment and domain information
>PHA02987 Ig domain OX-2-like protein; Provisional Back     alignment and domain information
>cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE) Back     alignment and domain information
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins Back     alignment and domain information
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins) Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin Back     alignment and domain information
>cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain Back     alignment and domain information
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) Back     alignment and domain information
>PHA03270 envelope glycoprotein C; Provisional Back     alignment and domain information
>cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>PHA03273 envelope glycoprotein C; Provisional Back     alignment and domain information
>cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain Back     alignment and domain information
>cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>PF07654 C1-set: Immunoglobulin C1-set domain; InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain Back     alignment and domain information
>cd00096 Ig Immunoglobulin domain Back     alignment and domain information
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins Back     alignment and domain information
>cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain Back     alignment and domain information
>PF08205 C2-set_2: CD80-like C2-set immunoglobulin domain ; InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>PHA03269 envelope glycoprotein C; Provisional Back     alignment and domain information
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains Back     alignment and domain information
>cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>smart00406 IGv Immunoglobulin V-Type Back     alignment and domain information
>cd07699 IgC_L Immunoglobulin Constant domain Back     alignment and domain information
>smart00407 IGc1 Immunoglobulin C-Type Back     alignment and domain information
>cd07703 Ig2_Nectin-2_like Second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112) and similar proteins Back     alignment and domain information
>cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain Back     alignment and domain information
>cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>PHA02633 hypothetical protein; Provisional Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R Back     alignment and domain information
>PF08204 V-set_CD47: CD47 immunoglobulin-like domain; InterPro: IPR013270 This family represents the CD47 leukocyte antigen V-set like Ig domain [, ] Back     alignment and domain information
>cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin Back     alignment and domain information
>cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain Back     alignment and domain information
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins Back     alignment and domain information
>PHA02982 hypothetical protein; Provisional Back     alignment and domain information
>cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE) Back     alignment and domain information
>PHA02982 hypothetical protein; Provisional Back     alignment and domain information
>PF11465 Receptor_2B4: Natural killer cell receptor 2B4; InterPro: IPR024303 2B4 is a transmembrane receptor which is expressed primarily on natural killer (NK) cells Back     alignment and domain information
>KOG4258|consensus Back     alignment and domain information
>cd07703 Ig2_Nectin-2_like Second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112) and similar proteins Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>PF07654 C1-set: Immunoglobulin C1-set domain; InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain Back     alignment and domain information
>PF03921 ICAM_N: Intercellular adhesion molecule (ICAM), N-terminal domain; InterPro: IPR013768 Intercellular adhesion molecules (ICAMs) and vascular cell adhesion molecule-1 (VCAM-1) are part of the immunoglobulin superfamily Back     alignment and domain information
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains Back     alignment and domain information
>cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>cd07704 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3), nectin-4 (poliovirus receptor related protein 4) and similar proteins Back     alignment and domain information
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) Back     alignment and domain information
>cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>KOG1480|consensus Back     alignment and domain information
>cd04986 IgC_CH2 CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain Back     alignment and domain information
>PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology Back     alignment and domain information
>cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>cd04986 IgC_CH2 CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>PHA03052 Hypothetical protein; Provisional Back     alignment and domain information
>cd07704 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3), nectin-4 (poliovirus receptor related protein 4) and similar proteins Back     alignment and domain information
>PHA02914 Immunoglobulin-like domain protein; Provisional Back     alignment and domain information
>PHA03270 envelope glycoprotein C; Provisional Back     alignment and domain information
>KOG4597|consensus Back     alignment and domain information
>PHA02633 hypothetical protein; Provisional Back     alignment and domain information
>PHA03042 CD47-like protein; Provisional Back     alignment and domain information
>KOG1480|consensus Back     alignment and domain information
>PF06328 Lep_receptor_Ig: Ig-like C2-type domain; InterPro: IPR010457 This entry represents a ligand-binding domain that displays similarity to C2-set immunoglobulin domains (antibody constant domain 2) [] Back     alignment and domain information
>PHA03271 envelope glycoprotein C; Provisional Back     alignment and domain information
>PF08204 V-set_CD47: CD47 immunoglobulin-like domain; InterPro: IPR013270 This family represents the CD47 leukocyte antigen V-set like Ig domain [, ] Back     alignment and domain information
>PF05790 C2-set: Immunoglobulin C2-set domain; InterPro: IPR008424 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>PF07354 Sp38: Zona-pellucida-binding protein (Sp38); InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals Back     alignment and domain information
>KOG4597|consensus Back     alignment and domain information
>COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] Back     alignment and domain information
>PF07354 Sp38: Zona-pellucida-binding protein (Sp38); InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals Back     alignment and domain information
>PHA03273 envelope glycoprotein C; Provisional Back     alignment and domain information
>COG4733 Phage-related protein, tail component [Function unknown] Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators Back     alignment and domain information
>PHA02914 Immunoglobulin-like domain protein; Provisional Back     alignment and domain information
>PF11465 Receptor_2B4: Natural killer cell receptor 2B4; InterPro: IPR024303 2B4 is a transmembrane receptor which is expressed primarily on natural killer (NK) cells Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>PHA03042 CD47-like protein; Provisional Back     alignment and domain information
>KOG1026|consensus Back     alignment and domain information
>PHA03189 UL14 tegument protein; Provisional Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>PF09067 EpoR_lig-bind: Erythropoietin receptor, ligand binding; InterPro: IPR015152 Members of this entry include the growth hormone and erythropoietin receptors Back     alignment and domain information
>PHA03269 envelope glycoprotein C; Provisional Back     alignment and domain information
>PF02010 REJ: REJ domain; InterPro: IPR002859 The REJ (Receptor for Egg Jelly) domain is found in PKD1 P98161 from SWISSPROT and the sperm receptor for egg jelly Q26627 from SWISSPROT Back     alignment and domain information
>PF02010 REJ: REJ domain; InterPro: IPR002859 The REJ (Receptor for Egg Jelly) domain is found in PKD1 P98161 from SWISSPROT and the sperm receptor for egg jelly Q26627 from SWISSPROT Back     alignment and domain information
>PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R Back     alignment and domain information
>PF06832 BiPBP_C: Penicillin-Binding Protein C-terminus Family; InterPro: IPR009647 This conserved region of approximately 90 residues is found in a sub-group of bacterial Penicillin-Binding Proteins (PBPs) Back     alignment and domain information
>COG4733 Phage-related protein, tail component [Function unknown] Back     alignment and domain information
>PRK14081 triple tyrosine motif-containing protein; Provisional Back     alignment and domain information
>PF11141 DUF2914: Protein of unknown function (DUF2914); InterPro: IPR022606 This bacterial family of proteins has no known function Back     alignment and domain information
>PF06328 Lep_receptor_Ig: Ig-like C2-type domain; InterPro: IPR010457 This entry represents a ligand-binding domain that displays similarity to C2-set immunoglobulin domains (antibody constant domain 2) [] Back     alignment and domain information
>PHA02865 MHC-like TNF binding protein; Provisional Back     alignment and domain information
>PF05790 C2-set: Immunoglobulin C2-set domain; InterPro: IPR008424 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>PF06832 BiPBP_C: Penicillin-Binding Protein C-terminus Family; InterPro: IPR009647 This conserved region of approximately 90 residues is found in a sub-group of bacterial Penicillin-Binding Proteins (PBPs) Back     alignment and domain information
>PF03921 ICAM_N: Intercellular adhesion molecule (ICAM), N-terminal domain; InterPro: IPR013768 Intercellular adhesion molecules (ICAMs) and vascular cell adhesion molecule-1 (VCAM-1) are part of the immunoglobulin superfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query591
2nzi_A305 Crystal Structure Of Domains A168-A170 From Titin L 3e-46
3lpw_A197 Crystal Structure Of The Fniii-Tandem A77-A78 From 1e-36
3lpw_A197 Crystal Structure Of The Fniii-Tandem A77-A78 From 1e-15
2j8h_A197 Structure Of The Immunoglobulin Tandem Repeat A168- 6e-23
2ill_A195 Anomalous Substructure Of Titin-A168169 Length = 19 1e-22
3lcy_A197 Titin Ig Tandem Domains A164-A165 Length = 197 5e-19
3uto_A 573 Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- 5e-18
3b43_A 570 I-band Fragment I65-i70 From Titin Length = 570 1e-14
1ya5_A201 Crystal Structure Of The Titin Domains Z1z2 In Comp 3e-14
1ya5_A201 Crystal Structure Of The Titin Domains Z1z2 In Comp 2e-04
2rjm_A284 3ig Structure Of Titin Domains I67-I69 E-To-A Mutat 1e-13
2rjm_A284 3ig Structure Of Titin Domains I67-I69 E-To-A Mutat 1e-06
2rik_A284 I-Band Fragment I67-I69 From Titin Length = 284 1e-13
2rik_A284 I-Band Fragment I67-I69 From Titin Length = 284 4e-07
2a38_A194 Crystal Structure Of The N-Terminus Of Titin Length 2e-13
2a38_A194 Crystal Structure Of The N-Terminus Of Titin Length 3e-04
2jll_A389 Crystal Structure Of Ncam2 Igiv-Fn3ii Length = 389 3e-13
2xyc_A291 Crystal Structure Of Ncam2 Igiv-Fn3i Length = 291 3e-13
3laf_A403 Structure Of Dcc, A Netrin-1 Receptor Length = 403 1e-12
2iep_A192 Crystal Structure Of Immunoglobulin-Like Domains 1 1e-12
2yux_A120 Solution Structure Of 3rd Fibronectin Type Three Do 2e-12
1bpv_A112 Titin Module A71 From Human Cardiac Muscle, Nmr, 50 1e-11
1bpv_A112 Titin Module A71 From Human Cardiac Muscle, Nmr, 50 1e-10
2xy1_A192 Crystal Structure Of Ncam2 Ig3-4 Length = 192 2e-11
2xy1_A192 Crystal Structure Of Ncam2 Ig3-4 Length = 192 8e-06
2v5t_A189 Crystal Structure Of Ncam2 Ig2-3 Length = 189 2e-10
2wim_A291 Crystal Structure Of Ncam2 Ig1-3 Length = 291 2e-10
3pxh_A201 Tandem Ig Domains Of Tyrosine Phosphatase Lar Lengt 6e-10
3dmk_A816 Crystal Structure Of Down Syndrome Cell Adhesion Mo 1e-09
2yd9_A304 Crystal Structure Of The N-Terminal Ig1-3 Module Of 1e-09
3pxj_A210 Tandem Ig Repeats Of Dlar Length = 210 7e-09
2yd5_A214 Crystal Structure Of The N-Terminal Ig1-2 Module Of 9e-09
1koa_A491 Twitchin Kinase Fragment (C.Elegans), Autoregulated 2e-08
1qz1_A291 Crystal Structure Of The Ig 1-2-3 Fragment Of Ncam 7e-08
2vra_A208 Drosophila Robo Ig1-2 (Monoclinic Form) Length = 20 1e-07
2vr9_A217 Drosophila Robo Ig1-2 (Tetragonal Form) Length = 21 1e-07
2yd1_A212 Crystal Structure Of The N-Terminal Ig1-2 Module Of 2e-07
2e7c_A118 Solution Structure Of The 6th Ig-Like Domain From H 3e-07
3knb_A100 Crystal Structure Of The Titin C-Terminus In Comple 4e-07
2wp3_T102 Crystal Structure Of The Titin M10-Obscurin Like 1 4e-07
1uem_A117 Solution Structure Of The First Fibronectin Type Ii 4e-07
2yd3_A202 Crystal Structure Of The N-Terminal Ig1-2 Module Of 7e-07
2yd2_A214 Crystal Structure Of The N-Terminal Ig1-2 Module Of 8e-07
3ojv_C226 Crystal Structure Of Fgf1 Complexed With The Ectodo 1e-06
1cvs_C225 Crystal Structure Of A Dimeric Fgf2-Fgfr1 Complex L 2e-06
2om5_A381 N-Terminal Fragment Of Human Tax1 Length = 381 2e-06
3knb_B107 Crystal Structure Of The Titin C-Terminus In Comple 2e-06
1tlk_A154 X-Ray Structure Determination Of Telokin, The C-Ter 2e-06
1tlk_A154 X-Ray Structure Determination Of Telokin, The C-Ter 8e-04
1evt_C225 Crystal Structure Of Fgf1 In Complex With The Extra 2e-06
2yd4_A210 Crystal Structure Of The N-Terminal Ig1-2 Module Of 2e-06
1fhg_A154 High Resolution Refinement Of Telokin Length = 154 3e-06
1fhg_A154 High Resolution Refinement Of Telokin Length = 154 8e-04
2wwk_O109 Crystal Structure Of The Titin M10-Obscurin Like 1 5e-06
2yd6_A212 Crystal Structure Of The N-Terminal Ig1-2 Module Of 5e-06
2wp3_O109 Crystal Structure Of The Titin M10-Obscurin Like 1 5e-06
2cqv_A114 Solution Structure Of The Eighth Ig-Like Domain Of 8e-06
3mtr_A215 Crystal Structure Of The Ig5-Fn1 Tandem Of Human Nc 8e-06
2dm3_A110 Solution Structure Of The Second Ig Domain Of Human 1e-05
2v5s_A394 Structural Basis For Dscam Isoform Specificity Leng 2e-05
2v5m_A388 Structural Basis For Dscam Isoform Specificity Leng 2e-05
1nct_A106 Titin Module M5, N-Terminally Extended, Nmr Length 3e-05
3p3y_A404 Crystal Structure Of Neurofascin Homophilic Adhesio 3e-05
1x3d_A118 Solution Structure Of The Fibronectin Type-Iii Doma 4e-05
1tnm_A100 Tertiary Structure Of An Immunoglobulin-Like Domain 4e-05
3jxa_A383 Immunoglobulin Domains 1-4 Of Mouse Cntn4 Length = 8e-05
3kld_A384 Ptprg Cntn4 Complex Length = 384 9e-05
1u2h_A99 X-Ray Structure Of The N-Terminally Truncated Human 1e-04
1g1c_A99 I1 Domain From Titin Length = 99 1e-04
3puc_A99 Atomic Resolution Structure Of Titin Domain M7 Leng 2e-04
2v9q_A212 First And Second Ig Domains From Human Robo1 Length 2e-04
1x4z_A121 Solution Structure Of The 2nd Fibronectin Type Iii 3e-04
2dku_A103 Solution Structure Of The Third Ig-Like Domain Of H 3e-04
3v6b_R424 Vegfr-2VEGF-E Complex Structure Length = 424 6e-04
1ie5_A107 Nmr Structure Of The Third Immunoglobulin Domain Fr 6e-04
1ry7_B334 Crystal Structure Of The 3 Ig Form Of Fgfr3c In Com 6e-04
3grw_A241 Fgfr3 In Complex With A Fab Length = 241 7e-04
3v2a_R 772 Vegfr-2VEGF-A Complex Structure Length = 772 7e-04
1cs6_A382 N-terminal Fragment Of Axonin-1 From Chicken Length 7e-04
>pdb|2NZI|A Chain A, Crystal Structure Of Domains A168-A170 From Titin Length = 305 Back     alignment and structure

Iteration: 1

Score = 183 bits (464), Expect = 3e-46, Method: Compositional matrix adjust. Identities = 107/287 (37%), Positives = 142/287 (49%), Gaps = 5/287 (1%) Query: 289 AAKAPEIIVPLRNANAIQNHNAQFQCTITGCPKPTISWLKGSREITPSARHHIFAE--GD 346 A AP LRN N NA C +TG PKP + W + +EI + E G Sbjct: 1 GAMAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGG 60 Query: 347 TYTLIINSVYGVDADEYVCRAVNKGGVKSTKAELIIMTAPKFNVPPRFRDTAYFD--KGE 404 + LII SV DA Y RA N+GG S A L + K ++P +GE Sbjct: 61 YHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGE 120 Query: 405 NVVVKIPFTGYPKPKITWYRDNEVIESGGHFHVETSERHAILTIRDA-SNVDTAPYRVVA 463 V +KIPF+G P P ITW + ++I++ GH+ V + L + D Y V A Sbjct: 121 VVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCA 180 Query: 464 ENDLGMDSAIVKIQISDRPDPPQFPTVEDIGHDSLALVWRAPIWDGGSNITNYIVEKREH 523 +N G+D V++ ++D PDPP+ V D+ DS+ L W P DGGS ITNYIVEK Sbjct: 181 KNRFGIDQKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCAT 240 Query: 524 PMSSWIRVGNTRFTTMAITGLSPGHQYEFRVYAENVYGRSDPSTTSD 570 W+RVG R T + L Y+FRV AEN +G S PS S+ Sbjct: 241 TAERWLRVGQARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSE 287
>pdb|3LPW|A Chain A, Crystal Structure Of The Fniii-Tandem A77-A78 From The A-Band Of Titin Length = 197 Back     alignment and structure
>pdb|3LPW|A Chain A, Crystal Structure Of The Fniii-Tandem A77-A78 From The A-Band Of Titin Length = 197 Back     alignment and structure
>pdb|2J8H|A Chain A, Structure Of The Immunoglobulin Tandem Repeat A168-A169 Of Titin Length = 197 Back     alignment and structure
>pdb|2ILL|A Chain A, Anomalous Substructure Of Titin-A168169 Length = 195 Back     alignment and structure
>pdb|3LCY|A Chain A, Titin Ig Tandem Domains A164-A165 Length = 197 Back     alignment and structure
>pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 Back     alignment and structure
>pdb|3B43|A Chain A, I-band Fragment I65-i70 From Titin Length = 570 Back     alignment and structure
>pdb|1YA5|A Chain A, Crystal Structure Of The Titin Domains Z1z2 In Complex With Telethonin Length = 201 Back     alignment and structure
>pdb|1YA5|A Chain A, Crystal Structure Of The Titin Domains Z1z2 In Complex With Telethonin Length = 201 Back     alignment and structure
>pdb|2RJM|A Chain A, 3ig Structure Of Titin Domains I67-I69 E-To-A Mutated Variant Length = 284 Back     alignment and structure
>pdb|2RJM|A Chain A, 3ig Structure Of Titin Domains I67-I69 E-To-A Mutated Variant Length = 284 Back     alignment and structure
>pdb|2RIK|A Chain A, I-Band Fragment I67-I69 From Titin Length = 284 Back     alignment and structure
>pdb|2RIK|A Chain A, I-Band Fragment I67-I69 From Titin Length = 284 Back     alignment and structure
>pdb|2A38|A Chain A, Crystal Structure Of The N-Terminus Of Titin Length = 194 Back     alignment and structure
>pdb|2A38|A Chain A, Crystal Structure Of The N-Terminus Of Titin Length = 194 Back     alignment and structure
>pdb|2JLL|A Chain A, Crystal Structure Of Ncam2 Igiv-Fn3ii Length = 389 Back     alignment and structure
>pdb|2XYC|A Chain A, Crystal Structure Of Ncam2 Igiv-Fn3i Length = 291 Back     alignment and structure
>pdb|3LAF|A Chain A, Structure Of Dcc, A Netrin-1 Receptor Length = 403 Back     alignment and structure
>pdb|2IEP|A Chain A, Crystal Structure Of Immunoglobulin-Like Domains 1 And 2 Of The Receptor Tyrosine Kinase Musk Length = 192 Back     alignment and structure
>pdb|2YUX|A Chain A, Solution Structure Of 3rd Fibronectin Type Three Domain Of Slow Type Myosin-Binding Protein C Length = 120 Back     alignment and structure
>pdb|1BPV|A Chain A, Titin Module A71 From Human Cardiac Muscle, Nmr, 50 Structures Length = 112 Back     alignment and structure
>pdb|1BPV|A Chain A, Titin Module A71 From Human Cardiac Muscle, Nmr, 50 Structures Length = 112 Back     alignment and structure
>pdb|2XY1|A Chain A, Crystal Structure Of Ncam2 Ig3-4 Length = 192 Back     alignment and structure
>pdb|2XY1|A Chain A, Crystal Structure Of Ncam2 Ig3-4 Length = 192 Back     alignment and structure
>pdb|2V5T|A Chain A, Crystal Structure Of Ncam2 Ig2-3 Length = 189 Back     alignment and structure
>pdb|2WIM|A Chain A, Crystal Structure Of Ncam2 Ig1-3 Length = 291 Back     alignment and structure
>pdb|3PXH|A Chain A, Tandem Ig Domains Of Tyrosine Phosphatase Lar Length = 201 Back     alignment and structure
>pdb|3DMK|A Chain A, Crystal Structure Of Down Syndrome Cell Adhesion Molecule (Dscam) Isoform 1.30.30, N-Terminal Eight Ig Domains Length = 816 Back     alignment and structure
>pdb|2YD9|A Chain A, Crystal Structure Of The N-Terminal Ig1-3 Module Of Human Receptor Protein Tyrosine Phosphatase Sigma Length = 304 Back     alignment and structure
>pdb|3PXJ|A Chain A, Tandem Ig Repeats Of Dlar Length = 210 Back     alignment and structure
>pdb|2YD5|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Human Receptor Protein Tyrosine Phosphatase Lar Length = 214 Back     alignment and structure
>pdb|1KOA|A Chain A, Twitchin Kinase Fragment (C.Elegans), Autoregulated Protein Kinase And Immunoglobulin Domains Length = 491 Back     alignment and structure
>pdb|1QZ1|A Chain A, Crystal Structure Of The Ig 1-2-3 Fragment Of Ncam Length = 291 Back     alignment and structure
>pdb|2VRA|A Chain A, Drosophila Robo Ig1-2 (Monoclinic Form) Length = 208 Back     alignment and structure
>pdb|2VR9|A Chain A, Drosophila Robo Ig1-2 (Tetragonal Form) Length = 217 Back     alignment and structure
>pdb|2YD1|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Drosophila Receptor Protein Tyrosine Phosphatase Dlar Length = 212 Back     alignment and structure
>pdb|2E7C|A Chain A, Solution Structure Of The 6th Ig-Like Domain From Human Myosin-Binding Protein C, Fast-Type Length = 118 Back     alignment and structure
>pdb|3KNB|A Chain A, Crystal Structure Of The Titin C-Terminus In Complex With Obscurin- Like 1 Length = 100 Back     alignment and structure
>pdb|2WP3|T Chain T, Crystal Structure Of The Titin M10-Obscurin Like 1 Ig Complex Length = 102 Back     alignment and structure
>pdb|1UEM|A Chain A, Solution Structure Of The First Fibronectin Type Iii Domain Of Human Kiaa1568 Protein Length = 117 Back     alignment and structure
>pdb|2YD3|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Human Receptor Protein Tyrosine Phosphatase Sigma Length = 202 Back     alignment and structure
>pdb|2YD2|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Human Receptor Protein Tyrosine Phosphatase Sigma Length = 214 Back     alignment and structure
>pdb|3OJV|C Chain C, Crystal Structure Of Fgf1 Complexed With The Ectodomain Of Fgfr1c Exhibiting An Ordered Ligand Specificity-Determining Betac'-Betae Loop Length = 226 Back     alignment and structure
>pdb|1CVS|C Chain C, Crystal Structure Of A Dimeric Fgf2-Fgfr1 Complex Length = 225 Back     alignment and structure
>pdb|2OM5|A Chain A, N-Terminal Fragment Of Human Tax1 Length = 381 Back     alignment and structure
>pdb|3KNB|B Chain B, Crystal Structure Of The Titin C-Terminus In Complex With Obscurin- Like 1 Length = 107 Back     alignment and structure
>pdb|1TLK|A Chain A, X-Ray Structure Determination Of Telokin, The C-Terminal Domain Of Myosin Light Chain Kinase, At 2.8 Angstroms Resolution Length = 154 Back     alignment and structure
>pdb|1TLK|A Chain A, X-Ray Structure Determination Of Telokin, The C-Terminal Domain Of Myosin Light Chain Kinase, At 2.8 Angstroms Resolution Length = 154 Back     alignment and structure
>pdb|1EVT|C Chain C, Crystal Structure Of Fgf1 In Complex With The Extracellular Ligand Binding Domain Of Fgf Receptor 1 (Fgfr1) Length = 225 Back     alignment and structure
>pdb|2YD4|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Chicken Receptor Protein Tyrosine Phosphatase Sigma Length = 210 Back     alignment and structure
>pdb|1FHG|A Chain A, High Resolution Refinement Of Telokin Length = 154 Back     alignment and structure
>pdb|1FHG|A Chain A, High Resolution Refinement Of Telokin Length = 154 Back     alignment and structure
>pdb|2WWK|O Chain O, Crystal Structure Of The Titin M10-Obscurin Like 1 Ig F17r Mutant Complex Length = 109 Back     alignment and structure
>pdb|2YD6|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Human Receptor Protein Tyrosine Phosphatase Delta Length = 212 Back     alignment and structure
>pdb|2WP3|O Chain O, Crystal Structure Of The Titin M10-Obscurin Like 1 Ig Complex Length = 109 Back     alignment and structure
>pdb|2CQV|A Chain A, Solution Structure Of The Eighth Ig-Like Domain Of Human Myosin Light Chain Kinase Length = 114 Back     alignment and structure
>pdb|3MTR|A Chain A, Crystal Structure Of The Ig5-Fn1 Tandem Of Human Ncam Length = 215 Back     alignment and structure
>pdb|2DM3|A Chain A, Solution Structure Of The Second Ig Domain Of Human Palladin Length = 110 Back     alignment and structure
>pdb|2V5S|A Chain A, Structural Basis For Dscam Isoform Specificity Length = 394 Back     alignment and structure
>pdb|2V5M|A Chain A, Structural Basis For Dscam Isoform Specificity Length = 388 Back     alignment and structure
>pdb|1NCT|A Chain A, Titin Module M5, N-Terminally Extended, Nmr Length = 106 Back     alignment and structure
>pdb|3P3Y|A Chain A, Crystal Structure Of Neurofascin Homophilic Adhesion Complex In Space Group P6522 Length = 404 Back     alignment and structure
>pdb|1X3D|A Chain A, Solution Structure Of The Fibronectin Type-Iii Domain Of Human Fibronectin Type-Iii Domain Containing Protein 3a Length = 118 Back     alignment and structure
>pdb|1TNM|A Chain A, Tertiary Structure Of An Immunoglobulin-Like Domain From The Muscle Protein Titin: A New Member Of The I Set Length = 100 Back     alignment and structure
>pdb|3JXA|A Chain A, Immunoglobulin Domains 1-4 Of Mouse Cntn4 Length = 383 Back     alignment and structure
>pdb|3KLD|A Chain A, Ptprg Cntn4 Complex Length = 384 Back     alignment and structure
>pdb|1U2H|A Chain A, X-Ray Structure Of The N-Terminally Truncated Human Apep-1 Length = 99 Back     alignment and structure
>pdb|1G1C|A Chain A, I1 Domain From Titin Length = 99 Back     alignment and structure
>pdb|3PUC|A Chain A, Atomic Resolution Structure Of Titin Domain M7 Length = 99 Back     alignment and structure
>pdb|2V9Q|A Chain A, First And Second Ig Domains From Human Robo1 Length = 212 Back     alignment and structure
>pdb|1X4Z|A Chain A, Solution Structure Of The 2nd Fibronectin Type Iii Domain From Mouse Biregional Cell Adhesion Molecule-RelatedDOWN- Regulated Oncogenes (Cdon) Binding Protein Length = 121 Back     alignment and structure
>pdb|2DKU|A Chain A, Solution Structure Of The Third Ig-Like Domain Of Human Kiaa1556 Protein Length = 103 Back     alignment and structure
>pdb|3V6B|R Chain R, Vegfr-2VEGF-E Complex Structure Length = 424 Back     alignment and structure
>pdb|1IE5|A Chain A, Nmr Structure Of The Third Immunoglobulin Domain From The Neural Cell Adhesion Molecule Length = 107 Back     alignment and structure
>pdb|1RY7|B Chain B, Crystal Structure Of The 3 Ig Form Of Fgfr3c In Complex With Fgf1 Length = 334 Back     alignment and structure
>pdb|3GRW|A Chain A, Fgfr3 In Complex With A Fab Length = 241 Back     alignment and structure
>pdb|3V2A|R Chain R, Vegfr-2VEGF-A Complex Structure Length = 772 Back     alignment and structure
>pdb|1CS6|A Chain A, N-terminal Fragment Of Axonin-1 From Chicken Length = 382 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query591
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 1e-103
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 9e-49
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 8e-35
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 3e-21
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 6e-83
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 2e-77
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 1e-45
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 1e-28
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 2e-64
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 8e-16
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 4e-09
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 2e-07
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 9e-63
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 4e-31
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 1e-28
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 3e-27
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 1e-57
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 2e-26
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 1e-13
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 2e-09
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 4e-05
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 1e-57
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 1e-39
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 8e-23
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 1e-17
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 1e-56
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 8e-44
3b43_A 570 Titin; I-SET IG fold, extended poly-IG filament, e 1e-40
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 8e-06
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 7e-51
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 3e-18
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 4e-50
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 5e-24
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 7e-24
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 2e-21
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 2e-18
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 5e-49
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 8e-24
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 1e-21
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 3e-21
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 8e-19
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 2e-48
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 2e-20
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 4e-18
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 4e-48
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 1e-46
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 7e-11
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 9e-09
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 4e-08
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 3e-47
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 5e-29
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 7e-16
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 8e-10
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 3e-08
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 7e-42
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 2e-41
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 6e-38
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 4e-37
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 1e-27
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 1e-27
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 3e-24
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 2e-13
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 7e-42
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 6e-33
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 1e-06
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 6e-04
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 2e-41
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 2e-39
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 8e-31
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 3e-30
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 1e-40
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 3e-24
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 6e-05
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 3e-04
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 6e-40
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 7e-15
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 7e-06
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 8e-40
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 1e-34
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 2e-19
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 9e-19
3r8q_A 290 Fibronectin; heparin, FNIII, heparin binding, cell 3e-18
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 3e-14
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 2e-39
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 1e-31
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 2e-26
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 6e-26
3laf_A 403 Deleted in colorectal cancer; netrin-1 receptor, i 3e-07
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 4e-04
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 3e-39
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 1e-22
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 2e-21
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 2e-17
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 7e-39
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 7e-23
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 1e-20
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 1e-20
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 5e-12
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 4e-08
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 9e-39
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 4e-30
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 3e-22
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 1e-05
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 3e-05
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 3e-38
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 9e-06
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 1e-04
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 3e-38
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 7e-33
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 1e-05
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 3e-04
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 1e-37
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 4e-23
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 3e-04
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 1e-37
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 2e-20
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 2e-05
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 2e-37
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 8e-35
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 2e-11
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 1e-09
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 1e-08
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 1e-36
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 8e-20
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 3e-12
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 3e-11
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 5e-11
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 8e-36
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 9e-25
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 1e-24
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 1e-22
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 7e-05
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 3e-35
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 4e-34
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 2e-28
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 2e-34
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 2e-29
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 1e-24
2ec8_A 524 MAST/stem cell growth factor receptor; glycoprotei 1e-13
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 2e-13
2ec8_A 524 MAST/stem cell growth factor receptor; glycoprotei 4e-06
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 2e-34
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 5e-25
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 6e-24
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 1e-21
3kld_A 384 Contactin 4, axcam, BIG-2; cell adhesion, protein 1e-07
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 4e-04
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 7e-04
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 2e-34
3qs9_E 527 FL cytokine receptor; immunoglobulin-like domain, 2e-27
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 1e-06
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 3e-34
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 8e-18
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 3e-15
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 5e-13
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 4e-34
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 7e-20
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 8e-11
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 4e-05
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 4e-05
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 2e-33
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 8e-27
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 1e-23
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 7e-05
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 4e-04
1x3d_A118 Fibronectin type-III domain containing protein 3A; 3e-33
1x3d_A118 Fibronectin type-III domain containing protein 3A; 9e-27
1x3d_A118 Fibronectin type-III domain containing protein 3A; 6e-24
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 3e-33
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 6e-25
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 2e-24
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 2e-21
1cs6_A 382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 8e-08
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 2e-04
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 3e-33
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 4e-18
2crm_A120 Fibronectin type-III domain containing protein 3A; 5e-33
2crm_A120 Fibronectin type-III domain containing protein 3A; 7e-31
2crm_A120 Fibronectin type-III domain containing protein 3A; 7e-24
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 5e-33
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 5e-15
3f7q_A 234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 5e-12
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 1e-32
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 9e-30
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 4e-04
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 1e-32
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 3e-32
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 1e-18
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 9e-08
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 1e-07
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 2e-06
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 2e-32
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 3e-26
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 7e-32
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 5e-19
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 2e-04
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 1e-31
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 1e-30
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 1e-27
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 1e-31
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 8e-31
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 5e-26
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 1e-31
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 2e-30
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 4e-26
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 4e-31
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 2e-25
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 3e-19
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 9e-19
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 4e-31
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 1e-30
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 5e-27
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 6e-23
1fnf_A 368 Fibronectin; RGD, extracellular matrix, cell adhes 7e-17
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 7e-16
1fnf_A 368 Fibronectin; RGD, extracellular matrix, cell adhes 1e-11
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 4e-31
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 7e-31
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 8e-28
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 6e-31
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 4e-16
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 3e-09
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 8e-31
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 7e-17
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 1e-30
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 1e-18
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 3e-09
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 3e-07
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 3e-07
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 2e-30
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 4e-29
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 1e-24
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 4e-30
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 8e-13
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 2e-12
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 3e-10
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 3e-09
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 4e-30
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 1e-26
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 7e-26
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 5e-24
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 4e-23
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 2e-18
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 2e-04
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 9e-04
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 4e-30
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 2e-16
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 3e-15
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 3e-12
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 7e-30
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 4e-04
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 9e-30
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 2e-26
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 1e-24
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 9e-30
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 1e-26
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 1e-23
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 2e-05
1x5x_A109 Fibronectin type-III domain containing protein 3A; 1e-29
1x5x_A109 Fibronectin type-III domain containing protein 3A; 6e-29
1x5x_A109 Fibronectin type-III domain containing protein 3A; 2e-28
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 2e-29
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 7e-17
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 4e-05
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 2e-04
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 2e-29
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 4e-21
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 2e-29
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 9e-17
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 1e-15
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 2e-29
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 9e-18
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 6e-29
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 2e-27
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 8e-25
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 5e-24
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 6e-29
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 3e-17
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 6e-06
2crz_A110 Fibronectin type-III domain containing protein 3A; 1e-28
2crz_A110 Fibronectin type-III domain containing protein 3A; 3e-27
2crz_A110 Fibronectin type-III domain containing protein 3A; 9e-23
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-28
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 9e-13
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-04
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 1e-28
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 1e-16
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 4e-08
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 1e-28
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 7e-27
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 1e-24
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 2e-28
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 7e-12
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 5e-10
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 2e-09
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 3e-28
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 8e-17
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 3e-10
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 3e-28
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 3e-28
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 3e-17
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 6e-09
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 6e-28
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 7e-18
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 7e-14
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 6e-28
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 4e-23
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 3e-20
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 1e-27
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 2e-22
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 7e-21
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 1e-27
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 2e-24
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 3e-18
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 1e-27
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 3e-26
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 3e-21
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 2e-27
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 2e-15
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 1e-07
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 2e-27
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 2e-15
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 3e-06
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 3e-27
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 1e-20
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 2e-12
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 7e-12
3l5i_A 290 Interleukin-6 receptor subunit beta; cytokine rece 3e-08
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 7e-27
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 5e-25
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 5e-22
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 8e-27
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 3e-15
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 5e-06
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 9e-27
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 9e-22
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 2e-08
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 1e-26
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 2e-25
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 1e-17
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 1e-04
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 1e-26
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 2e-13
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 6e-11
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 2e-26
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 2e-23
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 2e-06
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 2e-26
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 4e-18
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 3e-26
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 1e-18
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 1e-17
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 3e-26
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 1e-25
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 3e-17
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 8e-15
1tdq_A 283 Tenascin-R; extracellular matrix, lecticans, tenas 1e-13
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 8e-12
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 3e-26
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 4e-17
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 6e-14
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 5e-26
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 4e-14
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 6e-08
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 5e-26
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 6e-16
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 6e-07
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 7e-26
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 2e-17
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 1e-25
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 2e-15
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 2e-25
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 2e-25
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 9e-24
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 3e-25
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 7e-16
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 6e-08
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 5e-25
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 3e-20
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 9e-16
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 7e-25
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 8e-14
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 6e-10
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 7e-25
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 3e-15
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 2e-10
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 2e-24
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 5e-24
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 4e-23
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 6e-24
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 5e-15
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 2e-04
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 7e-24
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 6e-19
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 6e-12
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 8e-24
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 2e-20
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 3e-11
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 1e-23
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 6e-12
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 8e-12
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 7e-05
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 2e-23
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 7e-10
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 2e-05
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 2e-23
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 8e-23
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 6e-15
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 6e-23
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 4e-10
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 2e-05
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 6e-23
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 1e-21
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 2e-16
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 7e-23
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 7e-12
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 4e-08
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 8e-23
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 6e-10
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 5e-08
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 8e-23
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 3e-13
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 2e-22
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 2e-12
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 3e-07
1x4x_A106 Fibronectin type-III domain containing protein 3A; 2e-22
1x4x_A106 Fibronectin type-III domain containing protein 3A; 1e-18
1x4x_A106 Fibronectin type-III domain containing protein 3A; 3e-16
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 2e-22
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 3e-20
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 2e-18
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 2e-22
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 4e-11
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 5e-08
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 3e-22
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 8e-10
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 5e-07
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 3e-22
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 1e-08
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 7e-05
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 4e-22
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 2e-13
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 6e-06
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 9e-22
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 3e-12
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 3e-07
1waa_A93 Titin; metal binding protein, calmodulin-binding, 1e-21
1waa_A93 Titin; metal binding protein, calmodulin-binding, 4e-10
1waa_A93 Titin; metal binding protein, calmodulin-binding, 3e-05
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 1e-21
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 5e-20
1itb_B 315 Type 1 interleukin-1 receptor; immunoglobulin fold 7e-06
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 2e-21
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 6e-21
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 5e-20
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 2e-21
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 3e-14
2ch8_A201 BARF1, P33, 33 kDa early protein; viral protein, i 3e-21
2ch8_A201 BARF1, P33, 33 kDa early protein; viral protein, i 1e-10
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 5e-21
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 1e-15
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 1e-08
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 7e-05
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 5e-21
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 4e-12
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 2e-05
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 7e-21
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 2e-20
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 5e-19
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 2e-20
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 2e-20
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 2e-13
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 2e-20
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 4e-09
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 2e-05
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 3e-20
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 1e-11
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 3e-05
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 3e-20
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 3e-15
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 5e-14
3mjg_X289 Beta-type platelet-derived growth factor receptor; 3e-20
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 6e-20
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 2e-11
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 9e-20
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 5e-07
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 1e-19
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 2e-07
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 4e-04
1wwb_X103 Protein (brain derived neurotrophic factor recepto 1e-19
1wwb_X103 Protein (brain derived neurotrophic factor recepto 2e-19
1wwb_X103 Protein (brain derived neurotrophic factor recepto 2e-07
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 2e-19
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 4e-13
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 3e-06
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 2e-19
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 4e-10
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 6e-07
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 2e-19
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 5e-17
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 1e-16
2eo1_A102 OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 5e-19
2eo1_A102 OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 7e-10
2eo1_A102 OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 8e-06
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 6e-19
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 7e-11
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 7e-07
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 8e-19
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 9e-11
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 9e-19
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 5e-09
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 5e-04
1nn8_R302 CD155 antigen, poliovirus receptor; icosahedral vi 1e-18
1nn8_R302 CD155 antigen, poliovirus receptor; icosahedral vi 3e-16
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 1e-18
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 1e-07
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 1e-04
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 1e-18
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 3e-16
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 3e-16
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 2e-18
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 1e-14
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 2e-08
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 2e-05
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 9e-05
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 3e-18
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 3e-18
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 5e-10
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 3e-18
1z7z_I 450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 1e-12
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 1e-07
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 3e-18
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 9e-16
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 3e-18
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 2e-12
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 3e-18
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 9e-11
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 5e-04
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 4e-18
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 1e-15
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 2e-14
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 9e-18
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 7e-09
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 1e-17
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 3e-17
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 3e-17
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 1e-10
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 9e-06
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 3e-17
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 2e-14
2ocw_A 585 Polymeric-immunoglobulin receptor; SC, secretory, 2e-10
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 4e-17
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 2e-12
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 6e-04
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 5e-17
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 6e-13
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 1e-11
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 7e-17
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 8e-10
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 6e-04
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 9e-17
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 4e-14
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 2e-13
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 1e-16
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 9e-16
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 7e-14
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 1e-08
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 2e-16
2erj_C247 Cytokine receptor common gamma chain; immune syste 2e-16
2erj_C247 Cytokine receptor common gamma chain; immune syste 6e-11
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 2e-16
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 2e-08
2v9t_A117 Roundabout homolog 1; structural protein-receptor 2e-16
2v9t_A117 Roundabout homolog 1; structural protein-receptor 9e-08
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 3e-16
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 1e-12
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 1e-10
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 3e-16
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 2e-14
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 3e-12
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 3e-16
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 4e-07
2q7n_A 488 Leukemia inhibitory factor receptor; cytokine cell 5e-04
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 4e-16
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 2e-15
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 2e-13
1he7_A126 High affinity nerve growth factor receptor; transf 7e-16
1he7_A126 High affinity nerve growth factor receptor; transf 9e-14
1he7_A126 High affinity nerve growth factor receptor; transf 7e-07
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 7e-16
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 1e-08
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 8e-07
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 1e-15
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 3e-06
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 1e-15
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 6e-13
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 8e-10
3shs_A304 HOC head outer capsid protein; immunoglobulin-like 4e-15
3shs_A304 HOC head outer capsid protein; immunoglobulin-like 4e-14
3shs_A304 HOC head outer capsid protein; immunoglobulin-like 1e-06
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 5e-15
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 1e-13
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 1e-05
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 6e-15
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 4e-12
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 1e-09
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 7e-15
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 1e-14
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 2e-12
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 5e-11
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 1e-14
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 1e-08
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 1e-04
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 1e-14
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 2e-10
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 8e-09
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 1e-14
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 2e-14
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 2e-14
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 4e-14
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 9e-11
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 2e-14
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 6e-12
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 4e-09
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 2e-14
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 4e-05
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 5e-04
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 2e-14
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 8e-14
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 2e-07
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 6e-06
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 1e-05
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 2e-14
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 5e-08
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 2e-07
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 3e-14
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 2e-13
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 1e-12
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 3e-14
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 5e-10
2ens_A96 Advanced glycosylation END product-specific recept 4e-14
2ens_A96 Advanced glycosylation END product-specific recept 6e-08
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 5e-14
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2e-05
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 9e-05
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 5e-14
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 7e-14
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 1e-10
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 6e-14
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 4e-06
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 7e-14
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 2e-11
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 2e-11
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 7e-14
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 2e-13
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 1e-11
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 7e-14
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 8e-10
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 8e-09
3lb6_C 380 IL-13, interleukin-13 receptor subunit alpha-2; cy 2e-05
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 3e-05
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 9e-14
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 2e-06
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 1e-13
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 4e-12
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 1e-11
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 1e-13
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 2e-13
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 1e-10
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 1e-13
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 5e-10
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 3e-09
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 2e-13
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 4e-13
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 4e-12
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 2e-13
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 2e-11
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 6e-11
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 2e-13
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 1e-11
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 8e-08
3k2m_C101 Monobody HA4; engineered binding protein, antibody 3e-13
3k2m_C101 Monobody HA4; engineered binding protein, antibody 1e-11
3k2m_C101 Monobody HA4; engineered binding protein, antibody 5e-11
3t04_D103 Monobody 7C12; engineered binding protein, antibod 3e-13
3t04_D103 Monobody 7C12; engineered binding protein, antibod 4e-12
3t04_D103 Monobody 7C12; engineered binding protein, antibod 1e-10
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 4e-13
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 7e-13
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 2e-10
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 4e-13
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 2e-11
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 3e-11
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 2e-10
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 3e-06
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 6e-13
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 8e-13
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 6e-12
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 7e-13
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 3e-10
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 3e-06
3bpo_C 314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 1e-05
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 8e-13
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 3e-08
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 1e-12
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 1e-08
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 6e-05
1gl4_B98 Basement membrane-specific heparan sulfate proteog 2e-12
1gl4_B98 Basement membrane-specific heparan sulfate proteog 2e-09
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 2e-12
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 8e-12
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 8e-12
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 4e-12
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 4e-11
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 7e-11
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 6e-12
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 2e-09
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 1e-08
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 9e-12
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 4e-05
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 5e-04
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 6e-04
2fbo_J250 V1V2;, variable region-containing chitin-binding p 9e-12
2fbo_J250 V1V2;, variable region-containing chitin-binding p 1e-10
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 1e-11
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 2e-10
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 1e-11
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 5e-06
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 5e-05
1eer_B227 Epobp, erythropoietin receptor; signal transductio 1e-11
1eer_B227 Epobp, erythropoietin receptor; signal transductio 4e-09
1eer_B227 Epobp, erythropoietin receptor; signal transductio 1e-06
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 1e-11
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 3e-09
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 7e-05
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 2e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-05
1y6k_R214 Interleukin-10 receptor alpha chain; helix bundle, 2e-11
1y6k_R214 Interleukin-10 receptor alpha chain; helix bundle, 6e-04
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 3e-11
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 1e-10
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 3e-09
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 5e-11
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 2e-09
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 3e-07
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-07
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-06
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 8e-11
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 8e-07
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 1e-10
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 3e-09
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 3e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-04
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 2e-10
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 4e-04
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 7e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-05
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 3e-10
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 5e-10
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 5e-06
3s35_X122 Vascular endothelial growth factor receptor 2; ant 4e-10
3s35_X122 Vascular endothelial growth factor receptor 2; ant 1e-06
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 4e-10
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 1e-07
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 2e-06
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 4e-10
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 2e-05
2gys_A419 Cytokine receptor common beta chain; dimer of inte 2e-09
2gys_A419 Cytokine receptor common beta chain; dimer of inte 1e-08
2gys_A419 Cytokine receptor common beta chain; dimer of inte 2e-07
2gys_A419 Cytokine receptor common beta chain; dimer of inte 1e-06
2gys_A 419 Cytokine receptor common beta chain; dimer of inte 3e-06
2gys_A419 Cytokine receptor common beta chain; dimer of inte 1e-05
3so5_A112 LIG-3, leucine-rich repeats and immunoglobulin-lik 2e-09
2pet_A231 Lutheran blood group glycoprotein; immunoglobulin 2e-09
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 2e-09
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 2e-06
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 6e-04
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 3e-09
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 6e-07
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 6e-05
3m45_A108 Cell adhesion molecule 2; IG fold, dimer, disulfid 7e-09
3rbg_A124 Cytotoxic and regulatory T-cell molecule; IGV, crt 8e-09
2e6q_A112 Obscurin-like protein 1; IG-like domain, structura 1e-08
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 1e-08
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 8e-08
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 1e-07
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 2e-08
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 4e-08
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 7e-07
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 2e-08
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 1e-07
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 3e-07
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 2e-08
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 8e-08
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 2e-06
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 3e-08
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 7e-04
3og6_B226 Interleukin 28 receptor, alpha (interferon, lambd 5e-08
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 6e-08
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 4e-07
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 5e-07
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 7e-08
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 1e-07
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 1e-06
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 2e-05
1z9m_A145 GAPA225; nectin-like, IG-like domain, V domain, ce 3e-07
3eow_R221 Poliovirus receptor; immunoglobulin super family, 3e-07
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 3e-07
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 5e-04
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 3e-07
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 1e-06
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 1e-06
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 4e-07
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 3e-05
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 3e-04
3bn3_B196 ICAM-5, intercellular adhesion molecule 5, telence 5e-07
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 6e-07
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 1e-06
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 1e-06
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 9e-07
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 2e-06
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 1e-06
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 2e-04
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 1e-06
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 2e-04
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 2e-06
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 2e-06
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 2e-06
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 2e-06
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 8e-06
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 7e-05
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 2e-06
2edn_A118 Myosin-binding protein C, fast-type; beta-sandwich 2e-06
2edn_A118 Myosin-binding protein C, fast-type; beta-sandwich 1e-04
1mq8_A291 ICAM-1, intercellular adhesion molecule-1, CD54 an 2e-06
1mq8_A291 ICAM-1, intercellular adhesion molecule-1, CD54 an 1e-05
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 3e-06
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 3e-05
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 2e-04
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 3e-06
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 1e-05
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 2e-04
1zxq_A192 ICAM-2, intercellular adhesion molecule-2; immunog 3e-06
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 1e-05
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 6e-04
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 2e-05
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 2e-05
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 4e-05
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 8e-05
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 1e-04
1gsm_A210 Madcam-1, mucosal addressin cell adhesion molecule 8e-05
1oww_A98 FN, fibronectin first type III module, CIG; fibron 2e-04
2csp_A130 RIM-BP2, RIM binding protein 2; FN3 domain, struct 4e-04
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 5e-04
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 5e-04
1iam_A185 ICAM-1, CD54, intercellular adhesion molecule-1; r 6e-04
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
 Score =  313 bits (803), Expect = e-103
 Identities = 106/291 (36%), Positives = 144/291 (49%), Gaps = 5/291 (1%)

Query: 289 AAKAPEIIVPLRNANAIQNHNAQFQCTITGCPKPTISWLKGSREITPSARHHIF--AEGD 346
            A AP     LRN N     NA   C +TG PKP + W +  +EI      +     +G 
Sbjct: 1   GAMAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGG 60

Query: 347 TYTLIINSVYGVDADEYVCRAVNKGGVKSTKAELIIMTAPKFNVPPRFRDTA--YFDKGE 404
            + LII SV   DA  Y  RA N+GG  S  A L +    K ++P         +  +GE
Sbjct: 61  YHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGE 120

Query: 405 NVVVKIPFTGYPKPKITWYRDNEVIESGGHFHVETSERHA-ILTIRDASNVDTAPYRVVA 463
            V +KIPF+G P P ITW +  ++I++ GH+ V  +     ++        D   Y V A
Sbjct: 121 VVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCA 180

Query: 464 ENDLGMDSAIVKIQISDRPDPPQFPTVEDIGHDSLALVWRAPIWDGGSNITNYIVEKREH 523
           +N  G+D   V++ ++D PDPP+   V D+  DS+ L W  P  DGGS ITNYIVEK   
Sbjct: 181 KNRFGIDQKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCAT 240

Query: 524 PMSSWIRVGNTRFTTMAITGLSPGHQYEFRVYAENVYGRSDPSTTSDLITT 574
               W+RVG  R T   +  L     Y+FRV AEN +G S PS  S+   T
Sbjct: 241 TAERWLRVGQARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTIT 291


>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 Back     alignment and structure
>2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 Back     alignment and structure
>1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 Back     alignment and structure
>3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Length = 202 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 104 Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 104 Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 104 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Length = 222 Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Length = 222 Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Length = 214 Back     alignment and structure
>1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Length = 214 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Length = 236 Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Length = 236 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 206 Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 206 Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 206 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Length = 112 Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Length = 231 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 Back     alignment and structure
>3m45_A Cell adhesion molecule 2; IG fold, dimer, disulfide bond, glycoprotein, immunoglobulin membrane, transmembrane; HET: NAG; 2.21A {Mus musculus} Length = 108 Back     alignment and structure
>3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Length = 124 Back     alignment and structure
>2e6q_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Length = 88 Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Length = 88 Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Length = 88 Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Length = 103 Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Length = 103 Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Length = 103 Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Length = 226 Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Length = 226 Back     alignment and structure
>3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* Length = 226 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Length = 171 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>1z9m_A GAPA225; nectin-like, IG-like domain, V domain, cell adhesion; 2.40A {Homo sapiens} Length = 145 Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Length = 211 Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Length = 211 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>3bn3_B ICAM-5, intercellular adhesion molecule 5, telencephalin; I domain, integrin, allosteric mobility, cell adhesi immune system; HET: NAG; 2.10A {Homo sapiens} Length = 196 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Length = 201 Back     alignment and structure
>2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Length = 291 Back     alignment and structure
>1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Length = 291 Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Length = 223 Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Length = 223 Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Length = 223 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1zxq_A ICAM-2, intercellular adhesion molecule-2; immunoglobulin fold, cell adhesion, glycoprotein, transmembr; HET: NAG; 2.20A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Length = 192 Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Length = 306 Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Length = 306 Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Length = 180 Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Length = 193 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* Length = 210 Back     alignment and structure
>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 98 Back     alignment and structure
>2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Length = 219 Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Length = 219 Back     alignment and structure
>1iam_A ICAM-1, CD54, intercellular adhesion molecule-1; rhinovirus receptor, cell adhesion, integrin ligand, glycopr LFA-1 ligand, immunoglobulin fold; HET: NAG; 2.10A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ic1_A* 1d3l_A 1d3e_I 1d3i_I 3tcx_A Length = 185 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query591
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 100.0
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 100.0
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 100.0
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 100.0
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 100.0
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 100.0
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 100.0
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 100.0
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 100.0
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 100.0
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 100.0
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 100.0
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 100.0
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 100.0
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 100.0
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 100.0
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 100.0
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 100.0
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 100.0
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 100.0
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 100.0
2rcj_C523 Light chain; immunoglobulin M, polymeric antibodie 100.0
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 100.0
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 100.0
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 100.0
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 100.0
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 100.0
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 100.0
1qgc_4438 Protein (immunoglobulin); virus-antibody complex, 100.0
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 100.0
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 100.0
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 100.0
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 99.98
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 99.98
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 99.98
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 99.97
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 99.97
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 99.97
2rcj_C523 Light chain; immunoglobulin M, polymeric antibodie 99.97
1igt_B444 IGG2A intact antibody - MAB231; intact immunoglobu 99.96
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 99.96
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 99.96
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 99.96
1iga_A475 IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg 99.96
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 99.96
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 99.96
1hzh_H457 IGG, immunoglobulin heavy chain; antibody, immune 99.96
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 99.96
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 99.96
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 99.95
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 99.95
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 99.95
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 99.95
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 99.95
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 99.95
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 99.95
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 99.95
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 99.95
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 99.95
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 99.95
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 99.95
1igy_B434 IGG1 intact antibody MAB61.1.3; intact immunoglobu 99.95
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 99.95
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 99.95
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 99.94
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 99.94
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 99.94
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 99.94
4fom_A308 Poliovirus receptor-related protein 3; immunoglobu 99.94
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 99.94
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 99.94
1qgc_4438 Protein (immunoglobulin); virus-antibody complex, 99.94
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 99.94
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 99.94
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 99.94
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 99.94
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 99.94
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 99.93
1zvo_C512 Myeloma immunoglobulin D delta; immunoglobulin fol 99.93
4fqp_A313 Poliovirus receptor; immunoglobulin-like domain, I 99.93
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 99.93
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 99.93
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 99.93
4fqp_A313 Poliovirus receptor; immunoglobulin-like domain, I 99.93
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 99.92
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 99.92
4fom_A308 Poliovirus receptor-related protein 3; immunoglobu 99.92
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 99.92
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 99.92
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 99.92
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 99.92
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 99.92
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 99.92
4fa8_A203 Secreted protein BARF1; immunoglobulin-like domain 99.92
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 99.92
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 99.92
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 99.92
3mjg_X289 Beta-type platelet-derived growth factor receptor; 99.91
2wng_A327 Tyrosine-protein phosphatase non-receptor type sub 99.91
3mjg_X289 Beta-type platelet-derived growth factor receptor; 99.91
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 99.91
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 99.91
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 99.91
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 99.91
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 99.91
2wng_A327 Tyrosine-protein phosphatase non-receptor type sub 99.91
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 99.91
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 99.91
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 99.91
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 99.9
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 99.9
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 99.9
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 99.9
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 99.9
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 99.9
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 99.9
1igt_B444 IGG2A intact antibody - MAB231; intact immunoglobu 99.9
1za6_B344 IGG heavy chain; immunoglobulin fold, CH2-domain-d 99.9
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 99.89
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 99.89
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 99.89
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 99.89
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 99.89
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 99.89
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 99.89
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 99.89
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 99.89
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 99.89
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 99.88
1hzh_H457 IGG, immunoglobulin heavy chain; antibody, immune 99.88
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 99.88
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 99.88
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 99.88
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 99.88
1iga_A475 IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg 99.87
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 99.87
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 99.87
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 99.87
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.87
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 99.87
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 99.87
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 99.87
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 99.87
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 99.87
3p2t_A196 Leukocyte immunoglobulin-like receptor subfamily 4 99.86
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 99.86
2c1o_A254 IGK-C protein; FAB fragment, enantioselective, fin 99.86
2d3v_A196 Leukocyte immunoglobulin-like receptor subfamily A 99.86
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 99.86
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 99.85
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 99.85
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 99.85
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 99.85
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 99.85
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 99.85
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 99.85
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 99.85
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 99.85
1igy_B434 IGG1 intact antibody MAB61.1.3; intact immunoglobu 99.85
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 99.85
4fa8_A203 Secreted protein BARF1; immunoglobulin-like domain 99.84
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 99.84
1ugn_A198 LIR1, leukocyte immunoglobulin-like receptor 1; im 99.84
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 99.84
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 99.84
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 99.83
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 99.83
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 99.83
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 99.83
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 99.83
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 99.83
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 99.83
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 99.83
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 99.83
2gi7_A184 GPVI protein; IG-like domains, blood clotting, cel 99.83
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 99.82
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 99.82
1zvo_C512 Myeloma immunoglobulin D delta; immunoglobulin fol 99.82
3mj8_L213 Stimulatory hamster antibody HL4E10 FAB light CHA; 99.82
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 99.82
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 99.82
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 99.82
3d9a_L213 Light chain of hyhel10 antibody fragment (FAB); ly 99.82
1oll_A188 NK receptor; immune system/receptor, NK cell trigg 99.82
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 99.81
1f3r_B257 FV antibody fragment; IG-fold, immuno complex, ant 99.81
2fbo_J250 V1V2;, variable region-containing chitin-binding p 99.81
2wqr_A323 IG epsilon chain C region; immune system, immunogl 99.81
2ghw_B247 Anti-SARS SCFV antibody, 80R; S protein, neutraliz 99.81
4frw_A218 Poliovirus receptor-related protein 4; immunoglobu 99.81
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 99.8
3nl4_L213 Antigen binding fragment, immunoglobulin IGG - LI; 99.8
1lk3_L210 9D7 light chain; antigen-antibody complex, immune 99.8
1p6f_A242 NKP46, natural cytotoxicity triggering receptor 1; 99.8
1nqb_A256 Single-chain antibody fragment; multivalent antibo 99.79
3knb_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, AT 99.79
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 99.79
2pet_A231 Lutheran blood group glycoprotein; immunoglobulin 99.79
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 99.79
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 99.79
3auv_A276 SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid 99.79
3r06_A213 Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; 99.78
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 99.78
1nkr_A201 P58-CL42 KIR; inhibitory receptor, natural killer 99.78
2wqr_A323 IG epsilon chain C region; immune system, immunogl 99.78
3uzq_A253 Anti-dengue MAB 4E11; dengue antibody neutralizati 99.78
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 99.78
4i0k_A222 CD276 antigen; immunoglobulin domain, glycoprotein 99.78
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 99.78
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 99.78
1za6_B344 IGG heavy chain; immunoglobulin fold, CH2-domain-d 99.78
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 99.78
3tv3_L211 PGT128 light chain, IG lambda-2 chain C regions; F 99.78
3gkz_A257 Anti-methamphetamine single chain FV; therapeutic 99.78
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 99.77
3s96_B218 3B5H10 FAB light chain; huntingtin, immune system; 99.77
3esu_F250 Antibody 14B7* light chain and antibody 14B7* heav 99.77
3umt_A256 SCFV heavy chain and light chain; stability engine 99.77
1nfd_E212 H57 FAB; complex (immunoreceptor-immunoglobulin), 99.77
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 99.77
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 99.77
2znx_A242 SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s 99.77
1q0x_L212 FAB 9B1, light chain; anti-morphine antibody, FAB 99.77
3juy_B256 3B3 single chain variant HIV-1 antibody; envelope 99.77
2p1y_A238 Bispecific alpha/beta TCR; autoimmunity, immunoglo 99.76
1moe_A240 Anti-CEA MAB T84.66; anti carcinoembryonic antigen 99.76
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 99.76
3sob_L237 Antibody light chain; beta propeller, protein bind 99.76
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 99.76
1qok_A282 MFE-23 recombinant antibody fragment; immunoglobul 99.76
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 99.76
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 99.76
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 99.76
3knb_A100 Titin; IG-like, titin, OBSL1, ATP-binding, calmodu 99.76
2xzc_L216 FAB A.17 light chain; immune system; HET: XOP; 1.3 99.76
1svz_A247 Immunoglobulin;, single-chain FV fragment 1696; an 99.75
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 99.75
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 99.75
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 99.75
1c1e_H219 Catalytic antibody 1E9 (heavy chain); diels-alder, 99.75
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 99.75
1b6u_A257 KIR2DL3, P58 killer cell inhibitory receptor; natu 99.75
2zg1_A214 Sialic acid-binding IG-like lectin 5; siglec-5 inh 99.75
3tf7_C256 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; 99.74
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 99.74
3bkj_L252 WO2 IGG2A FAB fragment light chain kappa; abeta, F 99.74
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 99.74
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 99.74
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 99.74
1mju_H227 Immunoglobulin MS6-12; catalytic antibody, ester h 99.74
3ux9_B256 SCFV antibody; five helices, long loop connecting 99.74
1q9r_B222 S25-2 FAB (IGG1K) heavy chain; antigen-binding fra 99.74
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 99.74
2gjj_A264 A21 single-chain antibody fragment against ERBB2; 99.73
3knb_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, AT 99.73
3pv7_A248 B7-H6, IG-like domain-containing protein DKFZP686O 99.73
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 99.73
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.73
4dzb_B246 Vbeta2 (MAIT T cell receptor); immune system; 1.70 99.73
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 99.72
2j6e_L234 IGM, FAB light chain; autoimmune complex human IGM 99.72
4fmk_A225 Poliovirus receptor-related protein 2; immunoglobu 99.72
3eow_R221 Poliovirus receptor; immunoglobulin super family, 99.72
3d9a_H210 Heavy chain of hyhel10 antibody fragment (FAB); ly 99.72
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 99.72
1gsm_A210 Madcam-1, mucosal addressin cell adhesion molecule 99.72
2gki_A291 Nuclease; anti-DNA antibody, catalytic antibody, i 99.71
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 99.71
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 99.71
3fku_X280 Neutralizing antibody F10; influenza, hemagglutini 99.71
3d9a_L213 Light chain of hyhel10 antibody fragment (FAB); ly 99.71
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.71
1hxm_B242 Gamma-delta T-cell receptor; IG domain, TCR, GDTCR 99.71
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 99.71
3omz_A259 Human vdelta1 gamma delta T cell receptor delta1A; 99.71
2fbj_H220 IGA-kappa J539 FAB (heavy chain); immunoglobulin; 99.7
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 99.7
2rgs_A218 I, IG gamma-2B heavy chain; FC-fragment, immunoglo 99.7
1x9q_A268 SCFV, 4M5.3 anti-fluorescein single chain antibody 99.7
1pz5_B220 Heavy chain of FAB (SYA/J6); antibody-antigen stru 99.7
3bqu_C233 3H6 FAB light chain; beta sheet, immune system; 3. 99.7
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 99.69
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 99.69
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 99.69
3bae_H228 WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO 99.68
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 99.68
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 99.68
1op3_H225 FAB 2G12, heavy chain; domain-swapped FAB 2G12, an 99.68
3qib_D270 2B4 beta chain; IG domain, immune system; HET: NAG 99.68
1lk3_L210 9D7 light chain; antigen-antibody complex, immune 99.68
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 99.68
2vol_A207 Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, 99.68
3mj8_L213 Stimulatory hamster antibody HL4E10 FAB light CHA; 99.68
3nl4_H215 Antigen binding fragment,immunoglobulin IGG - HEA; 99.68
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 99.68
2crz_A110 Fibronectin type-III domain containing protein 3A; 99.67
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 99.67
1dee_B223 IGM RF 2A2; FAB-IBP complex 2.7A resolution bindin 99.67
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 99.67
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 99.67
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.67
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 99.67
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 99.67
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 99.67
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 99.66
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 99.66
2lu7_A84 Obscurin-like protein 1; structural genomics, nort 99.66
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 99.66
3nfj_J245 T cell receptor beta chain; immunoglobulin family, 99.66
3knb_A100 Titin; IG-like, titin, OBSL1, ATP-binding, calmodu 99.66
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 99.66
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 99.66
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 99.66
3liz_H253 4C3 monoclonal antibody heavy chain; hydrolase-imm 99.66
1dn0_B232 IGM-kappa cold agglutinin (heavy chain); FAB, anti 99.66
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 99.66
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 99.66
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 99.65
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 99.65
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 99.65
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 99.65
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 99.65
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 99.64
4ei6_B245 Vbeta16 XV19 type II natural killer T cell recept 99.64
2xqy_G261 A13-D6.3 monoclonal antibody, envelope glycoprotei 99.64
3q5y_A240 TCR N15 beta; IG, T cell receptor, antigen peptide 99.64
3m8o_H221 Immunoglobulin A1 heavy chain; immunoglobulin fold 99.64
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 99.64
1mq8_A291 ICAM-1, intercellular adhesion molecule-1, CD54 an 99.64
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 99.64
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 99.64
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 99.64
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 99.64
3nl4_L213 Antigen binding fragment, immunoglobulin IGG - LI; 99.64
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 99.64
1waa_A93 Titin; metal binding protein, calmodulin-binding, 99.64
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 99.63
1i1c_A239 IGG2A, IG gamma-2A chain C region; FC, immune syst 99.63
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 99.63
1x4x_A106 Fibronectin type-III domain containing protein 3A; 99.63
2gys_A419 Cytokine receptor common beta chain; dimer of inte 99.63
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 99.63
1b6u_A257 KIR2DL3, P58 killer cell inhibitory receptor; natu 99.63
2w59_A231 IGY FCU3-4; immunoglobulin, avian, immune system; 99.63
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 99.62
3pl6_D268 MBP peptide / T-cell receptor beta chain chimera; 99.62
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 99.62
1he7_A126 High affinity nerve growth factor receptor; transf 99.62
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 99.62
2c1o_A254 IGK-C protein; FAB fragment, enantioselective, fin 99.62
1c5d_H215 Monoclonal antibody against the main immunogenic t 99.62
1x5x_A109 Fibronectin type-III domain containing protein 3A; 99.62
3p2t_A196 Leukocyte immunoglobulin-like receptor subfamily 4 99.61
3bn9_D257 E2 FAB heavy chain; antibody-protease complex, pro 99.61
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 99.61
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 99.61
2crm_A120 Fibronectin type-III domain containing protein 3A; 99.61
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 99.61
2wbj_D279 OB TCR; transmembrane, immune response, T cell rec 99.61
1x3d_A118 Fibronectin type-III domain containing protein 3A; 99.61
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 99.61
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 99.6
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 99.6
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 99.6
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 99.6
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 99.6
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 99.6
1l6x_A207 Immunoglobulin gamma-1 heavy chain constant regio; 99.6
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 99.6
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 99.6
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 99.59
3shs_A304 HOC head outer capsid protein; immunoglobulin-like 99.59
1mq8_A291 ICAM-1, intercellular adhesion molecule-1, CD54 an 99.59
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 99.59
3uzq_A253 Anti-dengue MAB 4E11; dengue antibody neutralizati 99.58
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 99.58
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 99.58
2lvc_A91 Obscurin-like protein 1; structural genomics, nort 99.58
1ypz_F230 T-cell receptor gamma chain, beta-2-microglobulin; 99.58
1bec_A238 14.3.D T cell antigen receptor; T cell receptor; 1 99.58
2d3v_A196 Leukocyte immunoglobulin-like receptor subfamily A 99.58
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 99.58
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 99.58
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 99.58
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 99.57
3o3u_N581 Maltose-binding periplasmic protein, advanced Gly 99.57
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 99.57
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 99.57
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 99.57
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 99.57
2gi7_A184 GPVI protein; IG-like domains, blood clotting, cel 99.57
1wwb_X103 Protein (brain derived neurotrophic factor recepto 99.57
1nqb_A256 Single-chain antibody fragment; multivalent antibo 99.57
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 99.56
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 99.56
1f3r_B257 FV antibody fragment; IG-fold, immuno complex, ant 99.56
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 99.56
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 99.56
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 99.56
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 99.56
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 99.56
1ugn_A198 LIR1, leukocyte immunoglobulin-like receptor 1; im 99.56
3to4_D253 NKT vbeta2 (mouse variable domain, human constant; 99.55
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 99.55
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 99.55
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 99.55
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 99.55
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 99.55
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 99.55
2ghw_B247 Anti-SARS SCFV antibody, 80R; S protein, neutraliz 99.54
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 99.54
2edn_A118 Myosin-binding protein C, fast-type; beta-sandwich 99.54
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 99.54
1oll_A188 NK receptor; immune system/receptor, NK cell trigg 99.54
2fbo_J250 V1V2;, variable region-containing chitin-binding p 99.54
4acp_A240 IG gamma-1 chain C region; immune system, antibody 99.54
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 99.54
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 99.54
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 99.54
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 99.54
3tv3_H239 PGT128 heavy chain, IG gamma-1 chain C region; FAB 99.53
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 99.53
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 99.53
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 99.53
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 99.53
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 99.53
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 99.53
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 99.53
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 99.53
1waa_A93 Titin; metal binding protein, calmodulin-binding, 99.53
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 99.53
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 99.52
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 99.52
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 99.52
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 99.52
1nkr_A201 P58-CL42 KIR; inhibitory receptor, natural killer 99.52
3umt_A256 SCFV heavy chain and light chain; stability engine 99.52
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 99.52
2e6q_A112 Obscurin-like protein 1; IG-like domain, structura 99.52
3qhz_H232 Human monoclonal antibody DEL2D1, FAB heavy chain; 99.52
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 99.52
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 99.52
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 99.52
3u2s_H248 PG9 heavy chain; greek KEY, immunoglobulin, immune 99.52
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 99.51
3tf7_C256 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; 99.51
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 99.51
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 99.51
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 99.51
1p6f_A242 NKP46, natural cytotoxicity triggering receptor 1; 99.51
1qok_A282 MFE-23 recombinant antibody fragment; immunoglobul 99.51
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 99.51
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 99.5
1wwb_X103 Protein (brain derived neurotrophic factor recepto 99.5
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 99.5
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 99.5
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 99.5
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 99.5
2pet_A231 Lutheran blood group glycoprotein; immunoglobulin 99.5
4hwu_A95 Fibroblast growth factor receptor 2; FGFR2, KGFR, 99.5
1ypz_E207 T cell receptor delta, beta-2-microglobulin; H2-T2 99.5
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 99.5
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 99.49
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 99.49
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 99.49
3juy_B256 3B3 single chain variant HIV-1 antibody; envelope 99.49
3esu_F250 Antibody 14B7* light chain and antibody 14B7* heav 99.49
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 99.49
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 99.49
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 99.49
1oga_E252 TRBC1, T-cell receptor beta chain C region; immune 99.49
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 99.49
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 99.48
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 99.48
2lu7_A84 Obscurin-like protein 1; structural genomics, nort 99.48
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 99.48
1he7_A126 High affinity nerve growth factor receptor; transf 99.48
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 99.48
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 99.48
2znx_A242 SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s 99.48
2p1y_A238 Bispecific alpha/beta TCR; autoimmunity, immunoglo 99.48
4frw_A218 Poliovirus receptor-related protein 4; immunoglobu 99.48
1ow0_A214 IG alpha-1 chain C region; IGA1, fcari, CD89, anti 99.48
3auv_A276 SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid 99.47
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 99.47
3m45_A108 Cell adhesion molecule 2; IG fold, dimer, disulfid 99.47
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 99.47
1moe_A240 Anti-CEA MAB T84.66; anti carcinoembryonic antigen 99.47
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 99.47
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 99.47
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 99.47
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 99.47
2zg1_A214 Sialic acid-binding IG-like lectin 5; siglec-5 inh 99.47
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 99.47
3gkz_A257 Anti-methamphetamine single chain FV; therapeutic 99.47
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 99.46
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 99.46
3rbg_A124 Cytotoxic and regulatory T-cell molecule; IGV, crt 99.46
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 99.46
2lvc_A91 Obscurin-like protein 1; structural genomics, nort 99.46
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
Probab=100.00  E-value=1.5e-53  Score=423.68  Aligned_cols=543  Identities=17%  Similarity=0.233  Sum_probs=385.8

Q ss_pred             CceeeeecCCeEEEEEEeccCCCceEEEEECCEEeecCCceeEEEeCCeEEEEEcccCCCCceEEEEEEEcCCeeeEEEE
Q psy12425          2 PNALYIPEGDNTKVKIFYAGDQPMEVSLTKNGRVVQSDDRFKFTVLDDYIIIFIKEIRKEDAGDYTVNLSNSSGSVSGTF   81 (591)
Q Consensus         2 p~~~~v~~G~~~~l~C~~~~~p~~~v~W~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~g~Y~c~~~n~~g~~~~~~   81 (591)
                      ++++.+.+|+++.|.|.+.|.|.+.|.|+|||..+....++++...++..+|.|.+++.+|+|.|+|.|.|..|......
T Consensus        12 ~~~~~v~~G~~v~L~C~~~g~p~~~v~W~k~g~~l~~~~~~~~~~~~~~~~L~I~~v~~~D~G~Y~C~a~N~~g~~~~~~   91 (570)
T 3b43_A           12 LEHVEAAIGEPITLQCKVDGTPEIRIAWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYTCKAENSVGAVASSA   91 (570)
T ss_dssp             CCCEEECTTSCEEEEEEEESSSSCEEEEECSSSBCCCCSSEEEECCTTEEEEEESSCCGGGCEEEEEEEEETTEEEEEEE
T ss_pred             CCceEEcCCCEEEEEEEEccCCCCEEEEEECCEEccCCCCEEEEEECCEEEEEEccCChhhCEEEEEEEEeCCceEEEEE
Confidence            45788999999999999999999999999999999888888887777788999999999999999999999999988888


Q ss_pred             EEEEecCCCCCC---CCcceEEecCceEEEEecCCCCCCCcceeeEEEEEEecCCCceEEEEeecCcceEEEcCCcCCcE
Q psy12425         82 TINITGLPGPPI---GPLDVSEITKHTCTLHWNPPKYDGGLKVTHYVVERRDISMPHWICISTTCHDTTFIVQGLTEGQE  158 (591)
Q Consensus        82 ~l~v~~~p~~p~---~~~~~~~~~~~~~~l~w~~p~~~~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~i~~l~~~~~  158 (591)
                      .+.|...+.+|.   .+..+....+..+.|.|...... ...+.||.= ....................+.|..+...+.
T Consensus        92 ~l~v~~~~~~p~~~~~~~~~~~~~G~~v~l~C~~~g~p-~~~v~W~k~-g~~l~~~~~~~~~~~~~~~~L~i~~~~~~d~  169 (570)
T 3b43_A           92 VLVIKERKLPPSFARKLKDVHETLGFPVAFECRINGSE-PLQVSWYKD-GELLKDDANLQTSFIHNVATLQILQTDQSHV  169 (570)
T ss_dssp             EEEECCCCCCCEESSCCCCEEEETTSCEEEEEEEESSS-SCEEEEEET-TEECCCCSSEEEEEETTEEEEEESSCCGGGC
T ss_pred             EEEECCCCCCCcccccCCCeEecCCCeEEEEEEEccCC-CCEEEEEEC-CEECcCCCCEEEEEECCEEEEEECcCChHHC
Confidence            888876443333   22334555678899999743211 112333321 1111111112222223456788999999999


Q ss_pred             EEEEEEEEccCCCCCCCCccCcccccCCCCCCCCCC-CCeEEeecCCeEEEEEecCCCCCCcceEEEEEEeeecCCCccE
Q psy12425        159 YLFHVMAVNENGMGPPLEGINPIKAKSPYDKPSPPG-IPVVTQVGGDFVNLSWDKPLDDGGSRIQGYWIDKHEVGSDAWQ  237 (591)
Q Consensus       159 y~~~~~a~n~~g~~~~~~~~~~~~~~~~~~~p~~~~-~~~~~~~~~~~v~l~w~~~~~~~~~~~~~y~~~~~~~~~~~~~  237 (591)
                      +.|+|.|.|..|....+....   ......+|.... ........|..++|.|.....+. ..+. |...........-.
T Consensus       170 G~Y~C~a~n~~g~~~~~~~l~---v~~~~~pp~~~~~p~~~~v~~G~~~~l~C~~~g~p~-p~i~-W~k~g~~i~~~~~~  244 (570)
T 3b43_A          170 GQYNCSASNPLGTASSSAKLT---LSEHEVPPFFDLKPVSVDLALGESGTFKCHVTGTAP-IKIT-WAKDNREIRPGGNY  244 (570)
T ss_dssp             EEEEEEEEETTEEEEEEEEEE---EECCCCCCEEEECCCCBCCBSBSCEEEEEEEESSSC-CEEE-EEETTEECCTTSSE
T ss_pred             EEEEEEEEeCCcEEEEEEEEE---EcCCCCCCccccCCceeEecCCCeEEEEEEEEECCC-CEEE-EEECCEECcCCCcE
Confidence            999999999887643322111   111111111000 01123346788999998753221 1222 22111111111111


Q ss_pred             EEEeeecCCceeeecCcccCCcEEEEEEEEcCCCCCCCCCCcceEEEcCCCccCCCeEEeecc-ccceeccccEEEEEEE
Q psy12425        238 RVNVAICAPSQINIPNLIEGRQYEFRVYAQNEAGLSLPSSASNSVQIKDPMAAKAPEIIVPLR-NANAIQNHNAQFQCTI  316 (591)
Q Consensus       238 ~~~~~~~~~~~~~i~~l~~~~~~~y~c~a~n~~g~~~~s~~~~~~~~~~~~~~~~p~~~~~~~-~~~~~~g~~~~l~c~~  316 (591)
                      ... .......|.|.++...|.|.|+|.|.|..|...   ....+.+.     .+|.+...+. ...+.+|+.+.|.|.+
T Consensus       245 ~~~-~~~~~~~L~i~~v~~~D~G~Y~C~a~N~~g~~~---~~~~l~V~-----~~p~~~~~~~~~~~v~~g~~~~l~C~~  315 (570)
T 3b43_A          245 KMT-LVENTATLTVLKVTKGDAGQYTCYASNVAGKDS---CSAQLGVQ-----EPPRFIKKLEPSRIVKQDEHTRYECKI  315 (570)
T ss_dssp             EEE-EETTEEEEEESSBCGGGCEEEEEEEEETTEEEE---EEEEECCB-----CCCEEEECCCSBCCEESSCEEEEEEEE
T ss_pred             EEE-EECCEEEEEEcccCcccCEEEEEEEECCCCcEE---EEEEEEee-----cCCcccccCCCccEEcCCCcEEEEEEE
Confidence            111 112346899999999999999999999887532   23344443     5677665543 3457889999999999


Q ss_pred             cCCCCCeeEEecCCccCCCCCceEEEEeCCeEEEEEcceecccceEEEEEEEeCCcceeeeeEEEEecCCcccCCCCccc
Q psy12425        317 TGCPKPTISWLKGSREITPSARHHIFAEGDTYTLIINSVYGVDADEYVCRAVNKGGVKSTKAELIIMTAPKFNVPPRFRD  396 (591)
Q Consensus       317 ~~~p~~~v~W~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~g~y~c~a~n~~g~~~~~~~l~v~~~p~~~~~~~~~~  396 (591)
                      .|.|.+.+.|++++..+....++.+...+....|.|.++..+|+|.|+|.|.|..|.......|.|..+|.+...+.   
T Consensus       316 ~g~P~p~v~W~k~~~~l~~~~~~~~~~~~~~~~L~i~~v~~~D~G~Y~C~a~N~~g~~~~~~~l~V~~~P~~~~~~~---  392 (570)
T 3b43_A          316 GGSPEIKVLWYKDETEIQESSKFRMSFVESVAVLEMYNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPVFRKKPH---  392 (570)
T ss_dssp             ESSSSCEEEEEETTEECCCSSSEEEEEETTEEEEEEESCCGGGCEEEEEEEEBTTBCCEEEEEECEECCCEECSCCC---
T ss_pred             eeCCCCEEEEeECCEECCCCCcEEEEEECCEEEEEECCCCcccCEEEEEEEEeCCCEEEEEEEEEecCCCeeecCCC---
Confidence            99999999999999999888888877777778999999999999999999999999999999999999998776553   


Q ss_pred             ceeecCCCeEEEEEeeeccCCCeEEEeeCCeEeeeccceEEEecCCeeEEEEeccCCCcceeEEEEEEcCCCccceEEEE
Q psy12425        397 TAYFDKGENVVVKIPFTGYPKPKITWYRDNEVIESGGHFHVETSERHAILTIRDASNVDTAPYRVVAENDLGMDSAIVKI  476 (591)
Q Consensus       397 ~~~~~~g~~~~l~c~~~~~p~~~v~W~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~~~g~y~c~a~n~~g~~~~~~~~  476 (591)
                      ...+..|+.+.|.|.+.|.|.|.+.|+++|..+..+.++.+...+....|.|.++..+|+|.|+|.|.|..|.....+.+
T Consensus       393 ~~~~~~G~~v~l~C~~~g~P~p~v~W~k~g~~l~~~~~~~~~~~~~~~~L~i~~v~~~D~G~Y~C~A~N~~G~~~~~~~l  472 (570)
T 3b43_A          393 PVETLKGADVHLECELQGTPPFQVSWHKDKRELRSGKKYKIMSENFLTSIHILNVDSADIGEYQCKASNDVGSDTCVGSI  472 (570)
T ss_dssp             CEEECTTCCEEEEEEEESSSSCCCEEEETTEECCSSSSEEEEEETTEEEEEECSCCGGGCEEEEEEEECSSCEEEEEEEE
T ss_pred             ceeecCCCEEEEEEEEecCCCCEEEEEECCEECcCCCCEEEEEcCCEEEEEECCCChhhCEEEEEEEEECCCeEEEEEEE
Confidence            34567899999999999999999999999999988888888777777899999999999999999999999999999999


Q ss_pred             EecCCCC---CCCCCeeeeecCCeeEEEeeccccCCCcceeeEEEEeeeC-CCCceEEeceeeeeEEEEcCcccCceEEE
Q psy12425        477 QISDRPD---PPQFPTVEDIGHDSLALVWRAPIWDGGSNITNYIVEKREH-PMSSWIRVGNTRFTTMAITGLSPGHQYEF  552 (591)
Q Consensus       477 ~v~~~p~---~p~~~~~~~~~~~~v~l~W~~p~~~~~~~~~~y~v~~~~~-~~~~~~~~~~~~~~~~~i~~l~~~~~Y~~  552 (591)
                      .+..+|.   .+..+  ....+..+.|.|...... ...+.+|.-..... ...............|.|.++.+.+.+.|
T Consensus       473 ~v~~~P~~~~~~~~~--~~~~g~~~~l~c~~~g~p-~~~v~W~k~~~~~~~~~~~~~~~~~~~~~~L~i~~~~~~d~G~Y  549 (570)
T 3b43_A          473 TLKAPPRFVKKLSDI--STVVGEEVQLQATIEGAE-PISVAWFKDKGEIVRESDNIWISYSENIATLQFSRAEPANAGKY  549 (570)
T ss_dssp             EECCCCEEEECCCCB--CCBTTCCEEEEEEEESCS-SCCCEEEETTEECCCCTTTEEECCCSSEEEEEESSCCTTCCEEE
T ss_pred             EeccCCcccccCCCc--eecCCCeEEEEEEEecCC-CCEEEEEeCCeEeccCCCeEEEEECCCEEEEEECcCCHHHCEEE
Confidence            9988774   22222  223456788888753211 11233332111111 11122222233456899999999999999


Q ss_pred             EEEEEcCCcCCCCC
Q psy12425        553 RVYAENVYGRSDPS  566 (591)
Q Consensus       553 ~v~A~n~~G~~~~s  566 (591)
                      +|.|.|.+|....+
T Consensus       550 ~C~a~N~~G~~~~~  563 (570)
T 3b43_A          550 TCQIKNEAGTQECF  563 (570)
T ss_dssp             EEEEECSSCEEEEE
T ss_pred             EEEEEECCcEEEEE
Confidence            99999999976544



>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Back     alignment and structure
>2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Back     alignment and structure
>1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Back     alignment and structure
>2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Back     alignment and structure
>1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1iga_A IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg_A 2qtj_A 3chn_A 1r70_B 3cm9_A Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>1hzh_H IGG, immunoglobulin heavy chain; antibody, immune system; HET: NAG BMA MAN GAL FUC; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 PDB: 2ig2_H 1mco_H* Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>1igy_B IGG1 intact antibody MAB61.1.3; intact immunoglobulin, V region, C region, hinge region, immunoglobulin; HET: NAG FUL NDG BMA MAN GAL FUC; 3.20A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Back     alignment and structure
>4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Back     alignment and structure
>1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>1zvo_C Myeloma immunoglobulin D delta; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Back     alignment and structure
>4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>1za6_B IGG heavy chain; immunoglobulin fold, CH2-domain-deletion, immune system; 2.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>1hzh_H IGG, immunoglobulin heavy chain; antibody, immune system; HET: NAG BMA MAN GAL FUC; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 PDB: 2ig2_H 1mco_H* Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Back     alignment and structure
>1iga_A IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg_A 2qtj_A 3chn_A 1r70_B 3cm9_A Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Back     alignment and structure
>2c1o_A IGK-C protein; FAB fragment, enantioselective, finrozole, immune system, antibody, ENA11His antibody, immunoglobulin domain; 2.75A {Mus musculus} Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Back     alignment and structure
>1igy_B IGG1 intact antibody MAB61.1.3; intact immunoglobulin, V region, C region, hinge region, immunoglobulin; HET: NAG FUL NDG BMA MAN GAL FUC; 3.20A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>1zvo_C Myeloma immunoglobulin D delta; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... Back     alignment and structure
>1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Back     alignment and structure
>1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Back     alignment and structure
>2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A Back     alignment and structure
>2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Back     alignment and structure
>1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* Back     alignment and structure
>1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H Back     alignment and structure
>3knb_B Obscurin-like protein 1; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2wp3_O* 2wwm_C 2wwk_O Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L Back     alignment and structure
>3r06_A Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; anti-CD3epsilon, T-cell receptor, signalling, IMMU; 2.50A {Cricetulus migratorius} PDB: 3r08_L 3ld8_B 3ldb_B* Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A Back     alignment and structure
>2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A Back     alignment and structure
>3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Back     alignment and structure
>4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Back     alignment and structure
>1za6_B IGG heavy chain; immunoglobulin fold, CH2-domain-deletion, immune system; 2.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>3tv3_L PGT128 light chain, IG lambda-2 chain C regions; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_L* 3twc_L* 3tnm_L 2mcg_1 1mcw_M 1a8j_L 3mcg_1 1dcl_A 1mcb_A* 1mcc_A* 1mcd_A* 1mce_A* 1mcf_A* 1mch_A 1mci_A* 1mcj_A* 1mck_A 1mcl_A* 1mcn_A* 1mcq_A ... Back     alignment and structure
>3gkz_A Anti-methamphetamine single chain FV; therapeutic antibody, MDMA, IGG, immune system; HET: B40; 1.90A {Mus musculus} PDB: 3gm0_A* 1rvf_L 3ab0_C 2a0l_C 3iy5_A Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Back     alignment and structure
>3s96_B 3B5H10 FAB light chain; huntingtin, immune system; 1.90A {Mus musculus} PDB: 2qhr_L 3ffd_B 4dcq_A Back     alignment and structure
>3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* Back     alignment and structure
>3umt_A SCFV heavy chain and light chain; stability engineering, anthrax, anti-BCLA antibody, immunoglobulin fold (VH and VL domains), antibody, immune S; HET: NHE; 1.80A {Mus musculus} PDB: 1xiw_D Back     alignment and structure
>1nfd_E H57 FAB; complex (immunoreceptor-immunoglobulin), complex (immunorece immunoglobulin) complex; HET: NAG NDG; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Back     alignment and structure
>2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* Back     alignment and structure
>1q0x_L FAB 9B1, light chain; anti-morphine antibody, FAB fragment, immune system; HET: PG4; 1.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q0y_L* 1ngp_L* 1ngq_L 3ks0_L* 1gig_L 2vir_A 2vis_A* 2vit_A 1sm3_L 4a6y_L 1ind_L* 1ine_L* 1yuh_L* 2zpk_L 3rhw_K* 3ri5_K* 3ria_K* 3rif_K* 1mfe_L* 1mfb_L* ... Back     alignment and structure
>3juy_B 3B3 single chain variant HIV-1 antibody; envelope protein GP120, broadly neutralizing antibody, 3B3 single chain variable fragment, immune system; 2.50A {Homo sapiens} Back     alignment and structure
>2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A Back     alignment and structure
>1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>3sob_L Antibody light chain; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_A 3u1s_L* Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>1qok_A MFE-23 recombinant antibody fragment; immunoglobulin, single-chain FV, anti-carcinoembryonic antigen; 2.4A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>3knb_A Titin; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 3q5o_A 2wp3_T* 2wwk_T 2wwm_D 2y9r_T* Back     alignment and structure
>2xzc_L FAB A.17 light chain; immune system; HET: XOP; 1.36A {Homo sapiens} PDB: 2xza_L* 3kdm_L* 3nps_C 1dn0_A 1qlr_A* 2v7n_A 3eo0_A 3eo1_A 2agj_L* 2fx7_L 1tzg_L 2fx8_L 2fx9_L* 1u6a_L 3hi1_L* 3kym_A 3kyk_L 3qwo_L* 3ixt_L* 3qeg_L ... Back     alignment and structure
>1svz_A Immunoglobulin;, single-chain FV fragment 1696; antibody-antigen complex, HIV inhibiting antibody; 1.89A {Mus musculus} PDB: 1jp5_A Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1c1e_H Catalytic antibody 1E9 (heavy chain); diels-alder, immunoglobulin, immune system; HET: ENH; 1.90A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1dbb_H* 1dba_H* 1dbj_H* 1dbk_H* 1dbm_H* 2dbl_H* 3ojd_B 1jgl_H* 1jhk_H 1ghf_H 1tet_H* 3e8u_H 1fj1_B 1cl7_H Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A Back     alignment and structure
>3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>3bkj_L WO2 IGG2A FAB fragment light chain kappa; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} PDB: 3bkc_L 3bkm_L 2zuq_B* 1h3p_L Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Back     alignment and structure
>1mju_H Immunoglobulin MS6-12; catalytic antibody, ester hydrolysis, esterolytic, FAB, immune system; 1.22A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mjj_B 1mie_H 1mj7_H* 1mj8_H 1mh5_B* 4aeh_H 2y5t_A 2vwe_E 2op4_H 2ntf_H 3loh_C 1e4x_H 2vl5_A 1e4x_I 1e4w_H 3opz_H 3oz9_H 1plg_H 1hi6_B 1cfn_B ... Back     alignment and structure
>3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} Back     alignment and structure
>1q9r_B S25-2 FAB (IGG1K) heavy chain; antigen-binding fragment, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, KDO, complex, immune system; HET: KDA KDO; 1.45A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q9l_B 1q9k_B* 1q9q_B* 1q9v_B* 2r1w_B* 2r1x_B* 2r1y_B* 2r2b_B* 2r2e_B* 2r2h_B* 3bpc_B* 3sy0_B* 3t4y_B* 3t65_B* 2r23_B* 1q9t_B* 3t77_B* 3okl_B* 3okk_B* 3okm_B ... Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Back     alignment and structure
>2gjj_A A21 single-chain antibody fragment against ERBB2; IG family, SCFV, immune system; 2.10A {Mus musculus} PDB: 3h3b_C Back     alignment and structure
>3knb_B Obscurin-like protein 1; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2wp3_O* 2wwm_C 2wwk_O Back     alignment and structure
>3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>4dzb_B Vbeta2 (MAIT T cell receptor); immune system; 1.70A {Homo sapiens} PDB: 1ymm_E* 3o4l_E* 3o6f_D 3t0e_D 1ktk_E 3mfg_B 2ij0_E Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Back     alignment and structure
>2j6e_L IGM, FAB light chain; autoimmune complex human IGM rheumatoid factor IGG1-FC, immunoglobulin C region, membrane, glycoprotein, transmembrane; HET: NAG FUL BMA MAN NDG GAL; 3.0A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* Back     alignment and structure
>3d9a_H Heavy chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_H 1gpo_H 3ks0_H* 1dqd_H 1ndm_B 1nak_H 1dqq_B 1dqm_H 1dqj_B 1nby_B 1nbz_B 1xgu_B 1ndg_B 1xgt_B 1xgp_B 1xgq_B 1xgr_B 1s5i_H 1f8t_H 1f90_H ... Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Back     alignment and structure
>1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* Back     alignment and structure
>2gki_A Nuclease; anti-DNA antibody, catalytic antibody, immune system; 2.88A {Mus musculus} Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>3fku_X Neutralizing antibody F10; influenza, hemagglutinin, SCFV, F membrane, envelope protein, fusion protein, membrane, trans virion; HET: NAG BMA; 3.20A {Homo sapiens} Back     alignment and structure
>3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1hxm_B Gamma-delta T-cell receptor; IG domain, TCR, GDTCR, immune system; 3.12A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>3omz_A Human vdelta1 gamma delta T cell receptor delta1A; immunoglobulin fold, immune surveillance of cell stress PROT A/B, MIC-A/B binding, epithelium; 3.04A {Homo sapiens} Back     alignment and structure
>2fbj_H IGA-kappa J539 FAB (heavy chain); immunoglobulin; HET: NAG FUC; 1.95A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mcp_H 2mcp_H* Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>2rgs_A I, IG gamma-2B heavy chain; FC-fragment, immunoglobulin, glycosylation, immune system; HET: NAG FUC MAN GAL; 2.13A {Mus musculus} Back     alignment and structure
>1x9q_A SCFV, 4M5.3 anti-fluorescein single chain antibody fragment; VERY high affinity, antibody binding, electrostatics, directed evolution; HET: FLU; 1.50A {Homo sapiens} Back     alignment and structure
>1pz5_B Heavy chain of FAB (SYA/J6); antibody-antigen structure, peptide-carbohydrate mimicry, VA design, immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1m7d_B* 1m71_B* 1m7i_B* 1r24_B 1uz6_F 1uz8_B* 1clz_H* Back     alignment and structure
>3bqu_C 3H6 FAB light chain; beta sheet, immune system; 3.00A {Mus musculus} Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>3bae_H WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} SCOP: b.1.1.2 PDB: 3bkc_H 3bkj_H 3bkm_H 3mck_H 2r0w_H* 2iqa_H 2iq9_H 1ggi_H 1ggb_H 1ggc_H 3eys_H* 2ipt_H 2ipu_H 3eyu_H* 2r0z_H* 3rkd_H 1r0a_H* 1n5y_H* 1n6q_H* 1t03_H* ... Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>1op3_H FAB 2G12, heavy chain; domain-swapped FAB 2G12, anti-carbohydrate antibody, immune system; HET: MAN; 1.75A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1om3_H* 1op5_H* 3oay_M* 1zlu_H* 1zlv_H* 1zlw_H* 2oqj_B 1zls_H* 3ob0_H* 3oau_H* 3oaz_H* 3ghe_H 3eyf_B 3eyo_B 3ghb_H 3c2a_H 1q1j_H 2fl5_H* Back     alignment and structure
>3qib_D 2B4 beta chain; IG domain, immune system; HET: NAG FUC BMA; 2.70A {Mus musculus} Back     alignment and structure
>1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vol_A Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, cytoplasm, mouse IGG, zinc-finger, DNA-binding, RNA-binding, tripartite motif (TRIM) protein; HET: NAG MAN GAL FUC; 1.95A {Mus musculus} PDB: 3hkf_A 1i1a_C* 1cqk_A Back     alignment and structure
>3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1dee_B IGM RF 2A2; FAB-IBP complex 2.7A resolution binding outside the antigen combining site superantigen FAB VH3 specificity; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1hez_B 1adq_H Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Back     alignment and structure
>2lu7_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3knb_A Titin; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 3q5o_A 2wp3_T* 2wwk_T 2wwm_D 2y9r_T* Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Back     alignment and structure
>3liz_H 4C3 monoclonal antibody heavy chain; hydrolase-immune system complex; HET: NAG BMA MAN; 1.80A {Mus musculus} PDB: 3rvv_D* 3rvu_D 3rvt_D* 3rvw_D* 3rvx_D 1lo4_H 1ub6_H 3r06_B 3r08_H Back     alignment and structure
>1dn0_B IGM-kappa cold agglutinin (heavy chain); FAB, antibody, human, immune system; 2.28A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1qlr_B* 2j6e_H* 2agj_H* 2h32_H Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Back     alignment and structure
>3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Back     alignment and structure
>4ei6_B Vbeta16 XV19 type II natural killer T cell recept variable domain, human constant...; natural killer T cell receptor, immune system; 1.60A {Mus musculus} PDB: 4ei5_D 4elk_B 4elm_F* 2esv_E 3ffc_E 3utt_E 3utp_E* 3uts_E 3qjf_B 3qjh_B 3qiw_D* 3qiu_D Back     alignment and structure
>2xqy_G A13-D6.3 monoclonal antibody, envelope glycoprotein H; immune system-viral protein complex, envelope protein; HET: NAG; 2.05A {Mus musculus} Back     alignment and structure
>3q5y_A TCR N15 beta; IG, T cell receptor, antigen peptide/MHC, membrane, immune S; HET: EPE; 1.90A {Mus musculus} PDB: 1nfd_B* 3q5t_A Back     alignment and structure
>3m8o_H Immunoglobulin A1 heavy chain; immunoglobulin fold, immune system; 1.55A {Homo sapiens} PDB: 3qnx_B 3qny_B Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1i1c_A IGG2A, IG gamma-2A chain C region; FC, immune system; HET: NAG FUL BMA MAN FUC; 2.70A {Rattus norvegicus} SCOP: b.1.1.2 b.1.1.2 PDB: 1i1a_D* Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2w59_A IGY FCU3-4; immunoglobulin, avian, immune system; HET: NAG MAN; 1.75A {Gallus gallus} Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Back     alignment and structure
>3pl6_D MBP peptide / T-cell receptor beta chain chimera; TCR-MHC complex, immunoglobulin fold, immune receptor, membr immune system; HET: NAG; 2.55A {Homo sapiens} Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Back     alignment and structure
>2c1o_A IGK-C protein; FAB fragment, enantioselective, finrozole, immune system, antibody, ENA11His antibody, immunoglobulin domain; 2.75A {Mus musculus} Back     alignment and structure
>1c5d_H Monoclonal antibody against the main immunogenic the human muscle acetylcholine receptor...; immunoglobulin, immune system; 2.40A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 2arj_H 3b9k_H* 2gk0_H 2gjz_H 1fn4_B 3mj8_H 3mj9_H* Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Back     alignment and structure
>3bn9_D E2 FAB heavy chain; antibody-protease complex, protein-protein complex, enzyme- inhibitor complex, disease mutation, glycoprotein, hydrolase; 2.17A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 3kr3_H 2xtj_E Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2wbj_D OB TCR; transmembrane, immune response, T cell receptor, MHC II, MEM receptor, molecular mimicry, multiple sclerosis, immune SYS autoimmunity; HET: NAG BMA MAN; 3.00A {Homo sapiens} Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Back     alignment and structure
>1l6x_A Immunoglobulin gamma-1 heavy chain constant regio; IGG1 FC, FC complex, immune system; HET: NAG BMA MAN GAL FUL; 1.65A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2iwg_A* 3v7m_A* 3d6g_A* 3agv_A* 1oqo_A* 1oqx_A* 3v95_A* 2wah_A* 3sgj_A* 3sgk_A* 2dtq_A* 2dts_A* 3ave_A* 3ay4_A* 3do3_A* 2gj7_A* 1t83_A* 1t89_A* 1dn2_A* 3dnk_A ... Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Back     alignment and structure
>1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lvc_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>1ypz_F T-cell receptor gamma chain, beta-2-microglobulin; H2-T22 protein, T cell receptor delta, immune system; HET: NAG MAN FUC; 3.40A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>1bec_A 14.3.D T cell antigen receptor; T cell receptor; 1.70A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1jck_A 1l0x_A 1sbb_A 1l0y_A 3c6l_B 1mwa_B* 1g6r_B* 1tcr_B* 2ckb_B 2q86_B* 1lp9_F 2j8u_F 2jcc_F 2uwe_F 3mbe_D* 1d9k_B* 2aq3_A 3mc0_A 3byt_A 3bzd_A ... Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3o3u_N Maltose-binding periplasmic protein, advanced Gly END product-specific receptor; RAGE, AGER, scavenger receptor; HET: MLR; 1.50A {Escherichia coli} PDB: 3s59_A 3s58_A 3cjj_A 2l7u_A* 2e5e_A Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Back     alignment and structure
>1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Back     alignment and structure
>3to4_D NKT vbeta2 (mouse variable domain, human constant; mouse CD1D, mouse NKT, immune system; HET: AGH NAG; 3.10A {Homo sapiens} Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} SCOP: b.1.1.0 Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Back     alignment and structure
>2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Back     alignment and structure
>4acp_A IG gamma-1 chain C region; immune system, antibody, kifunensine; HET: NAG; 2.49A {Homo sapiens} PDB: 2j6e_A* Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Back     alignment and structure
>3tv3_H PGT128 heavy chain, IG gamma-1 chain C region; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_H* 3twc_H* 3tje_H* 3thm_H* 4fqq_H 2xzc_H* 2xza_H* 3b2u_H* 3b2v_H* 3mly_H 3mlz_H 4fq2_H 2ykl_H* 3tnm_H 4fqc_H* 4fq1_H* 2yk1_H* 3mlx_H 2jix_D 2vxq_H ... Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A Back     alignment and structure
>3umt_A SCFV heavy chain and light chain; stability engineering, anthrax, anti-BCLA antibody, immunoglobulin fold (VH and VL domains), antibody, immune S; HET: NHE; 1.80A {Mus musculus} PDB: 1xiw_D Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>2e6q_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3qhz_H Human monoclonal antibody DEL2D1, FAB heavy chain; immunoglobulin, immune recognition, influenza A hemagglutini system; 1.55A {Homo sapiens} PDB: 3lzf_H* 3qrg_H* 3mod_H 3mob_H 3moa_H 3lev_H* 3idg_B 3d0l_B 3d0v_B 3idi_B 3idj_B 3idm_B* 3idn_B* 1tjg_H* 1tjh_H* 1tji_H* 2pr4_H 3drq_B 2p8m_B 2p8p_B ... Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3u2s_H PG9 heavy chain; greek KEY, immunoglobulin, immune recognition, immune system; HET: PCA TYS BU3 NAG BMA MAN; 1.80A {Homo sapiens} PDB: 3u4e_H* 3u36_H 3mug_B* 3lrs_H* 3mme_H* 2qsc_H* Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Back     alignment and structure
>3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1qok_A MFE-23 recombinant antibody fragment; immunoglobulin, single-chain FV, anti-carcinoembryonic antigen; 2.4A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Back     alignment and structure
>4hwu_A Fibroblast growth factor receptor 2; FGFR2, KGFR, CD332, IG-C2 type 1 domain, IG superfamily, IMM system, structural genomics, PSI-biology; 2.90A {Mus musculus} Back     alignment and structure
>1ypz_E T cell receptor delta, beta-2-microglobulin; H2-T22 protein, T cell receptor delta, immune system; HET: NAG MAN FUC; 3.40A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3juy_B 3B3 single chain variant HIV-1 antibody; envelope protein GP120, broadly neutralizing antibody, 3B3 single chain variable fragment, immune system; 2.50A {Homo sapiens} Back     alignment and structure
>3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Back     alignment and structure
>1oga_E TRBC1, T-cell receptor beta chain C region; immune system/receptor, immune system/receptor/complex, TCR, MHC, immunodominance, FLU, complex; 1.40A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 2vlm_E 2vlk_E 2vlj_E 2vlr_E 2xna_B 2xn9_B 2axh_A 2axj_A 3scm_D* 3sda_D* 3sdc_D* 3sdd_D* 3qi9_D* 3mff_B* 2ak4_E 3he7_D* 2eyr_B 3pqy_E 3kxf_E 2cde_B ... Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2lu7_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* Back     alignment and structure
>2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A Back     alignment and structure
>4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} Back     alignment and structure
>1ow0_A IG alpha-1 chain C region; IGA1, fcari, CD89, antibody, immunoglobulin-LIK immune system; HET: NAG FUL BMA GAL SIA FUC MAN NDG; 3.10A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2qej_A* Back     alignment and structure
>3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3m45_A Cell adhesion molecule 2; IG fold, dimer, disulfide bond, glycoprotein, immunoglobulin membrane, transmembrane; HET: NAG; 2.21A {Mus musculus} Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Back     alignment and structure
>3gkz_A Anti-methamphetamine single chain FV; therapeutic antibody, MDMA, IGG, immune system; HET: B40; 1.90A {Mus musculus} PDB: 3gm0_A* 1rvf_L 3ab0_C 2a0l_C 3iy5_A Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Back     alignment and structure
>3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lvc_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 591
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 2e-25
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 5e-10
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 5e-10
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 9e-10
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 3e-09
d1x5ya198 b.1.2.1 (A:8-105) Myosin binding protein C, fast-t 6e-21
d1x5ya198 b.1.2.1 (A:8-105) Myosin binding protein C, fast-t 3e-20
d1x5ya198 b.1.2.1 (A:8-105) Myosin binding protein C, fast-t 4e-19
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 2e-20
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 7e-20
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 2e-17
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 8e-20
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 1e-18
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 7e-17
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 4e-19
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 1e-15
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 2e-15
d1wf5a1108 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) 5e-19
d1wf5a1108 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) 3e-18
d1wf5a1108 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) 6e-18
d1wk0a_137 b.1.2.1 (A:) Fibronectin type-III domain containin 6e-19
d1wk0a_137 b.1.2.1 (A:) Fibronectin type-III domain containin 3e-12
d1wk0a_137 b.1.2.1 (A:) Fibronectin type-III domain containin 5e-12
d2crza197 b.1.2.1 (A:8-104) Fibronectin type-III domain cont 1e-18
d2crza197 b.1.2.1 (A:8-104) Fibronectin type-III domain cont 5e-18
d2crza197 b.1.2.1 (A:8-104) Fibronectin type-III domain cont 2e-15
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 1e-17
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 3e-14
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 8e-14
d2crma1107 b.1.2.1 (A:8-114) Fibronectin type-III domain cont 1e-17
d2crma1107 b.1.2.1 (A:8-114) Fibronectin type-III domain cont 1e-14
d2crma1107 b.1.2.1 (A:8-114) Fibronectin type-III domain cont 1e-12
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 2e-17
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 5e-17
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 3e-15
d1bpva_104 b.1.2.1 (A:) Type I titin module {Human (Homo sapi 2e-17
d1bpva_104 b.1.2.1 (A:) Type I titin module {Human (Homo sapi 3e-15
d1bpva_104 b.1.2.1 (A:) Type I titin module {Human (Homo sapi 1e-14
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 2e-17
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 2e-15
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 8e-14
d1tdqa292 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu 4e-17
d1tdqa292 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu 2e-12
d1tdqa292 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu 8e-11
d2cqva1101 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T 7e-17
d2cqva1101 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T 2e-16
d2cqva1101 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T 1e-11
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 2e-16
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 7e-16
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 7e-16
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 2e-16
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 1e-12
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 3e-12
d1wisa1111 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) 4e-16
d1wisa1111 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) 5e-16
d1wisa1111 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) 2e-12
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 8e-16
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 2e-15
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 3e-14
d3dara197 b.1.1.4 (A:153-249) Fibroblast growth factor recep 1e-15
d3dara197 b.1.1.4 (A:153-249) Fibroblast growth factor recep 2e-12
d3dara197 b.1.1.4 (A:153-249) Fibroblast growth factor recep 7e-07
d1ueya_127 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 2e-15
d1ueya_127 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 4e-14
d1ueya_127 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 2e-13
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 3e-15
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 3e-15
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 4e-14
d1x5xa196 b.1.2.1 (A:8-103) Fibronectin type-III domain cont 3e-15
d1x5xa196 b.1.2.1 (A:8-103) Fibronectin type-III domain cont 4e-15
d1x5xa196 b.1.2.1 (A:8-103) Fibronectin type-III domain cont 1e-13
d1qr4a187 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) 4e-15
d1qr4a187 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) 3e-12
d1qr4a187 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) 1e-09
d1j8ka_94 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 4e-15
d1j8ka_94 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 1e-12
d1j8ka_94 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 5e-12
d1tdqa386 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic 4e-15
d1tdqa386 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic 7e-10
d1tdqa386 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic 2e-09
d1fnha389 b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod 5e-15
d1fnha389 b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod 2e-13
d1fnha389 b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod 2e-11
d1g1ca_98 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 6e-15
d1g1ca_98 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 4e-09
d1g1ca_98 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 6e-05
d1koaa197 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha 2e-14
d1koaa197 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha 3e-11
d1koaa197 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha 3e-08
d2ic2a1107 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit 3e-14
d2ic2a1107 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit 2e-12
d2ic2a1107 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit 7e-11
d1qr4a288 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu 3e-14
d1qr4a288 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu 1e-13
d1qr4a288 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu 3e-09
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 5e-14
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 1e-11
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 1e-10
d1tena_90 b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId 6e-14
d1tena_90 b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId 3e-10
d1tena_90 b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId 1e-09
d2cuma193 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) 6e-14
d2cuma193 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) 2e-10
d2cuma193 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) 3e-08
d1fnfa389 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m 6e-14
d1fnfa389 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m 9e-14
d1fnfa389 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m 1e-11
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 1e-13
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 4e-13
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 4e-11
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 1e-13
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 4e-13
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 6e-12
d1y6kr199 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10 2e-13
d1y6kr199 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10 2e-10
d1y6kr199 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10 2e-09
d1f6fb2103 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu 2e-13
d1f6fb2103 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu 6e-12
d1f6fb2103 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu 8e-11
d1n26a3104 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c 2e-13
d1n26a3104 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c 3e-13
d1n26a3104 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c 2e-11
d1cd9b1107 b.1.2.1 (B:1-107) Granulocyte colony-stimulating f 2e-13
d1cd9b1107 b.1.2.1 (B:1-107) Granulocyte colony-stimulating f 3e-11
d1cd9b1107 b.1.2.1 (B:1-107) Granulocyte colony-stimulating f 1e-08
d1iarb2101 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch 3e-13
d1iarb2101 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch 1e-11
d1iarb2101 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch 1e-11
d1cd9b2106 b.1.2.1 (B:108-213) Granulocyte colony-stimulating 4e-13
d1cd9b2106 b.1.2.1 (B:108-213) Granulocyte colony-stimulating 3e-10
d1cd9b2106 b.1.2.1 (B:108-213) Granulocyte colony-stimulating 1e-08
d1cfba1100 b.1.2.1 (A:610-709) Neuroglian, two amino proximal 4e-13
d1cfba1100 b.1.2.1 (A:610-709) Neuroglian, two amino proximal 7e-12
d1cfba1100 b.1.2.1 (A:610-709) Neuroglian, two amino proximal 3e-11
d1uc6a_109 b.1.2.1 (A:) Ciliary neurotrophic factor receptor 4e-13
d1uc6a_109 b.1.2.1 (A:) Ciliary neurotrophic factor receptor 5e-12
d1uc6a_109 b.1.2.1 (A:) Ciliary neurotrophic factor receptor 7e-10
d1wfua_120 b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat 5e-13
d1wfua_120 b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat 7e-12
d1wfua_120 b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat 2e-08
d2cuia1101 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) 7e-13
d2cuia1101 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) 4e-11
d2cuia1101 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) 8e-09
d1fyhb198 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha 1e-12
d1fyhb198 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha 2e-12
d1fyhb198 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha 3e-12
d1fnha190 b.1.2.1 (A:3-92) Fibronectin, different Fn3 module 1e-12
d1fnha190 b.1.2.1 (A:3-92) Fibronectin, different Fn3 module 5e-12
d1fnha190 b.1.2.1 (A:3-92) Fibronectin, different Fn3 module 2e-09
d1bqua2115 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki 1e-12
d1bqua2115 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki 5e-09
d1bqua2115 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki 7e-09
d1fnfa291 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m 1e-12
d1fnfa291 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m 1e-11
d1fnfa291 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m 1e-10
d1fhga_102 b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) 2e-12
d1fhga_102 b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) 4e-06
d1fhga_102 b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) 2e-05
d1fnaa_91 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 3e-12
d1fnaa_91 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 2e-11
d1fnaa_91 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 2e-11
d1fnha290 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu 3e-12
d1fnha290 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu 3e-11
d1fnha290 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu 3e-09
d2b5ib2104 b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch 4e-12
d2b5ib2104 b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch 4e-11
d2b5ib2104 b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch 9e-11
d2d9qb2105 b.1.2.1 (B:204-308) Granulocyte colony-stimulating 6e-12
d2d9qb2105 b.1.2.1 (B:204-308) Granulocyte colony-stimulating 6e-10
d2d9qb2105 b.1.2.1 (B:204-308) Granulocyte colony-stimulating 5e-08
d2gysa2114 b.1.2.1 (A:104-217) Common beta-chain in the GM-CS 7e-12
d2gysa2114 b.1.2.1 (A:104-217) Common beta-chain in the GM-CS 7e-09
d1tdqa193 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) 8e-12
d1tdqa193 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) 6e-09
d1tdqa193 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) 1e-07
d1tnna_91 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 9e-12
d1tnna_91 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 5e-07
d1tnna_91 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 1e-06
d1x4xa193 b.1.2.1 (A:8-100) Fibronectin type-III domain cont 1e-11
d1x4xa193 b.1.2.1 (A:8-100) Fibronectin type-III domain cont 5e-11
d1x4xa193 b.1.2.1 (A:8-100) Fibronectin type-III domain cont 5e-09
d1qg3a2103 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum 1e-11
d1qg3a2103 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum 6e-11
d1qg3a2103 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum 6e-10
d1wiua_93 b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis el 1e-11
d1wiua_93 b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis el 5e-08
d2b5ic195 b.1.2.1 (C:130-224) Cytokine receptor common gamma 2e-11
d2b5ic195 b.1.2.1 (C:130-224) Cytokine receptor common gamma 8e-08
d2b5ic195 b.1.2.1 (C:130-224) Cytokine receptor common gamma 2e-07
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 2e-11
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 5e-11
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 2e-10
d2fdbp2109 b.1.1.4 (P:2252-2360) Fibroblast growth factor rec 2e-11
d2fdbp2109 b.1.1.4 (P:2252-2360) Fibroblast growth factor rec 1e-06
d2fdbp2109 b.1.1.4 (P:2252-2360) Fibroblast growth factor rec 2e-04
d1biha489 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr 3e-11
d1biha489 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr 4e-11
d1biha489 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr 3e-05
d1x5ja1100 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ 4e-11
d1x5ja1100 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ 2e-10
d1x5ja1100 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ 6e-08
d1ujta_120 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 6e-11
d1ujta_120 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 2e-06
d1bqua195 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine- 6e-11
d1bqua195 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine- 4e-10
d1bqua195 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine- 4e-08
d1x44a190 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-ty 8e-11
d1x44a190 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-ty 4e-04
d1k85a_88 b.1.2.1 (A:) Fibronectin type III domain from chit 1e-10
d1k85a_88 b.1.2.1 (A:) Fibronectin type III domain from chit 1e-10
d1k85a_88 b.1.2.1 (A:) Fibronectin type III domain from chit 5e-10
d2c9aa196 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein 1e-10
d2c9aa196 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein 6e-06
d1axib2106 b.1.2.1 (B:131-236) Growth hormone receptor {Human 1e-10
d1axib2106 b.1.2.1 (B:131-236) Growth hormone receptor {Human 5e-10
d1axib2106 b.1.2.1 (B:131-236) Growth hormone receptor {Human 1e-09
d1wwca_105 b.1.1.4 (A:) NT3 binding domain of trkC receptor { 2e-10
d1wwca_105 b.1.1.4 (A:) NT3 binding domain of trkC receptor { 4e-08
d1wwca_105 b.1.1.4 (A:) NT3 binding domain of trkC receptor { 4e-04
d1x5aa194 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse 2e-10
d1x5aa194 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse 4e-10
d1x5aa194 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse 2e-09
d2vkwa293 b.1.2.1 (A:601-693) Neural cell adhesion molecule 2e-10
d2vkwa293 b.1.2.1 (A:601-693) Neural cell adhesion molecule 4e-10
d2vkwa293 b.1.2.1 (A:601-693) Neural cell adhesion molecule 5e-09
d3d48r2104 b.1.2.1 (R:101-204) Prolactin receptor {Human (Hom 2e-10
d3d48r2104 b.1.2.1 (R:101-204) Prolactin receptor {Human (Hom 7e-09
d3d48r2104 b.1.2.1 (R:101-204) Prolactin receptor {Human (Hom 1e-08
d1cs6a489 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall 2e-10
d1cs6a489 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall 1e-05
d1cs6a489 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall 0.003
d2fnba_95 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 2e-10
d2fnba_95 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 4e-10
d2fnba_95 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 7e-08
d1fnfa194 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m 3e-10
d1fnfa194 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m 3e-10
d1fnfa194 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m 1e-08
d1cs6a197 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus 4e-10
d1cs6a197 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus 9e-06
d1biha194 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropi 4e-10
d1biha194 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropi 4e-06
d1wwbx_103 b.1.1.4 (X:) Ligand binding domain of trkB recepto 4e-10
d1wwbx_103 b.1.1.4 (X:) Ligand binding domain of trkB recepto 4e-09
d1wwbx_103 b.1.1.4 (X:) Ligand binding domain of trkB recepto 7e-04
d1cs6a391 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall 5e-10
d1cs6a391 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall 3e-07
d1cs6a391 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall 0.001
d1qz1a3100 b.1.1.4 (A:190-289) Neural cell adhesion molecule 7e-10
d1qz1a3100 b.1.1.4 (A:190-289) Neural cell adhesion molecule 2e-09
d1qz1a3100 b.1.1.4 (A:190-289) Neural cell adhesion molecule 2e-04
d2avga1110 b.1.1.4 (A:1-110) Cardiac myosin binding protein C 1e-09
d2avga1110 b.1.1.4 (A:1-110) Cardiac myosin binding protein C 1e-04
d1he7a_107 b.1.1.4 (A:) High affinity nerve growth factor rec 1e-09
d1he7a_107 b.1.1.4 (A:) High affinity nerve growth factor rec 7e-09
d1he7a_107 b.1.1.4 (A:) High affinity nerve growth factor rec 7e-04
d2gysa4100 b.1.2.1 (A:317-416) Common beta-chain in the GM-CS 1e-09
d2gysa4100 b.1.2.1 (A:317-416) Common beta-chain in the GM-CS 2e-09
d2gysa4100 b.1.2.1 (A:317-416) Common beta-chain in the GM-CS 3e-07
d1qg3a192 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum 2e-09
d1qg3a192 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum 2e-09
d1qg3a192 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum 5e-09
d2djsa195 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human 2e-09
d2djsa195 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human 2e-09
d2djsa195 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human 4e-09
d1cfba2105 b.1.2.1 (A:710-814) Neuroglian, two amino proximal 2e-09
d1cfba2105 b.1.2.1 (A:710-814) Neuroglian, two amino proximal 2e-08
d1cfba2105 b.1.2.1 (A:710-814) Neuroglian, two amino proximal 7e-07
d1x4ya1101 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { 2e-09
d1x4ya1101 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { 5e-09
d1x4ya1101 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { 2e-08
d3b5ha1101 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo 4e-09
d2ibga195 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit 4e-09
d2ibga195 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit 9e-09
d2ibga195 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit 5e-08
d2haza1101 b.1.2.1 (A:489-589) Neural cell adhesion molecule 6e-09
d2haza1101 b.1.2.1 (A:489-589) Neural cell adhesion molecule 7e-09
d2haza1101 b.1.2.1 (A:489-589) Neural cell adhesion molecule 7e-09
d1wfta_123 b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus 7e-09
d1wfta_123 b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus 5e-08
d1wfta_123 b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus 3e-07
d2dtge1102 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo 7e-09
d2dtge1102 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo 2e-08
d2dtge1102 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo 6e-07
d1erna2105 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor 8e-09
d2cspa1117 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Ho 9e-09
d1gxea_130 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 1e-08
d1gxea_130 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 2e-08
d1gxea_130 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 1e-06
d1tiua_89 b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig re 1e-08
d1tiua_89 b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig re 0.003
d1nbqa2104 b.1.1.4 (A:130-233) Junction adhesion molecule, JA 2e-08
d1nbqa2104 b.1.1.4 (A:130-233) Junction adhesion molecule, JA 8e-05
d2cuha1102 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) 3e-08
d2cuha1102 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) 3e-07
d2cuha1102 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) 1e-06
d1x5ia1113 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [ 4e-08
d1x5ia1113 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [ 3e-07
d1x5ia1113 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [ 2e-06
d2dava1113 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-t 4e-08
d2dava1113 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-t 9e-05
d2dava1113 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-t 0.002
d2dtge3125 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo 5e-08
d2dtge3125 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo 2e-07
d2dtge3125 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo 1e-06
d1pd6a_94 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 8e-08
d2crya1115 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRR 8e-08
d1wj3a_117 b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo s 9e-08
d1wj3a_117 b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo s 2e-05
d1wj3a_117 b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo s 4e-05
d1rhfa191 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor 2e-07
d1rhfa191 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor 3e-05
d1rhfa191 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor 1e-04
d1zxqa1106 b.1.1.3 (A:87-192) Intercellular cell adhesion mol 2e-07
d1owwa_93 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 2e-07
d1owwa_93 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 2e-06
d1owwa_93 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 2e-06
d2ifga192 b.1.1.4 (A:192-283) High affinity nerve growth fac 4e-07
d2ifga192 b.1.1.4 (A:192-283) High affinity nerve growth fac 1e-04
d2ifga192 b.1.1.4 (A:192-283) High affinity nerve growth fac 0.001
d1iray1101 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {H 6e-07
d1iray1101 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {H 1e-06
d1epfa292 b.1.1.4 (A:98-189) Neural cell adhesion molecule ( 2e-06
d1epfa292 b.1.1.4 (A:98-189) Neural cell adhesion molecule ( 8e-05
d1epfa292 b.1.1.4 (A:98-189) Neural cell adhesion molecule ( 0.001
d1gl4b_89 b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus muscu 2e-06
d1gl4b_89 b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus muscu 2e-04
d1biha397 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecr 2e-06
d1biha397 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecr 9e-05
d1v5ja_108 b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId 3e-06
d1v5ja_108 b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId 2e-05
d1v5ja_108 b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId 3e-05
d1f97a2110 b.1.1.4 (A:129-238) Junction adhesion molecule, JA 4e-06
d1f97a2110 b.1.1.4 (A:129-238) Junction adhesion molecule, JA 0.002
d1iray3107 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor 4e-06
d1iray3107 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor 5e-05
d1iama1103 b.1.1.3 (A:83-185) Intercellular cell adhesion mol 5e-06
d2aw2a1104 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator 1e-05
d1f97a1102 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM 2e-05
d1f97a1102 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM 0.003
d1pkoa_126 b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein ( 3e-05
d1hnga198 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus no 5e-05
d2oz4a384 b.1.1.4 (A:367-450) Intercellular adhesion molecul 1e-04
d2oz4a384 b.1.1.4 (A:367-450) Intercellular adhesion molecul 0.003
d1n26a193 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chai 1e-04
d1n26a193 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chai 3e-04
d1ccza193 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-ter 0.001
d1cs6a2105 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gall 0.001
d1iray2103 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor 0.002
d1gsma190 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion m 0.002
d1rhfa285 b.1.1.4 (A:98-182) Tyrosine-protein kinase recepto 0.004
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Fibronectin type III
family: Fibronectin type III
domain: Insulin receptor
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  101 bits (251), Expect = 2e-25
 Identities = 26/201 (12%), Positives = 51/201 (25%), Gaps = 14/201 (6%)

Query: 89  PGPPIGPLDVSEITKHTCTLHWNPPKYDGGLKVTHYVVERRDISMPHWICISTTCHDTTF 148
           P  P+ P      +     L W PP    G  +THY+V     +    +     C     
Sbjct: 3   PSVPLDP-ISVSNSSSQIILKWKPPSDPNG-NITHYLVFWERQAEDSELFELDYCLKGL- 59

Query: 149 IVQGLTEGQEYLFHVMAVNENGMGPPLEGINPIK----AKSPYDKPSPPGIPVVTQVGGD 204
                   + +     + +           +  +     K+              +   D
Sbjct: 60  ----KLPSRTWSPPFESEDSQKHNQSEYEDSAGECCSCPKTDSQILKELEESSFRKTFED 115

Query: 205 FVNLSWDKPLDDGGSRIQGYWIDKHEVGSDAWQRVNVAICAPSQINIPNLIEGRQYEFRV 264
           +++     P      R  G   +      +   R    +     + I  L     Y   +
Sbjct: 116 YLHNVVFVPRPSRKRRSLGDVGNAGN---NEEHRPFEKVVNKESLVISGLRHFTGYRIEL 172

Query: 265 YAQNEAGLSLPSSASNSVQIK 285
            A N+       S +  V  +
Sbjct: 173 QACNQDTPEERCSVAAYVSAR 193


>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 106 Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 106 Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 106 Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 93 Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 93 Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 97 Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 97 Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 94 Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 94 Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 97 Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 97 Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 126 Back     information, alignment and structure
>d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 98 Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 105 Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query591
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1koaa197 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.77
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 99.75
d1tnna_91 Titin {Human (Homo sapiens), different modules [Ta 99.74
d1wiua_93 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.73
d1fhga_102 Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 99.73
d1g1ca_98 Titin {Human (Homo sapiens), different modules [Ta 99.72
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1cs6a489 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.7
d2crza197 Fibronectin type-III domain containing protein 3a, 99.69
d1rhfa191 Tyrosine-protein kinase receptor tyro3, N-terminal 99.68
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.68
d1koaa197 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.66
d1biha489 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.66
d1wiua_93 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.66
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.66
d3dara197 Fibroblast growth factor receptor, FGFR {Human (Ho 99.65
d1qz1a3100 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.65
d1biha397 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.64
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.64
d1epfa292 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.64
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.63
d2nxyb284 CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 99.63
d1fhga_102 Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 99.63
d1g1ca_98 Titin {Human (Homo sapiens), different modules [Ta 99.63
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 99.63
d1cs6a391 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.62
d1he7a_107 High affinity nerve growth factor receptor TrkA, d 99.62
d1x5xa196 Fibronectin type-III domain containing protein 3a, 99.61
d1vcaa290 Vascular cell adhesion molecule-1 (VCAM-1) {Human 99.61
d1gxea_130 Cardiac myosin binding protein C, different domain 99.61
d1cs6a489 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.6
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.6
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 99.6
d2fdbp2109 Fibroblast growth factor receptor, FGFR {Human (Ho 99.59
d2oz4a384 Intercellular adhesion molecule-1, ICAM-1 {Human ( 99.58
d1x4xa193 Fibronectin type-III domain containing protein 3a, 99.58
d1tnna_91 Titin {Human (Homo sapiens), different modules [Ta 99.58
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 99.58
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.58
d1wwca_105 NT3 binding domain of trkC receptor {Human (Homo s 99.57
d1gl4b_89 Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 99.57
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.57
d2dava1113 Myosin-binding protein C, slow-type {Human (Homo s 99.57
d1gsma190 Mucosal addressin cell adhesion molecule-1 (MADCAM 99.57
d1x44a190 Myosin-binding protein C, slow-type {Human (Homo s 99.57
d1rhfa285 Tyrosine-protein kinase receptor tyro3, second dom 99.57
d1epfa197 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.56
d2avga1110 Cardiac myosin binding protein C, different domain 99.56
d1x3da1105 Fibronectin type-III domain containing protein 3a, 99.56
d1wwbx_103 Ligand binding domain of trkB receptor {Human (Hom 99.56
d1pd6a_94 Cardiac myosin binding protein C, different domain 99.56
d3b5ha1101 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 99.56
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 99.56
d1l6za296 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t 99.56
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.55
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.55
d2crma1107 Fibronectin type-III domain containing protein 3a, 99.55
d1biha194 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.55
d1tiua_89 Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI 99.54
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.54
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1wwca_105 NT3 binding domain of trkC receptor {Human (Homo s 99.53
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 99.52
d3dara197 Fibroblast growth factor receptor, FGFR {Human (Ho 99.52
d2fcba288 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.51
d1cs6a197 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.51
d1fnla289 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.51
d2ifga192 High affinity nerve growth factor receptor TrkA, d 99.51
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.51
d1f2qa289 IgE high affinity receptor alpha subunit {Human (H 99.5
d1wwbx_103 Ligand binding domain of trkB receptor {Human (Hom 99.5
d2aw2a1104 B- and T-lymphocyte attenuator CD272 {Human (Homo 99.5
d1biha489 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.49
d1cs6a2105 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.49
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 99.49
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 99.48
d1qz1a3100 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.47
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.47
d2c9aa196 Receptor-type tyrosine-protein phosphatase mu {Hum 99.47
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.47
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.46
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.46
d1cs6a391 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.46
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 99.46
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.46
d1rhfa191 Tyrosine-protein kinase receptor tyro3, N-terminal 99.45
d1iray1101 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.45
d3b5ha1101 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 99.45
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 99.45
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 99.44
d1iray3107 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.44
d1epfa292 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.44
d1olza192 Semaphorin 4d Ig-like domain {Human (Homo sapiens) 99.43
d2nxyb284 CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 99.43
d1gsma190 Mucosal addressin cell adhesion molecule-1 (MADCAM 99.43
d1f97a2110 Junction adhesion molecule, JAM, C-terminal domain 99.43
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 99.42
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 99.42
d1rhfa285 Tyrosine-protein kinase receptor tyro3, second dom 99.42
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 99.42
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.42
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 99.41
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.41
d1n26a193 Interleukin-6 receptor alpha chain, N-terminal dom 99.41
d1vcaa290 Vascular cell adhesion molecule-1 (VCAM-1) {Human 99.41
d1nbqa1105 Junction adhesion molecule, JAM, N-terminal domain 99.41
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 99.41
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.4
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 99.4
d2ifga192 High affinity nerve growth factor receptor TrkA, d 99.4
d1l6za296 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t 99.4
d1gxea_130 Cardiac myosin binding protein C, different domain 99.4
d1biha397 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.39
d1iray2103 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.39
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 99.39
d1gl4b_89 Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 99.39
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 99.39
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 99.39
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 99.39
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 99.38
d1he7a_107 High affinity nerve growth factor receptor TrkA, d 99.38
d1f97a1102 Junction adhesion molecule, JAM, N-terminal domain 99.38
d1nbqa2104 Junction adhesion molecule, JAM, C-terminal domain 99.38
d1va9a1109 Down syndrome cell adhesion molecule-like protein 99.37
d1biha194 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.37
d1cs6a197 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.37
d2avga1110 Cardiac myosin binding protein C, different domain 99.37
d2oz4a384 Intercellular adhesion molecule-1, ICAM-1 {Human ( 99.37
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.36
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.36
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.36
d1x44a190 Myosin-binding protein C, slow-type {Human (Homo s 99.36
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.35
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 99.35
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 99.35
d2dava1113 Myosin-binding protein C, slow-type {Human (Homo s 99.35
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.34
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.34
d2fdbp2109 Fibroblast growth factor receptor, FGFR {Human (Ho 99.34
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.34
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.33
d2crya1115 Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s 99.33
d2fcba185 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.33
d2c9aa196 Receptor-type tyrosine-protein phosphatase mu {Hum 99.33
d1fnla184 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.33
d1epfa197 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.33
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 99.32
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 99.31
d1tiua_89 Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI 99.31
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 99.31
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.3
d1n26a193 Interleukin-6 receptor alpha chain, N-terminal dom 99.3
d1f2qa182 IgE high affinity receptor alpha subunit {Human (H 99.3
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.3
d2aw2a1104 B- and T-lymphocyte attenuator CD272 {Human (Homo 99.29
d1pd6a_94 Cardiac myosin binding protein C, different domain 99.29
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 99.29
d1cs6a2105 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.29
d1f2qa289 IgE high affinity receptor alpha subunit {Human (H 99.29
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 99.28
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 99.28
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.28
d1iama1103 Intercellular cell adhesion molecule-1 (ICAM-1) {H 99.28
d1iray3107 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.28
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 99.28
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 99.27
d2fcba288 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.25
d1ccza193 CD2-binding domain of CD58, N-terminal domain {Hum 99.25
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 99.25
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 99.25
d2crma1107 Fibronectin type-III domain containing protein 3a, 99.24
d1f97a2110 Junction adhesion molecule, JAM, C-terminal domain 99.23
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.23
d1nbqa2104 Junction adhesion molecule, JAM, C-terminal domain 99.22
d1fnla289 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.22
d2crza197 Fibronectin type-III domain containing protein 3a, 99.22
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 99.22
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 99.22
d1biha2111 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.22
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 99.19
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.19
d1zxqa1106 Intercellular cell adhesion molecule-2 (ICAM-2) {H 99.18
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.18
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 99.18
d1olza192 Semaphorin 4d Ig-like domain {Human (Homo sapiens) 99.18
d2crya1115 Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s 99.18
d1f97a1102 Junction adhesion molecule, JAM, N-terminal domain 99.18
d2fcba185 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.17
d1iama1103 Intercellular cell adhesion molecule-1 (ICAM-1) {H 99.16
d1nbqa1105 Junction adhesion molecule, JAM, N-terminal domain 99.16
d1iray2103 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.15
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 99.14
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.13
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 99.13
d1iray1101 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.12
d1x5xa196 Fibronectin type-III domain containing protein 3a, 99.11
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 99.1
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.1
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 99.1
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.1
d1fnla184 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.1
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.09
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.09
d1pkoa_126 Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra 99.09
d1biha2111 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.08
d1f2qa182 IgE high affinity receptor alpha subunit {Human (H 99.06
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.06
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 99.06
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.03
d1zxqa1106 Intercellular cell adhesion molecule-2 (ICAM-2) {H 99.02
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 99.02
d1x3da1105 Fibronectin type-III domain containing protein 3a, 99.02
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 99.0
d1x4xa193 Fibronectin type-III domain containing protein 3a, 98.97
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 98.97
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 98.97
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 98.96
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 98.96
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 98.95
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 98.94
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 98.93
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.93
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 98.93
d1hnga198 CD2, first domain {Rat (Rattus norvegicus) [TaxId: 98.91
d1i8ka_106 Immunoglobulin light chain kappa variable domain, 98.91
d1c5cl1107 Immunoglobulin light chain kappa variable domain, 98.9
d1ospl1107 Immunoglobulin light chain kappa variable domain, 98.88
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 98.88
d1tjgl1107 Immunoglobulin light chain kappa variable domain, 98.87
d1a0ql1106 Immunoglobulin light chain kappa variable domain, 98.87
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.87
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 98.86
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 98.86
d1kcvl1107 Immunoglobulin light chain kappa variable domain, 98.86
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 98.86
d1j1pl_107 Immunoglobulin light chain kappa variable domain, 98.85
d1op3k1106 Immunoglobulin light chain kappa variable domain, 98.84
d1ccza193 CD2-binding domain of CD58, N-terminal domain {Hum 98.84
d3bp5a1114 Programmed cell death protein 1, PD1, extracellula 98.84
d1xeda_116 Polymeric-immunoglobulin receptor, PIGR {Human (Ho 98.83
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 98.82
d1l6za1107 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t 98.82
d1jhll_108 Immunoglobulin light chain kappa variable domain, 98.81
d1lk3l1106 Immunoglobulin light chain kappa variable domain, 98.8
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 98.79
d1mexl1107 Immunoglobulin light chain kappa variable domain, 98.79
d1d5il1107 Immunoglobulin light chain kappa variable domain, 98.79
d8faba1103 Immunoglobulin light chain lambda variable domain, 98.79
d1bwwa_109 Immunoglobulin light chain kappa variable domain, 98.78
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 98.78
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 98.77
d1eaja_124 Coxsackie virus and adenovirus receptor (Car), dom 98.77
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 98.77
d1pkoa_126 Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra 98.76
d2rhea_114 Immunoglobulin light chain lambda variable domain, 98.75
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.74
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 98.74
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 98.74
d2bnqd1113 T-cell antigen receptor {Human (Homo sapiens), alp 98.74
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 98.73
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 98.73
d2gsia1111 Immunoglobulin light chain kappa variable domain, 98.72
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 98.7
d1lgva1112 Immunoglobulin light chain lambda variable domain, 98.7
d2cdea1114 T-cell antigen receptor {Human (Homo sapiens), bet 98.7
d2fx7l1108 Immunoglobulin light chain kappa variable domain, 98.7
d3cx5k1107 Immunoglobulin light chain kappa variable domain, 98.69
d2esvd1110 T-cell antigen receptor {Human (Homo sapiens), alp 98.69
d1oaql_110 Immunoglobulin light chain lambda variable domain, 98.69
d1mqkl_109 Immunoglobulin light chain kappa variable domain, 98.69
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 98.68
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 98.68
d1sq2n_112 Novel antigen receptor (against lysozyme) {Nurse s 98.68
d1ogad1115 T-cell antigen receptor {Human (Homo sapiens), alp 98.68
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 98.68
d1olla195 Ligand binding domain of NK receptor NKp46 {Human 98.67
d1bd2d1111 T-cell antigen receptor {Human (Homo sapiens), alp 98.67
d1akjd_114 CD8 {Human (Homo sapiens) [TaxId: 9606]} 98.67
d1neua_119 Myelin membrane adhesion molecule P0 {Rat (Rattus 98.66
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 98.66
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 98.66
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 98.66
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 98.66
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 98.65
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 98.65
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 98.65
d1rzfl1111 Immunoglobulin light chain lambda variable domain, 98.65
d1lp9e1115 T-cell antigen receptor {Mouse (Mus musculus), alp 98.65
d1w72l1109 Immunoglobulin light chain lambda variable domain, 98.65
d1ucta199 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 98.64
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.64
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 98.63
d1j05a_111 Immunoglobulin light chain kappa variable domain, 98.63
d1hkfa_108 NK cell activating receptor NKP44 {Human (Homo sap 98.63
d2nxyb197 CD4 V-set domains {Human (Homo sapiens) [TaxId: 96 98.63
d1vesa_113 Novel antigen receptor 12Y-2 {Spotted wobbegong (O 98.62
d1yqvl1104 Immunoglobulin light chain kappa variable domain, 98.62
d1u3ha1110 T-cell antigen receptor {Mouse (Mus musculus), alp 98.61
d1mjul1112 Immunoglobulin light chain kappa variable domain, 98.61
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.61
d1ncwl1112 Immunoglobulin light chain kappa variable domain, 98.61
d1n4xl_113 Immunoglobulin light chain kappa variable domain, 98.61
d1nfde1108 Immunoglobulin light chain lambda variable domain, 98.6
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 98.59
d1nezg_122 CD8 {Mouse (Mus musculus) [TaxId: 10090]} 98.59
d1f3rb2119 Immunoglobulin light chain kappa variable domain, 98.58
d1i9ea_115 T-cell antigen receptor {Mouse (Mus musculus), alp 98.58
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 98.57
d1q9ra1113 Immunoglobulin light chain kappa variable domain, 98.57
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 98.57
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.57
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.56
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 98.56
d2ak4d1114 T-cell antigen receptor {Human (Homo sapiens), alp 98.56
d2g5ra1121 N-terminal domain of sialic acid binding Ig-like l 98.56
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 98.56
d1cd0a_111 Immunoglobulin light chain lambda variable domain, 98.55
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.55
d2atpb1115 CD8 {Mouse (Mus musculus), beta-chain [TaxId: 1009 98.55
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 98.54
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 98.54
d1j8hd1115 T-cell antigen receptor {Human (Homo sapiens), alp 98.53
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 98.52
d1tvda_116 T-cell antigen receptor {Human (Homo sapiens), del 98.51
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 98.51
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 98.5
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 98.49
d2aq2a1110 T-cell antigen receptor {Mouse (Mus musculus), bet 98.49
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 98.48
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.48
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 98.48
d1qfoa_118 N-terminal domain of sialoadhesin {Mouse (Mus musc 98.47
d1kgcd1112 T-cell antigen receptor {Human (Homo sapiens), alp 98.47
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 98.47
d1fo0a_115 T-cell antigen receptor {Mouse (Mus musculus), alp 98.46
d2gj6d194 T-cell antigen receptor {Mouse (Mus musculus), bet 98.45
d1va9a1109 Down syndrome cell adhesion molecule-like protein 98.45
d1h5ba_113 T-cell antigen receptor {Mouse (Mus musculus), alp 98.45
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 98.44
d1ncna_110 CD86 (b7-2), N-terminal domain {Human (Homo sapien 98.43
d1dr9a1105 CD80, N-terminal domain {Human (Homo sapiens) [Tax 98.43
d1smoa_113 TREM-1 (triggering receptor expressed on myeloid c 98.43
d1vcaa1109 Vascular cell adhesion molecule-1 (VCAM-1) {Human 98.42
d2ij0c1118 T-cell antigen receptor {Human (Homo sapiens), bet 98.41
d1hnga198 CD2, first domain {Rat (Rattus norvegicus) [TaxId: 98.41
d1a0ql1106 Immunoglobulin light chain kappa variable domain, 98.4
d1ac6a_110 T-cell antigen receptor {Mouse (Mus musculus), alp 98.4
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.39
d1kgce1112 T-cell antigen receptor {Human (Homo sapiens), bet 98.38
d2ntsp1113 T-cell antigen receptor {Human (Homo sapiens), bet 98.38
d2esve1111 T-cell antigen receptor {Human (Homo sapiens), bet 98.38
d1dqta_117 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 98.37
d1l6za1107 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t 98.36
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 98.35
d1eaja_124 Coxsackie virus and adenovirus receptor (Car), dom 98.34
d1u9ka_110 TREM-1 (triggering receptor expressed on myeloid c 98.33
d1hxma1120 T-cell antigen receptor {Human (Homo sapiens), gam 98.33
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 98.32
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 98.32
d1ucta296 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 98.31
d1i8ka_106 Immunoglobulin light chain kappa variable domain, 98.31
d1c5cl1107 Immunoglobulin light chain kappa variable domain, 98.31
d1j1pl_107 Immunoglobulin light chain kappa variable domain, 98.3
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 98.3
d1ogae1114 T-cell antigen receptor {Human (Homo sapiens), bet 98.28
d1tjgl1107 Immunoglobulin light chain kappa variable domain, 98.28
d1ospl1107 Immunoglobulin light chain kappa variable domain, 98.27
d1kcvl1107 Immunoglobulin light chain kappa variable domain, 98.26
d1ypzf1120 T-cell antigen receptor {Human (Homo sapiens), gam 98.26
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.26
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 98.26
d1olla293 Ligand binding domain of NK receptor NKp46 {Human 98.25
d1op3k1106 Immunoglobulin light chain kappa variable domain, 98.25
d1ymmd196 T-cell antigen receptor {Human (Homo sapiens), alp 98.25
d1j8he1113 T-cell antigen receptor {Human (Homo sapiens), bet 98.24
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 98.24
d2bnub1112 T-cell antigen receptor {Human (Homo sapiens), bet 98.24
d1nfdb1113 T-cell antigen receptor {Mouse (Mus musculus), bet 98.23
d1jhll_108 Immunoglobulin light chain kappa variable domain, 98.23
d1mexl1107 Immunoglobulin light chain kappa variable domain, 98.23
d1i8lc_118 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 98.22
d1nezg_122 CD8 {Mouse (Mus musculus) [TaxId: 10090]} 98.22
d1bwwa_109 Immunoglobulin light chain kappa variable domain, 98.22
d1hxmb1123 T-cell antigen receptor {Human (Homo sapiens), del 98.21
d2cdeb1112 T-cell antigen receptor {Human (Homo sapiens), bet 98.2
d1nkra299 Killer cell inhibitory receptor {Human (Homo sapie 98.2
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 98.19
d1d5il1107 Immunoglobulin light chain kappa variable domain, 98.18
d1lk3l1106 Immunoglobulin light chain kappa variable domain, 98.17
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 98.16
d3bp5a1114 Programmed cell death protein 1, PD1, extracellula 98.14
d8faba1103 Immunoglobulin light chain lambda variable domain, 98.14
d1akjd_114 CD8 {Human (Homo sapiens) [TaxId: 9606]} 98.13
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.11
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 98.1
d2rhea_114 Immunoglobulin light chain lambda variable domain, 98.1
d1mqkl_109 Immunoglobulin light chain kappa variable domain, 98.09
d1ucta199 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 98.09
d2fx7l1108 Immunoglobulin light chain kappa variable domain, 98.09
d1xaua_104 B and T lymphocyte attenuator, Btla {Mouse (Mus mu 98.08
d1olla195 Ligand binding domain of NK receptor NKp46 {Human 98.07
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 98.07
d2bnqd1113 T-cell antigen receptor {Human (Homo sapiens), alp 98.06
d3cx5k1107 Immunoglobulin light chain kappa variable domain, 98.05
d1dr9a295 CD80, second domain {Human (Homo sapiens) [TaxId: 98.04
d2cdea1114 T-cell antigen receptor {Human (Homo sapiens), bet 98.03
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 98.02
d2gsia1111 Immunoglobulin light chain kappa variable domain, 98.02
d1xeda_116 Polymeric-immunoglobulin receptor, PIGR {Human (Ho 98.02
d1f3rb2119 Immunoglobulin light chain kappa variable domain, 98.01
d1mqkh_123 Immunoglobulin heavy chain variable domain, VH {Mo 98.0
d1sq2n_112 Novel antigen receptor (against lysozyme) {Nurse s 98.0
d1kxvc_119 Camelid IG heavy chain variable domain, VHh {Camel 98.0
d1yqvl1104 Immunoglobulin light chain kappa variable domain, 97.99
d1vesa_113 Novel antigen receptor 12Y-2 {Spotted wobbegong (O 97.99
d2agjh1120 Immunoglobulin heavy chain variable domain, VH {En 97.98
d1w72l1109 Immunoglobulin light chain lambda variable domain, 97.97
d1vcaa1109 Vascular cell adhesion molecule-1 (VCAM-1) {Human 97.97
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 97.97
d1dn0b1120 Immunoglobulin heavy chain variable domain, VH {Hu 97.97
d1lp9e1115 T-cell antigen receptor {Mouse (Mus musculus), alp 97.97
d1q9ra1113 Immunoglobulin light chain kappa variable domain, 97.97
d7fabh1116 Immunoglobulin heavy chain variable domain, VH {Hu 97.96
d1bd2d1111 T-cell antigen receptor {Human (Homo sapiens), alp 97.96
d1ugna298 Ligand binding domain of lir-1 (ilt2) {Human (Homo 97.95
d1iqdb1117 Immunoglobulin heavy chain variable domain, VH {Hu 97.95
d1pg7x1120 Immunoglobulin heavy chain variable domain, VH {Mo 97.95
d3b5ha280 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 97.95
d1nkra196 Killer cell inhibitory receptor {Human (Homo sapie 97.94
d1i9ea_115 T-cell antigen receptor {Mouse (Mus musculus), alp 97.94
d1oaql_110 Immunoglobulin light chain lambda variable domain, 97.94
d1rzfl1111 Immunoglobulin light chain lambda variable domain, 97.94
d1c5db1117 Immunoglobulin heavy chain variable domain, VH {Ra 97.94
d2nxyb197 CD4 V-set domains {Human (Homo sapiens) [TaxId: 96 97.93
d1neua_119 Myelin membrane adhesion molecule P0 {Rat (Rattus 97.93
d1j05a_111 Immunoglobulin light chain kappa variable domain, 97.93
d1lgva1112 Immunoglobulin light chain lambda variable domain, 97.93
d1nfde1108 Immunoglobulin light chain lambda variable domain, 97.92
d1mfah1117 Immunoglobulin heavy chain variable domain, VH {Mo 97.92
d1f3dh1115 Immunoglobulin heavy chain variable domain, VH {Mo 97.92
d2jelh1118 Immunoglobulin heavy chain variable domain, VH {Mo 97.92
d1ai1h1120 Immunoglobulin heavy chain variable domain, VH {Mo 97.92
d1ncwl1112 Immunoglobulin light chain kappa variable domain, 97.91
d2atpb1115 CD8 {Mouse (Mus musculus), beta-chain [TaxId: 1009 97.91
d1vgeh1122 Immunoglobulin heavy chain variable domain, VH {Hu 97.9
d1fo0b_112 T-cell antigen receptor {Mouse (Mus musculus), bet 97.9
d1qnzh_119 Immunoglobulin heavy chain variable domain, VH {Mo 97.9
d1ogad1115 T-cell antigen receptor {Human (Homo sapiens), alp 97.89
d1etzb1126 Immunoglobulin heavy chain variable domain, VH {Mo 97.89
d1um5h1117 Immunoglobulin heavy chain variable domain, VH {Mo 97.89
d1n4xl_113 Immunoglobulin light chain kappa variable domain, 97.89
d2ck0h1109 Immunoglobulin heavy chain variable domain, VH {Mo 97.88
d1tjgh1132 Immunoglobulin heavy chain variable domain, VH {En 97.88
d1ugna196 Ligand binding domain of lir-1 (ilt2) {Human (Homo 97.87
d1k5nb_100 beta2-microglobulin {Human (Homo sapiens) [TaxId: 97.87
d1ncwh1119 Immunoglobulin heavy chain variable domain, VH {Mo 97.87
d1ucta296 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 97.86
d1mjul1112 Immunoglobulin light chain kappa variable domain, 97.86
d1jpth1117 Immunoglobulin heavy chain variable domain, VH {En 97.86
d1a2yb_116 Immunoglobulin heavy chain variable domain, VH {Mo 97.86
d2ij0c1118 T-cell antigen receptor {Human (Homo sapiens), bet 97.86
d1mjuh1116 Immunoglobulin heavy chain variable domain, VH {Mo 97.86
d1yjdc1118 CD28 {Human (Homo sapiens) [TaxId: 9606]} 97.85
d1indh1114 Immunoglobulin heavy chain variable domain, VH {Mo 97.84
d2aq2a1110 T-cell antigen receptor {Mouse (Mus musculus), bet 97.84
d1tvda_116 T-cell antigen receptor {Human (Homo sapiens), del 97.84
d1zvya1124 Camelid IG heavy chain variable domain, VHh {Camel 97.83
d1nlbh1118 Immunoglobulin heavy chain variable domain, VH {Mo 97.83
d1lk2b_99 beta2-microglobulin {Mouse (Mus musculus) [TaxId: 97.83
d1hkfa_108 NK cell activating receptor NKP44 {Human (Homo sap 97.83
d1r0ah1123 Immunoglobulin heavy chain variable domain, VH {Mo 97.83
d1sjva_107 Camelid IG heavy chain variable domain, VHh {Llama 97.82
d1dlfh_120 Immunoglobulin heavy chain variable domain, VH {Mo 97.82
d1ieha_135 Camelid IG heavy chain variable domain, VHh {Llama 97.82
d1jnhb1117 Immunoglobulin heavy chain variable domain, VH {Mo 97.81
d2ak4d1114 T-cell antigen receptor {Human (Homo sapiens), alp 97.81
d1oari_103 Immunoglobulin heavy chain variable domain, VH {Ra 97.81
d2p49b1121 Camelid IG heavy chain variable domain, VHh {Camel 97.8
d2fbjh1118 Immunoglobulin heavy chain variable domain, VH {Mo 97.79
d1ct8b1118 Immunoglobulin heavy chain variable domain, VH {Mo 97.78
d1j05b_121 Immunoglobulin heavy chain variable domain, VH {Mo 97.78
d1dfbh1126 Immunoglobulin heavy chain variable domain, VH {Hu 97.77
d1cd0a_111 Immunoglobulin light chain lambda variable domain, 97.76
d1lmka1126 Immunoglobulin heavy chain variable domain, VH {Mo 97.75
d1bz7b1122 Immunoglobulin heavy chain variable domain, VH {Mo 97.75
d2nxyd1128 Immunoglobulin heavy chain variable domain, VH {Hu 97.75
d2esvd1110 T-cell antigen receptor {Human (Homo sapiens), alp 97.74
d1fo0a_115 T-cell antigen receptor {Mouse (Mus musculus), alp 97.74
d1yedb1124 Immunoglobulin heavy chain variable domain, VH {Mo 97.73
d1rihh1125 Immunoglobulin heavy chain variable domain, VH {Mo 97.73
d1muja1100 Class II MHC alpha chain, C-terminal domain {Mouse 97.73
d2gj6d194 T-cell antigen receptor {Mouse (Mus musculus), bet 97.72
d1eapb1119 Immunoglobulin heavy chain variable domain, VH {Mo 97.72
d1n0xh1127 Immunoglobulin heavy chain variable domain, VH {Hu 97.72
d3cx5j1127 Immunoglobulin heavy chain variable domain, VH {Mo 97.71
d1ol0a_121 Immunoglobulin heavy chain variable domain, VH {En 97.71
d2b1hh1124 Immunoglobulin heavy chain variable domain, VH {En 97.71
d1op3h1125 Immunoglobulin heavy chain variable domain, VH {En 97.71
d1ac6a_110 T-cell antigen receptor {Mouse (Mus musculus), alp 97.71
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Immunoglobulin
family: I set domains
domain: Telokin
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.81  E-value=1.7e-19  Score=130.17  Aligned_cols=94  Identities=22%  Similarity=0.380  Sum_probs=88.7

Q ss_pred             CCceeeeecCCeEEEEEEeccCCCceEEEEECCEEeecCCceeEEEeCCeEEEEEcccCCCCceEEEEEEEcCCeeeEEE
Q psy12425          1 MPNALYIPEGDNTKVKIFYAGDQPMEVSLTKNGRVVQSDDRFKFTVLDDYIIIFIKEIRKEDAGDYTVNLSNSSGSVSGT   80 (591)
Q Consensus         1 ~p~~~~v~~G~~~~l~C~~~~~p~~~v~W~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~g~Y~c~~~n~~g~~~~~   80 (591)
                      .|+++.+.+|+++.|.|.+.|.|.+.+.|+|||+.|....++++...++.++|.|.+++.+|+|.|+|.|.|..|..+.+
T Consensus         6 ~p~~~~v~~G~~~~l~C~v~g~p~p~v~W~k~~~~l~~~~~~~~~~~~~~~~L~I~~~~~~D~G~Y~C~a~N~~G~~~~~   85 (101)
T d2cqva1           6 FPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQ   85 (101)
T ss_dssp             CCCSEEEETTCCEEEEEEEESSSSCEEEEEESSSBCCCSSSEEEEECSSEEEEEETTCCTTTCEEEEEEEECSSCEEECC
T ss_pred             eCCcEEEeCCCcEEEEEEEEecCCCEEEEEeCceeeccCCcEEEEEecceeEEEEeeCCcccCEEEEEEEEECCCEEEEE
Confidence            47889999999999999999999999999999999999999999988888999999999999999999999999999999


Q ss_pred             EEEEEecCCCCCCC
Q psy12425         81 FTINITGLPGPPIG   94 (591)
Q Consensus        81 ~~l~v~~~p~~p~~   94 (591)
                      +.|.|.+.|.+|..
T Consensus        86 ~~l~V~~~P~pP~g   99 (101)
T d2cqva1          86 VNLTVVDKPDPPAG   99 (101)
T ss_dssp             EEEEEECSCSCCCC
T ss_pred             EEEEEEecCCCcCC
Confidence            99999999988753



>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Back     information, alignment and structure
>d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i8ka_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1c5cl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1ospl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tjgl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kcvl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j1pl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1op3k1 b.1.1.1 (K:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bp5a1 b.1.1.1 (A:1-114) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jhll_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1lk3l1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mexl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1d5il1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d8faba1 b.1.1.1 (A:3-105) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1bwwa_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2rhea_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnqd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gsia1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lgva1 b.1.1.1 (A:1-112) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]} Back     information, alignment and structure
>d2cdea1 b.1.1.1 (A:2-115) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2fx7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]} Back     information, alignment and structure
>d3cx5k1 b.1.1.1 (K:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2esvd1 b.1.1.1 (D:4-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1oaql_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mqkl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq2n_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} Back     information, alignment and structure
>d1ogad1 b.1.1.1 (D:3-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd2d1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1akjd_ b.1.1.1 (D:) CD8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzfl1 b.1.1.1 (L:2-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d1lp9e1 b.1.1.1 (E:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1w72l1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j05a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vesa_ b.1.1.1 (A:) Novel antigen receptor 12Y-2 {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]} Back     information, alignment and structure
>d1yqvl1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1u3ha1 b.1.1.1 (A:2-116) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1mjul1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncwl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1n4xl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1nfde1 b.1.1.1 (E:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i9ea_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q9ra1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak4d1 b.1.1.1 (D:1-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d2g5ra1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd0a_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2atpb1 b.1.1.1 (B:1-115) CD8 {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8hd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tvda_ b.1.1.1 (A:) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2aq2a1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qfoa_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kgcd1 b.1.1.1 (D:2-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fo0a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d2gj6d1 b.1.1.1 (D:15-114) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h5ba_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncna_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1smoa_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa1 b.1.1.3 (A:91-199) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ij0c1 b.1.1.1 (C:1-117) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1ac6a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kgce1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2ntsp1 b.1.1.1 (P:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2esve1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1dqta_ b.1.1.1 (A:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u9ka_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxma1 b.1.1.1 (A:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ucta2 b.1.1.4 (A:101-196) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i8ka_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1c5cl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1j1pl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogae1 b.1.1.1 (E:5-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1tjgl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1ospl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1kcvl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1ypzf1 b.1.1.1 (F:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olla2 b.1.1.4 (A:96-188) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1op3k1 b.1.1.1 (K:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1ymmd1 b.1.1.1 (D:9-104) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1j8he1 b.1.1.1 (E:2-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnub1 b.1.1.1 (B:2-113) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1nfdb1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1jhll_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1mexl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1i8lc_ b.1.1.1 (C:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bwwa_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1hxmb1 b.1.1.1 (B:1-123) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2cdeb1 b.1.1.1 (B:5-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1nkra2 b.1.1.4 (A:102-200) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d5il1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1lk3l1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bp5a1 b.1.1.1 (A:1-114) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d8faba1 b.1.1.1 (A:3-105) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1akjd_ b.1.1.1 (D:) CD8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rhea_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d1mqkl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fx7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]} Back     information, alignment and structure
>d1xaua_ b.1.1.4 (A:) B and T lymphocyte attenuator, Btla {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bnqd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d3cx5k1 b.1.1.1 (K:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1dr9a2 b.1.1.3 (A:106-200) CD80, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cdea1 b.1.1.1 (A:2-115) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gsia1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mqkh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1sq2n_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} Back     information, alignment and structure
>d1kxvc_ b.1.1.1 (C:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1yqvl1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1vesa_ b.1.1.1 (A:) Novel antigen receptor 12Y-2 {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]} Back     information, alignment and structure
>d2agjh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1w72l1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa1 b.1.1.3 (A:91-199) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dn0b1 b.1.1.1 (B:1-120) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} Back     information, alignment and structure
>d1lp9e1 b.1.1.1 (E:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1q9ra1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]} Back     information, alignment and structure
>d7fabh1 b.1.1.1 (H:1-116) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} Back     information, alignment and structure
>d1bd2d1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ugna2 b.1.1.4 (A:98-195) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iqdb1 b.1.1.1 (B:1-114) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1pg7x1 b.1.1.1 (X:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d3b5ha2 b.1.1.4 (A:23-102) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkra1 b.1.1.4 (A:6-101) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d1i9ea_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1oaql_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rzfl1 b.1.1.1 (L:2-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d1c5db1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1j05a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1lgva1 b.1.1.1 (A:1-112) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]} Back     information, alignment and structure
>d1nfde1 b.1.1.1 (E:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1mfah1 b.1.1.1 (H:251-367) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1f3dh1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d2jelh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1ai1h1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.3 [TaxId: 10090]} Back     information, alignment and structure
>d1ncwl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d2atpb1 b.1.1.1 (B:1-115) CD8 {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1vgeh1 b.1.1.1 (H:1-122) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1fo0b_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1qnzh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1ogad1 b.1.1.1 (D:3-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1etzb1 b.1.1.1 (B:1-126) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} Back     information, alignment and structure
>d1um5h1 b.1.1.1 (H:3-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1n4xl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d2ck0h1 b.1.1.1 (H:1-106) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d1tjgh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1ugna1 b.1.1.4 (A:2-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k5nb_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncwh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]} Back     information, alignment and structure
>d1ucta2 b.1.1.4 (A:101-196) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mjul1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1jpth1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1a2yb_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]} Back     information, alignment and structure
>d2ij0c1 b.1.1.1 (C:1-117) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1mjuh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1yjdc1 b.1.1.1 (C:1-118) CD28 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1indh1 b.1.1.1 (H:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d2aq2a1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1tvda_ b.1.1.1 (A:) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1zvya1 b.1.1.1 (A:2-125) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1nlbh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1lk2b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0ah1 b.1.1.1 (H:1-123) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} Back     information, alignment and structure
>d1sjva_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d1dlfh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d1ieha_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d1jnhb1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d2ak4d1 b.1.1.1 (D:1-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1oari_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2p49b1 b.1.1.1 (B:1-121) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d2fbjh1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1ct8b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.3 [TaxId: 10090]} Back     information, alignment and structure
>d1j05b_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1dfbh1 b.1.1.1 (H:1-126) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]} Back     information, alignment and structure
>d1cd0a_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1lmka1 b.1.1.1 (A:2-127) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1bz7b1 b.1.1.1 (B:1-122) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d2nxyd1 b.1.1.1 (D:3001-3128) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d2esvd1 b.1.1.1 (D:4-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1fo0a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1yedb1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1rihh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1muja1 b.1.1.2 (A:84-183) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} Back     information, alignment and structure
>d2gj6d1 b.1.1.1 (D:15-114) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1eapb1 b.1.1.1 (B:1-124) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1n0xh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d3cx5j1 b.1.1.1 (J:1-127) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]} Back     information, alignment and structure
>d1ol0a_ b.1.1.1 (A:) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d2b1hh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1op3h1 b.1.1.1 (H:1-115) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1ac6a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure