Psyllid ID: psy12430

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140------
MNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNAEKQPYYEEQSRLSKLHMEKHPDYRYRPRPKRTCIVDGKKMRISEYKTLMRQRRNEMRQLWCRGEAGPSGSGGPAFPFPGDGSLSPSDMMPFSPGSPGSMDSHDED
cccHHHccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHcccHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccc
cccEEEEcHHHHHHHHHHccccccHHHHHHHHHHHHHHcHHHcccHHHHHHHHHHHHHHHcccccccccccccEcccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccc
MNAFMVWAKDERRKILKAcpdmhnsnISKILGARWKAMSNAEKQPYYEEQSRLSKlhmekhpdyryrprpkrtcivdgkkmrISEYKTLMRQRRNEMRQLwcrgeagpsgsggpafpfpgdgslspsdmmpfspgspgsmdshded
mnafmvwaKDERRKILkacpdmhnsnISKILGARWKAMSNAEKQPYYEEQSRLSKLHmekhpdyryrprpkrtcivdgkkmriseykTLMRQRRNEMRQLWCRGEAGPSGSGGPAFPFPGDGSLSPSDMMPFSpgspgsmdshded
MNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNAEKQPYYEEQSRLSKLHMEKHPDYRYRPRPKRTCIVDGKKMRISEYKTLMRQRRNEMRQLWCRGEagpsgsggpafpfpgDGSLSPSDMMPFSPGSPGSMDSHDED
***FMVWAKDERRKILKACPDMHNSNISKILGARWK************************************TCIVDGKKMRISEYK************LWC********************************************
MNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNAEKQPYYEEQSRLSKLHMEKHPDYRY********************************************************************************
MNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNAEKQPYYEEQSRLSKLHMEKHPDYRYRPRPKRTCIVDGKKMRISEYKTLMRQRRNEMRQLWCRGEAGPSGSGGPAFPFPGDGSLSPSDMMPFSP************
*NAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNAEKQPYYEEQSRLSKLHMEKHPDYRYRPRPKRTCIVDGKKMRISEYKTLMRQRRNEMRQLWCRG******************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNAEKQPYYEEQSRLSKLHMEKHPDYRYRPRPKRTCIVDGKKMRISEYKTLMRQRRNEMRQLWCRGEAGPSGSGGPAFPFPGDGSLSPSDMMPFSPGSPGSMDSHDED
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query146 2.2.26 [Sep-21-2011]
B1H349777 Transcription factor Sox- yes N/A 0.719 0.135 0.8 3e-48
P35710763 Transcription factor SOX- yes N/A 0.801 0.153 0.714 5e-48
P35711763 Transcription factor SOX- yes N/A 0.801 0.153 0.714 5e-48
Q5RCU4787 Transcription factor SOX- no N/A 0.719 0.133 0.790 8e-48
P35712828 Transcription factor SOX- no N/A 0.719 0.126 0.790 8e-48
P40645827 Transcription factor SOX- no N/A 0.719 0.126 0.790 9e-48
B3DM43753 Transcription factor Sox- no N/A 0.671 0.130 0.785 7e-44
P40647757 Transcription factor Sox- N/A N/A 0.643 0.124 0.808 2e-43
Q28EW4566 Transcription factor Sox- no N/A 0.767 0.197 0.683 2e-43
P40649567 Transcription factor Sox- N/A N/A 0.869 0.223 0.640 2e-43
>sp|B1H349|SOX6_XENTR Transcription factor Sox-6 OS=Xenopus tropicalis GN=sox6 PE=2 SV=1 Back     alignment and function desciption
 Score =  189 bits (481), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 96/105 (91%)

Query: 1   MNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNAEKQPYYEEQSRLSKLHMEK 60
           MNAFMVWAKDERRKIL+A PDMHNSNISKILG+RWKAMSN EKQPYYEEQ+RLSK+H+EK
Sbjct: 574 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKAMSNQEKQPYYEEQARLSKIHLEK 633

Query: 61  HPDYRYRPRPKRTCIVDGKKMRISEYKTLMRQRRNEMRQLWCRGE 105
           +P+Y+Y+PRPKRTCIVDGKK+RI EYK LMR RR EMRQ +  G+
Sbjct: 634 YPNYKYKPRPKRTCIVDGKKLRIGEYKQLMRSRRQEMRQFFTVGQ 678
Transcriptional activator. Binds specifically to the DNA sequence 5'-AACAAT-3'. Plays a key role in several developmental processes, including neurogenesis and skeleton formation.
Xenopus tropicalis (taxid: 8364)
>sp|P35710|SOX5_MOUSE Transcription factor SOX-5 OS=Mus musculus GN=Sox5 PE=1 SV=2 Back     alignment and function description
>sp|P35711|SOX5_HUMAN Transcription factor SOX-5 OS=Homo sapiens GN=SOX5 PE=1 SV=3 Back     alignment and function description
>sp|Q5RCU4|SOX6_PONAB Transcription factor SOX-6 OS=Pongo abelii GN=SOX6 PE=2 SV=1 Back     alignment and function description
>sp|P35712|SOX6_HUMAN Transcription factor SOX-6 OS=Homo sapiens GN=SOX6 PE=1 SV=3 Back     alignment and function description
>sp|P40645|SOX6_MOUSE Transcription factor SOX-6 OS=Mus musculus GN=Sox6 PE=1 SV=2 Back     alignment and function description
>sp|B3DM43|SOX5_XENTR Transcription factor Sox-5 OS=Xenopus tropicalis GN=sox5 PE=2 SV=1 Back     alignment and function description
>sp|P40647|SOX5_XENLA Transcription factor Sox-5 OS=Xenopus laevis GN=sox5 PE=2 SV=2 Back     alignment and function description
>sp|Q28EW4|SOX13_XENTR Transcription factor Sox-13 OS=Xenopus tropicalis GN=sox13 PE=2 SV=1 Back     alignment and function description
>sp|P40649|SOX13_XENLA Transcription factor Sox-13 OS=Xenopus laevis GN=sox13 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query146
328698811 965 PREDICTED: hypothetical protein LOC10016 1.0 0.151 0.787 4e-63
350417222 848 PREDICTED: hypothetical protein LOC10074 1.0 0.172 0.656 2e-59
340715248 844 PREDICTED: hypothetical protein LOC10065 1.0 0.172 0.656 2e-59
307174178 523 Transcription factor SOX-5 [Camponotus f 0.993 0.277 0.651 3e-59
380019991 522 PREDICTED: uncharacterized protein LOC10 0.986 0.275 0.653 4e-59
328785651 522 PREDICTED: hypothetical protein LOC40888 0.986 0.275 0.653 4e-59
322794627 513 hypothetical protein SINV_12661 [Solenop 0.972 0.276 0.647 4e-58
345496351 655 PREDICTED: hypothetical protein LOC10011 0.952 0.212 0.663 6e-58
332025343 524 Transcription factor SOX-6 [Acromyrmex e 0.993 0.276 0.636 2e-57
263359663 690 hypothetical protein DVIR88_6g0036 [Dros 0.842 0.178 0.853 2e-56
>gi|328698811|ref|XP_001951971.2| PREDICTED: hypothetical protein LOC100168120 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  245 bits (626), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 130/165 (78%), Positives = 135/165 (81%), Gaps = 19/165 (11%)

Query: 1   MNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNAEKQPYYEEQSRLSKLHMEK 60
           MNAFMVWAKDERRKILKACPDMHNSNISKILG RWKAMSNA+KQPYYEEQSRLSKLHMEK
Sbjct: 801 MNAFMVWAKDERRKILKACPDMHNSNISKILGGRWKAMSNADKQPYYEEQSRLSKLHMEK 860

Query: 61  HPDYRYRPRPKRTCIVDGKKMRISEYKTLMRQRRNEMRQLWCRG-EAGPSGSG------- 112
           HPDYRYRPRPKRTCIVDGKKMRISEYKTLMRQRRNEMRQLW RG E+GPSGSG       
Sbjct: 861 HPDYRYRPRPKRTCIVDGKKMRISEYKTLMRQRRNEMRQLWYRGEESGPSGSGLDGVAEP 920

Query: 113 ---GPAFPFPGDGSLSPSDM--MPFSPG-----SPG-SMDSHDED 146
              G +F FP DGS+SP  M  M  SP      SP  S+DSHDED
Sbjct: 921 DVAGTSFRFPADGSVSPIVMYSMANSPANSQANSPSFSVDSHDED 965

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350417222|ref|XP_003491316.1| PREDICTED: hypothetical protein LOC100741472 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340715248|ref|XP_003396129.1| PREDICTED: hypothetical protein LOC100650599 [Bombus terrestris] Back     alignment and taxonomy information
>gi|307174178|gb|EFN64823.1| Transcription factor SOX-5 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|380019991|ref|XP_003693882.1| PREDICTED: uncharacterized protein LOC100863610 [Apis florea] Back     alignment and taxonomy information
>gi|328785651|ref|XP_392414.4| PREDICTED: hypothetical protein LOC408884 [Apis mellifera] Back     alignment and taxonomy information
>gi|322794627|gb|EFZ17635.1| hypothetical protein SINV_12661 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|345496351|ref|XP_001603143.2| PREDICTED: hypothetical protein LOC100119354 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|332025343|gb|EGI65511.1| Transcription factor SOX-6 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|263359663|gb|ACY70499.1| hypothetical protein DVIR88_6g0036 [Drosophila virilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query146
FB|FBgn0039938618 Sox102F "Sox102F" [Drosophila 0.705 0.166 0.951 1.2e-51
UNIPROTKB|F1S992247 SOX-6 "Uncharacterized protein 0.719 0.425 0.790 8.1e-44
UNIPROTKB|F1SFJ1316 SOX5 "Uncharacterized protein" 0.719 0.332 0.780 2.8e-43
UNIPROTKB|F1NAU5783 SOX6 "Uncharacterized protein" 0.719 0.134 0.790 3.8e-43
RGD|1309000787 Sox6 "SRY (sex determining reg 0.719 0.133 0.790 3.9e-43
UNIPROTKB|F6UQM4793 SOX6 "Uncharacterized protein" 0.719 0.132 0.790 4.1e-43
MGI|MGI:98368827 Sox6 "SRY-box containing gene 0.719 0.126 0.790 4.9e-43
UNIPROTKB|P35712828 SOX6 "Transcription factor SOX 0.719 0.126 0.790 4.9e-43
UNIPROTKB|E2QTS7829 SOX6 "Uncharacterized protein" 0.719 0.126 0.790 4.9e-43
UNIPROTKB|E1BE01841 SOX6 "Uncharacterized protein" 0.719 0.124 0.790 5.2e-43
FB|FBgn0039938 Sox102F "Sox102F" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 536 (193.7 bits), Expect = 1.2e-51, P = 1.2e-51
 Identities = 98/103 (95%), Positives = 100/103 (97%)

Query:     1 MNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNAEKQPYYEEQSRLSKLHMEK 60
             MNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNA+KQPYYEEQSRLSKLHME+
Sbjct:   427 MNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHMEQ 486

Query:    61 HPDYRYRPRPKRTCIVDGKKMRISEYKTLMRQRRNEMRQLWCR 103
             HPDYRYRPRPKRTCIVDGKKMRISEYK LMR RR EMRQLWCR
Sbjct:   487 HPDYRYRPRPKRTCIVDGKKMRISEYKVLMRNRRAEMRQLWCR 529
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISS
UNIPROTKB|F1S992 SOX-6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1SFJ1 SOX5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NAU5 SOX6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1309000 Sox6 "SRY (sex determining region Y)-box 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F6UQM4 SOX6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:98368 Sox6 "SRY-box containing gene 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P35712 SOX6 "Transcription factor SOX-6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2QTS7 SOX6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BE01 SOX6 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B1H349SOX6_XENTRNo assigned EC number0.80.71910.1351yesN/A
P35711SOX5_HUMANNo assigned EC number0.71420.80130.1533yesN/A
P35710SOX5_MOUSENo assigned EC number0.71420.80130.1533yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
cd0138872 cd01388, SOX-TCF_HMG-box, SOX-TCF_HMG-box, class I 4e-34
pfam0050569 pfam00505, HMG_box, HMG (high mobility group) box 4e-20
smart0039870 smart00398, HMG, high mobility group 2e-19
cd0008466 cd00084, HMG-box, High Mobility Group (HMG)-box is 5e-18
cd0138977 cd01389, MATA_HMG-box, MATA_HMG-box, class I membe 2e-14
cd0139066 cd01390, HMGB-UBF_HMG-box, HMGB-UBF_HMG-box, class 2e-11
COG5648211 COG5648, NHP6B, Chromatin-associated proteins cont 2e-07
PTZ0019994 PTZ00199, PTZ00199, high mobility group protein; P 3e-05
pfam0901169 pfam09011, DUF1898, Domain of unknown function (DU 0.002
>gnl|CDD|238684 cd01388, SOX-TCF_HMG-box, SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information 
 Score =  113 bits (286), Expect = 4e-34
 Identities = 40/67 (59%), Positives = 52/67 (77%)

Query: 1  MNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNAEKQPYYEEQSRLSKLHMEK 60
          MNAFM+++K  RRK+L+  P   N  ISKILG RWKA+SN EKQPYYEE  +L +LHM+ 
Sbjct: 6  MNAFMLFSKRHRRKVLQEYPLKENRAISKILGDRWKALSNEEKQPYYEEAKKLKELHMKL 65

Query: 61 HPDYRYR 67
          +PDY++R
Sbjct: 66 YPDYKWR 72

These proteins contain a single HMG box, and bind the minor groove of DNA in a highly sequence-specific manner. Members include SRY and its homologs in insects and vertebrates, and transcription factor-like proteins, TCF-1, -3, -4, and LEF-1. They appear to bind the minor groove of the A/T C A A A G/C-motif. Length = 72
>gnl|CDD|189580 pfam00505, HMG_box, HMG (high mobility group) box Back     alignment and domain information
>gnl|CDD|197700 smart00398, HMG, high mobility group Back     alignment and domain information
>gnl|CDD|238037 cd00084, HMG-box, High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors Back     alignment and domain information
>gnl|CDD|238685 cd01389, MATA_HMG-box, MATA_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>gnl|CDD|238686 cd01390, HMGB-UBF_HMG-box, HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>gnl|CDD|227935 COG5648, NHP6B, Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|185511 PTZ00199, PTZ00199, high mobility group protein; Provisional Back     alignment and domain information
>gnl|CDD|204115 pfam09011, DUF1898, Domain of unknown function (DUF1898) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 146
KOG0527|consensus 331 99.94
cd0138977 MATA_HMG-box MATA_HMG-box, class I member of the H 99.92
KOG0528|consensus511 99.9
cd0138872 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of 99.89
PTZ0019994 high mobility group protein; Provisional 99.78
smart0039870 HMG high mobility group. 99.77
PF0050569 HMG_box: HMG (high mobility group) box; InterPro: 99.77
cd0139066 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and II 99.75
cd0008466 HMG-box High Mobility Group (HMG)-box is found in 99.72
KOG3248|consensus421 99.67
PF0901173 HMG_box_2: HMG-box domain; InterPro: IPR015101 Thi 99.64
KOG0381|consensus96 99.58
COG5648211 NHP6B Chromatin-associated proteins containing the 99.55
KOG0526|consensus615 99.29
KOG4715|consensus 410 99.15
KOG2746|consensus 683 98.96
PF1488785 HMG_box_5: HMG (high mobility group) box 5; PDB: 1 97.76
PF06382183 DUF1074: Protein of unknown function (DUF1074); In 97.72
COG5648211 NHP6B Chromatin-associated proteins containing the 96.91
PF0807355 CHDNT: CHDNT (NUC034) domain; InterPro: IPR012958 96.84
PTZ0019994 high mobility group protein; Provisional 95.35
PF04769201 MAT_Alpha1: Mating-type protein MAT alpha 1; Inter 92.7
PRK15117211 ABC transporter periplasmic binding protein MlaC; 92.41
TIGR03481198 HpnM hopanoid biosynthesis associated membrane pro 92.25
PF06244122 DUF1014: Protein of unknown function (DUF1014); In 88.74
PF0901173 HMG_box_2: HMG-box domain; InterPro: IPR015101 Thi 84.13
cd0139066 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and II 81.94
>KOG0527|consensus Back     alignment and domain information 
Probab=99.94  E-value=3.5e-27  Score=192.67  Aligned_cols=77  Identities=53%  Similarity=0.936  Sum_probs=73.5

Q ss_pred             CchhHHHHHHHHHHHHHhCCCCChhHHHHHHHHHHhcCChhhhhhhHHHHHHHHHHHHHhCCCCCCCCCCCCcccCC
Q psy12430          1 MNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNAEKQPYYEEQSRLSKLHMEKHPDYRYRPRPKRTCIVD   77 (146)
Q Consensus         1 mnay~lF~~~~r~~i~~~~P~~~~~eisk~lg~~Wk~Ls~eeK~~y~~~A~~~k~~~~~~~p~Yk~~p~~kr~~~~~   77 (146)
                      |||||+|++..|.+|.++||+++|.||||+||.+||.|+++||.+|+++|+++|.+|+++||+|||+||||+++...
T Consensus        67 MNAFMVWSq~~RRkma~qnP~mHNSEISK~LG~~WK~Lse~EKrPFi~EAeRLR~~HmkehPdYKYRPRRKkk~~~~  143 (331)
T KOG0527|consen   67 MNAFMVWSQGQRRKLAKQNPKMHNSEISKRLGAEWKLLSEEEKRPFVDEAERLRAQHMKEYPDYKYRPRRKKKKRPK  143 (331)
T ss_pred             cchhhhhhHHHHHHHHHhCcchhhHHHHHHHHHHHhhcCHhhhccHHHHHHHHHHHHHHhCCCcccccccccccccc
Confidence            89999999999999999999999999999999999999999999999999999999999999999999998754433

>cd01389 MATA_HMG-box MATA_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>KOG0528|consensus Back     alignment and domain information
>cd01388 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>PTZ00199 high mobility group protein; Provisional Back     alignment and domain information
>smart00398 HMG high mobility group Back     alignment and domain information
>PF00505 HMG_box: HMG (high mobility group) box; InterPro: IPR000910 High mobility group (HMG or HMGB) proteins are a family of relatively low molecular weight non-histone components in chromatin Back     alignment and domain information
>cd01390 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>cd00084 HMG-box High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors Back     alignment and domain information
>KOG3248|consensus Back     alignment and domain information
>PF09011 HMG_box_2: HMG-box domain; InterPro: IPR015101 This domain is predominantly found in Maelstrom homologue proteins Back     alignment and domain information
>KOG0381|consensus Back     alignment and domain information
>COG5648 NHP6B Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0526|consensus Back     alignment and domain information
>KOG4715|consensus Back     alignment and domain information
>KOG2746|consensus Back     alignment and domain information
>PF14887 HMG_box_5: HMG (high mobility group) box 5; PDB: 1L8Y_A 1L8Z_A 2HDZ_A Back     alignment and domain information
>PF06382 DUF1074: Protein of unknown function (DUF1074); InterPro: IPR024460 This family consists of several proteins which appear to be specific to Insecta Back     alignment and domain information
>COG5648 NHP6B Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information
>PF08073 CHDNT: CHDNT (NUC034) domain; InterPro: IPR012958 The CHD N-terminal domain is found in PHD/RING fingers and chromo domain-associated helicases [] Back     alignment and domain information
>PTZ00199 high mobility group protein; Provisional Back     alignment and domain information
>PF04769 MAT_Alpha1: Mating-type protein MAT alpha 1; InterPro: IPR006856 This family includes Saccharomyces cerevisiae (Baker's yeast) mating type protein alpha 1 (P01365 from SWISSPROT) Back     alignment and domain information
>PRK15117 ABC transporter periplasmic binding protein MlaC; Provisional Back     alignment and domain information
>TIGR03481 HpnM hopanoid biosynthesis associated membrane protein HpnM Back     alignment and domain information
>PF06244 DUF1014: Protein of unknown function (DUF1014); InterPro: IPR010422 This family consists of several hypothetical eukaryotic proteins of unknown function Back     alignment and domain information
>PF09011 HMG_box_2: HMG-box domain; InterPro: IPR015101 This domain is predominantly found in Maelstrom homologue proteins Back     alignment and domain information
>cd01390 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
1i11_A81 Solution Structure Of The Dna Binding Domain, Sox-5 4e-33
3f27_D83 Structure Of Sox17 Bound To Dna Length = 83 1e-20
1o4x_B88 Ternary Complex Of The Dna Binding Domains Of The O 2e-20
2le4_A81 Solution Structure Of The Hmg Box Dna-Binding Domai 3e-20
1gt0_D80 Crystal Structure Of A PouHMGDNA TERNARY COMPLEX Le 4e-20
3u2b_C79 Structure Of The Sox4 Hmg Domain Bound To Dna Lengt 9e-19
2yul_A82 Solution Structure Of The Hmg Box Of Human Transcri 2e-18
4a3n_A71 Crystal Structure Of Hmg-Box Of Human Sox17 Length 7e-18
1j46_A85 3d Solution Nmr Structure Of The Wild Type Hmg-Box 3e-17
1j47_A85 3d Solution Nmr Structure Of The M9i Mutant Of The 7e-17
1hrz_A76 The 3d Structure Of The Human Sry-Dna Complex Solve 9e-17
4euw_A106 Crystal Structure Of A Hmg Domain Of Transcription 6e-16
2gzk_A159 Structure Of A Complex Of Tandem Hmg Boxes And Dna 8e-16
2lef_A86 Lef1 Hmg Domain (From Mouse), Complexed With Dna (1 1e-06
2e6o_A87 Solution Structure Of The Hmg Box Domain From Human 6e-06
1cg7_A93 Hmg Protein Nhp6a From Saccharomyces Cerevisiae Len 2e-04
1j5n_A93 Solution Structure Of The Non-Sequence-Specific Hmg 2e-04
1wz6_A82 Solution Structure Of The Hmg_box Domain Of Murine 3e-04
2lhj_A97 Nmr Structure Of The High Mobility Group Protein-Li 4e-04
2yqi_A81 Solution Structure Of The Second Hmg-Box Domain Fro 6e-04
>pdb|1I11|A Chain A, Solution Structure Of The Dna Binding Domain, Sox-5 Hmg Box From Mouse Length = 81 Back     alignment and structure 
Iteration: 1

 Score =  136 bits (343), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 62/73 (84%), Positives = 70/73 (95%)
Query: 1  MNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNAEKQPYYEEQSRLSKLHMEK 60
          MNAFMVWAKDERRKIL+A PDMHNSNISKILG+RWKAM+N EKQPYYEEQ+RLSK H+EK
Sbjct: 9  MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKAMTNLEKQPYYEEQARLSKQHLEK 68
Query: 61 HPDYRYRPRPKRT 73
          +PDY+Y+PRPKRT
Sbjct: 69 YPDYKYKPRPKRT 81
>pdb|3F27|D Chain D, Structure Of Sox17 Bound To Dna Length = 83 Back     alignment and structure
>pdb|1O4X|B Chain B, Ternary Complex Of The Dna Binding Domains Of The Oct1 And Sox2 Transcription Factors With A 19mer Oligonucleotide From The Hoxb1 Regulatory Element Length = 88 Back     alignment and structure
>pdb|2LE4|A Chain A, Solution Structure Of The Hmg Box Dna-Binding Domain Of Human Stem Cell Transcription Factor Sox2 Length = 81 Back     alignment and structure
>pdb|1GT0|D Chain D, Crystal Structure Of A PouHMGDNA TERNARY COMPLEX Length = 80 Back     alignment and structure
>pdb|3U2B|C Chain C, Structure Of The Sox4 Hmg Domain Bound To Dna Length = 79 Back     alignment and structure
>pdb|2YUL|A Chain A, Solution Structure Of The Hmg Box Of Human Transcription Factor Sox-17 Length = 82 Back     alignment and structure
>pdb|4A3N|A Chain A, Crystal Structure Of Hmg-Box Of Human Sox17 Length = 71 Back     alignment and structure
>pdb|1J46|A Chain A, 3d Solution Nmr Structure Of The Wild Type Hmg-Box Domain Of The Human Male Sex Determining Factor Sry Complexed To Dna Length = 85 Back     alignment and structure
>pdb|1J47|A Chain A, 3d Solution Nmr Structure Of The M9i Mutant Of The Hmg-Box Domain Of The Human Male Sex Determining Factor Sry Complexed To Dna Length = 85 Back     alignment and structure
>pdb|1HRZ|A Chain A, The 3d Structure Of The Human Sry-Dna Complex Solved By Multi-Dimensional Heteronuclear-Edited And-Filtered Nmr Length = 76 Back     alignment and structure
>pdb|4EUW|A Chain A, Crystal Structure Of A Hmg Domain Of Transcription Factor Sox-9 Bound To Dna (Sox-9DNA) FROM HOMO SAPIENS AT 2.77 A RESOLUTION Length = 106 Back     alignment and structure
>pdb|2GZK|A Chain A, Structure Of A Complex Of Tandem Hmg Boxes And Dna Length = 159 Back     alignment and structure
>pdb|2LEF|A Chain A, Lef1 Hmg Domain (From Mouse), Complexed With Dna (15bp), Nmr, 12 Structures Length = 86 Back     alignment and structure
>pdb|2E6O|A Chain A, Solution Structure Of The Hmg Box Domain From Human Hmg-Box Transcription Factor 1 Length = 87 Back     alignment and structure
>pdb|1CG7|A Chain A, Hmg Protein Nhp6a From Saccharomyces Cerevisiae Length = 93 Back     alignment and structure
>pdb|1J5N|A Chain A, Solution Structure Of The Non-Sequence-Specific Hmgb Protein Nhp6a In Complex With Sry Dna Length = 93 Back     alignment and structure
>pdb|1WZ6|A Chain A, Solution Structure Of The Hmg_box Domain Of Murine Bobby Sox Homolog Length = 82 Back     alignment and structure
>pdb|2LHJ|A Chain A, Nmr Structure Of The High Mobility Group Protein-Like Protein Nhp1 From Babesia Bovis T2bo (Baboa.00841.A) Length = 97 Back     alignment and structure
>pdb|2YQI|A Chain A, Solution Structure Of The Second Hmg-Box Domain From High Mobility Group Protein B3 Length = 81 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
1i11_A81 Transcription factor SOX-5; HMG BOX, DNA bending, 7e-39
4euw_A106 Transcription factor SOX-9; protein-DNA complex, H 5e-37
3u2b_C79 Transcription factor SOX-4; HMG domain, transcript 3e-36
1wz6_A82 HMG-box transcription factor BBX; bobby SOX homolo 6e-36
1j46_A85 SRY, sex-determining region Y protein; MALE sex de 9e-36
3f27_D83 Transcription factor SOX-17; protein-DNA complex, 1e-35
1hry_A76 Human SRY; DNA, DNA-binding protein, DNA binding p 1e-35
2lef_A86 LEF-1 HMG, protein (lymphoid enhancer-binding fact 1e-35
1gt0_D80 Transcription factor SOX-2; POU factors, SOX prote 7e-35
4a3n_A71 Transcription factor SOX-17; 2.40A {Homo sapiens} 8e-33
2e6o_A87 HMG box-containing protein 1; HMG-box domain, HMG- 6e-31
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 5e-26
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 9e-26
1wgf_A90 Upstream binding factor 1; transcription factor, D 1e-25
2crj_A92 SWI/SNF-related matrix-associated actin- dependent 9e-21
1hme_A77 High mobility group protein fragment-B; DNA-bindin 3e-20
2cs1_A92 PMS1 protein homolog 1; DNA mismatch repair protei 2e-18
1wxl_A73 Single-strand recognition protein; FACT, SSRP1, HM 5e-17
2lhj_A97 High mobility group protein homolog NHP1; structur 1e-16
3nm9_A73 HMG-D, high mobility group protein D; DNA bending, 3e-16
2co9_A102 Thymus high mobility group box protein TOX; TOX pr 3e-16
1cg7_A93 Protein (NON histone protein 6 A); HMG BOX, DNA be 9e-15
1k99_A99 Upstream binding factor 1; alpha-helix, L-shape, D 1e-14
2yrq_A173 High mobility group protein B1; HMG box domain, DN 6e-12
2yrq_A173 High mobility group protein B1; HMG box domain, DN 7e-06
1ckt_A71 High mobility group 1 protein; high-mobility group 2e-11
1aab_A83 High mobility group protein; HMG-BOX, DNA-binding; 7e-11
2eqz_A86 High mobility group protein B3; HMG-box domain, mo 2e-10
3tq6_A214 Transcription factor A, mitochondrial; transcripti 2e-09
3tq6_A214 Transcription factor A, mitochondrial; transcripti 8e-06
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 4e-09
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 2e-05
3fgh_A67 Transcription factor A, mitochondrial; HMG domain, 3e-08
2d7l_A81 WD repeat and HMG-box DNA binding protein 1; high 2e-07
1v63_A101 Nucleolar transcription factor 1; DNA binding, str 4e-06
1v64_A108 Nucleolar transcription factor 1; DNA binding, str 5e-05
>1i11_A Transcription factor SOX-5; HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein, DNA sequence specific, testis determining.; NMR {Mus musculus} SCOP: a.21.1.1 Length = 81 Back     alignment and structure
 Score =  125 bits (316), Expect = 7e-39
 Identities = 62/73 (84%), Positives = 70/73 (95%)

Query: 1  MNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNAEKQPYYEEQSRLSKLHMEK 60
          MNAFMVWAKDERRKIL+A PDMHNSNISKILG+RWKAM+N EKQPYYEEQ+RLSK H+EK
Sbjct: 9  MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKAMTNLEKQPYYEEQARLSKQHLEK 68

Query: 61 HPDYRYRPRPKRT 73
          +PDY+Y+PRPKRT
Sbjct: 69 YPDYKYKPRPKRT 81
>4euw_A Transcription factor SOX-9; protein-DNA complex, HMG domain, activator, DNA-binding, NUC transcription; HET: DNA; 2.77A {Homo sapiens} Length = 106 Back     alignment and structure
>3u2b_C Transcription factor SOX-4; HMG domain, transcriptional regulation, transcription-DNA CO; HET: DNA; 2.40A {Mus musculus} Length = 79 Back     alignment and structure
>1wz6_A HMG-box transcription factor BBX; bobby SOX homolog, HMG_BOX domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative; NMR {Mus musculus} Length = 82 Back     alignment and structure
>1j46_A SRY, sex-determining region Y protein; MALE sex determining factor, SRY, sex-reversal mutation; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1j47_A Length = 85 Back     alignment and structure
>3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, DNA- nucleus, transcription regulation, transcrip complex; HET: DNA; 2.75A {Mus musculus} PDB: 2yul_A Length = 83 Back     alignment and structure
>1hry_A Human SRY; DNA, DNA-binding protein, DNA binding protein/DNA complex; HET: DNA; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1hrz_A* Length = 76 Back     alignment and structure
>2lef_A LEF-1 HMG, protein (lymphoid enhancer-binding factor); LEF1, HMG, TCR-A, transcription factor; HET: DNA; NMR {Mus musculus} SCOP: a.21.1.1 Length = 86 Back     alignment and structure
>1gt0_D Transcription factor SOX-2; POU factors, SOX proteins; 2.6A {Mus musculus} SCOP: a.21.1.1 PDB: 2le4_A 1o4x_B Length = 80 Back     alignment and structure
>4a3n_A Transcription factor SOX-17; 2.40A {Homo sapiens} Length = 71 Back     alignment and structure
>2e6o_A HMG box-containing protein 1; HMG-box domain, HMG-box transcription factor 1, high mobility group box transcription factor 1, structural genomics; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Length = 159 Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Length = 159 Back     alignment and structure
>1wgf_A Upstream binding factor 1; transcription factor, DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Length = 90 Back     alignment and structure
>2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} Length = 92 Back     alignment and structure
>1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A Length = 77 Back     alignment and structure
>2cs1_A PMS1 protein homolog 1; DNA mismatch repair protein PMS1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1wxl_A Single-strand recognition protein; FACT, SSRP1, HMG, DNA binding protein; NMR {Drosophila melanogaster} Length = 73 Back     alignment and structure
>2lhj_A High mobility group protein homolog NHP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid; NMR {Babesia bovis} Length = 97 Back     alignment and structure
>3nm9_A HMG-D, high mobility group protein D; DNA bending, non-sequence-specific, HMG chromosomal protein; HET: DNA; 2.85A {Drosophila melanogaster} PDB: 1e7j_A* 1hma_A 1qrv_A* Length = 73 Back     alignment and structure
>2co9_A Thymus high mobility group box protein TOX; TOX protein, HMG box domain, structural genomics, NPPSFA; NMR {Mus musculus} Length = 102 Back     alignment and structure
>1cg7_A Protein (NON histone protein 6 A); HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.21.1.1 PDB: 1j5n_A 1lwm_A Length = 93 Back     alignment and structure
>1k99_A Upstream binding factor 1; alpha-helix, L-shape, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 Length = 99 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 173 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 173 Back     alignment and structure
>1ckt_A High mobility group 1 protein; high-mobility group domain, BENT DNA, protein-drug-DNA compl regulation-DNA complex; HET: DNA 5IU; 2.50A {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1j3x_A Length = 71 Back     alignment and structure
>1aab_A High mobility group protein; HMG-BOX, DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 Length = 83 Back     alignment and structure
>2eqz_A High mobility group protein B3; HMG-box domain, mobility group protein 2A, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Length = 214 Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Length = 214 Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Length = 238 Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Length = 238 Back     alignment and structure
>3fgh_A Transcription factor A, mitochondrial; HMG domain, mitochondrial transcription, activator, DNA- binding, mitochondrion, phosphoprotein; 1.35A {Homo sapiens} Length = 67 Back     alignment and structure
>2d7l_A WD repeat and HMG-box DNA binding protein 1; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1v63_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: a.21.1.1 Length = 101 Back     alignment and structure
>1v64_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Length = 108 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query146
1i11_A81 Transcription factor SOX-5; HMG BOX, DNA bending, 99.93
3f27_D83 Transcription factor SOX-17; protein-DNA complex, 99.93
3u2b_C79 Transcription factor SOX-4; HMG domain, transcript 99.93
1j46_A85 SRY, sex-determining region Y protein; MALE sex de 99.93
1gt0_D80 Transcription factor SOX-2; POU factors, SOX prote 99.93
2lef_A86 LEF-1 HMG, protein (lymphoid enhancer-binding fact 99.93
4euw_A106 Transcription factor SOX-9; protein-DNA complex, H 99.92
1hry_A76 Human SRY; DNA, DNA-binding protein, DNA binding p 99.92
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 99.92
1wz6_A82 HMG-box transcription factor BBX; bobby SOX homolo 99.91
2e6o_A87 HMG box-containing protein 1; HMG-box domain, HMG- 99.9
2yrq_A173 High mobility group protein B1; HMG box domain, DN 99.89
4a3n_A71 Transcription factor SOX-17; 2.40A {Homo sapiens} 99.88
1k99_A99 Upstream binding factor 1; alpha-helix, L-shape, D 99.87
1hme_A77 High mobility group protein fragment-B; DNA-bindin 99.86
2crj_A92 SWI/SNF-related matrix-associated actin- dependent 99.86
2cs1_A92 PMS1 protein homolog 1; DNA mismatch repair protei 99.85
3tq6_A214 Transcription factor A, mitochondrial; transcripti 99.85
1ckt_A71 High mobility group 1 protein; high-mobility group 99.85
2co9_A102 Thymus high mobility group box protein TOX; TOX pr 99.84
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 99.84
1wxl_A73 Single-strand recognition protein; FACT, SSRP1, HM 99.84
1aab_A83 High mobility group protein; HMG-BOX, DNA-binding; 99.83
2eqz_A86 High mobility group protein B3; HMG-box domain, mo 99.83
3nm9_A73 HMG-D, high mobility group protein D; DNA bending, 99.83
1wgf_A90 Upstream binding factor 1; transcription factor, D 99.81
2lhj_A97 High mobility group protein homolog NHP1; structur 99.79
2d7l_A81 WD repeat and HMG-box DNA binding protein 1; high 99.78
1cg7_A93 Protein (NON histone protein 6 A); HMG BOX, DNA be 99.78
1l8y_A91 Upstream binding factor 1; HUBF, HMG box 5, DNA bi 99.77
3fgh_A67 Transcription factor A, mitochondrial; HMG domain, 99.77
2yrq_A173 High mobility group protein B1; HMG box domain, DN 99.76
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 99.74
1v63_A101 Nucleolar transcription factor 1; DNA binding, str 99.73
2cto_A93 Novel protein; high mobility group box domain, hel 99.73
1v64_A108 Nucleolar transcription factor 1; DNA binding, str 99.72
2yuk_A90 Myeloid/lymphoid or mixed-lineage leukemia protein 99.68
3tq6_A214 Transcription factor A, mitochondrial; transcripti 99.52
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 99.51
1k99_A99 Upstream binding factor 1; alpha-helix, L-shape, D 95.83
2eqz_A86 High mobility group protein B3; HMG-box domain, mo 95.48
1wgf_A90 Upstream binding factor 1; transcription factor, D 95.35
2co9_A102 Thymus high mobility group box protein TOX; TOX pr 95.32
2e6o_A87 HMG box-containing protein 1; HMG-box domain, HMG- 93.95
1aab_A83 High mobility group protein; HMG-BOX, DNA-binding; 93.45
1hme_A77 High mobility group protein fragment-B; DNA-bindin 93.38
1v64_A108 Nucleolar transcription factor 1; DNA binding, str 93.13
2lhj_A97 High mobility group protein homolog NHP1; structur 92.99
3nm9_A73 HMG-D, high mobility group protein D; DNA bending, 92.61
1cg7_A93 Protein (NON histone protein 6 A); HMG BOX, DNA be 92.31
2crj_A92 SWI/SNF-related matrix-associated actin- dependent 92.24
2yuk_A90 Myeloid/lymphoid or mixed-lineage leukemia protein 92.0
2d7l_A81 WD repeat and HMG-box DNA binding protein 1; high 91.89
1wxl_A73 Single-strand recognition protein; FACT, SSRP1, HM 91.33
1hry_A76 Human SRY; DNA, DNA-binding protein, DNA binding p 90.69
2cto_A93 Novel protein; high mobility group box domain, hel 90.65
2cs1_A92 PMS1 protein homolog 1; DNA mismatch repair protei 89.7
3fgh_A67 Transcription factor A, mitochondrial; HMG domain, 89.37
1ckt_A71 High mobility group 1 protein; high-mobility group 88.87
1wz6_A82 HMG-box transcription factor BBX; bobby SOX homolo 88.73
4euw_A106 Transcription factor SOX-9; protein-DNA complex, H 88.6
1j46_A85 SRY, sex-determining region Y protein; MALE sex de 88.55
1i11_A81 Transcription factor SOX-5; HMG BOX, DNA bending, 85.91
1gt0_D80 Transcription factor SOX-2; POU factors, SOX prote 85.81
2qgu_A211 Probable signal peptide protein; NESG, RSR89, Q8XV 84.99
3f27_D83 Transcription factor SOX-17; protein-DNA complex, 84.47
4a3n_A71 Transcription factor SOX-17; 2.40A {Homo sapiens} 82.44
2lef_A86 LEF-1 HMG, protein (lymphoid enhancer-binding fact 80.83
>1i11_A Transcription factor SOX-5; HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein, DNA sequence specific, testis determining.; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
Probab=99.93  E-value=1.5e-26  Score=153.07  Aligned_cols=72  Identities=85%  Similarity=1.378  Sum_probs=63.4

Q ss_pred             CchhHHHHHHHHHHHHHhCCCCChhHHHHHHHHHHhcCChhhhhhhHHHHHHHHHHHHHhCCCCCCCCCCCC
Q psy12430          1 MNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNAEKQPYYEEQSRLSKLHMEKHPDYRYRPRPKR   72 (146)
Q Consensus         1 mnay~lF~~~~r~~i~~~~P~~~~~eisk~lg~~Wk~Ls~eeK~~y~~~A~~~k~~~~~~~p~Yk~~p~~kr   72 (146)
                      |||||||++++|.+|+.+||++++.||+++||++|++|+++||++|+++|++++++|.++||+|+|+|++++
T Consensus         9 ~naf~lf~~~~r~~~~~~~p~~~~~eisk~lg~~Wk~ls~eeK~~y~~~A~~~k~~~~~~~p~Yky~pr~~~   80 (81)
T 1i11_A            9 MNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKAMTNLEKQPYYEEQARLSKQHLEKYPDYKYKPRPKR   80 (81)
T ss_dssp             CCHHHHHHHHHHHHHHTTCSSCCHHHHHHHHHHHHTTSCSGGGHHHHHHHHHHHHHHHTTCSCC--------
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHhhhhhCCHHHHHHHHHHHHHHHHHHHHHCCCCeeccCCCC
Confidence            799999999999999999999999999999999999999999999999999999999999999999998875
>3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, DNA- nucleus, transcription regulation, transcrip complex; HET: DNA; 2.75A {Mus musculus} SCOP: a.21.1.1 PDB: 2yul_A Back     alignment and structure
>3u2b_C Transcription factor SOX-4; HMG domain, transcriptional regulation, transcription-DNA CO; HET: DNA; 2.40A {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>1j46_A SRY, sex-determining region Y protein; MALE sex determining factor, SRY, sex-reversal mutation; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1j47_A Back     alignment and structure
>1gt0_D Transcription factor SOX-2; POU factors, SOX proteins; 2.6A {Mus musculus} SCOP: a.21.1.1 PDB: 2le4_A 1o4x_B Back     alignment and structure
>2lef_A LEF-1 HMG, protein (lymphoid enhancer-binding factor); LEF1, HMG, TCR-A, transcription factor; HET: DNA; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>4euw_A Transcription factor SOX-9; protein-DNA complex, HMG domain, activator, DNA-binding, NUC transcription; HET: DNA; 2.77A {Homo sapiens} Back     alignment and structure
>1hry_A Human SRY; DNA, DNA-binding protein, DNA binding protein/DNA complex; HET: DNA; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1hrz_A* Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Back     alignment and structure
>1wz6_A HMG-box transcription factor BBX; bobby SOX homolog, HMG_BOX domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative; NMR {Mus musculus} Back     alignment and structure
>2e6o_A HMG box-containing protein 1; HMG-box domain, HMG-box transcription factor 1, high mobility group box transcription factor 1, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a3n_A Transcription factor SOX-17; 2.40A {Homo sapiens} SCOP: a.21.1.0 Back     alignment and structure
>1k99_A Upstream binding factor 1; alpha-helix, L-shape, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 Back     alignment and structure
>1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A Back     alignment and structure
>2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} Back     alignment and structure
>2cs1_A PMS1 protein homolog 1; DNA mismatch repair protein PMS1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Back     alignment and structure
>1ckt_A High mobility group 1 protein; high-mobility group domain, BENT DNA, protein-drug-DNA compl regulation-DNA complex; HET: DNA 5IU; 2.50A {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1j3x_A Back     alignment and structure
>2co9_A Thymus high mobility group box protein TOX; TOX protein, HMG box domain, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Back     alignment and structure
>1wxl_A Single-strand recognition protein; FACT, SSRP1, HMG, DNA binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>1aab_A High mobility group protein; HMG-BOX, DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 Back     alignment and structure
>2eqz_A High mobility group protein B3; HMG-box domain, mobility group protein 2A, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nm9_A HMG-D, high mobility group protein D; DNA bending, non-sequence-specific, HMG chromosomal protein; HET: DNA; 2.85A {Drosophila melanogaster} SCOP: a.21.1.1 PDB: 1e7j_A* 1hma_A 1qrv_A* Back     alignment and structure
>1wgf_A Upstream binding factor 1; transcription factor, DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2lhj_A High mobility group protein homolog NHP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid; NMR {Babesia bovis} Back     alignment and structure
>2d7l_A WD repeat and HMG-box DNA binding protein 1; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1cg7_A Protein (NON histone protein 6 A); HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.21.1.1 PDB: 1j5n_A 1lwm_A Back     alignment and structure
>1l8y_A Upstream binding factor 1; HUBF, HMG box 5, DNA binding domain, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1l8z_A 2hdz_A Back     alignment and structure
>3fgh_A Transcription factor A, mitochondrial; HMG domain, mitochondrial transcription, activator, DNA- binding, mitochondrion, phosphoprotein; 1.35A {Homo sapiens} Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Back     alignment and structure
>1v63_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2cto_A Novel protein; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v64_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2yuk_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Back     alignment and structure
>1k99_A Upstream binding factor 1; alpha-helix, L-shape, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 Back     alignment and structure
>2eqz_A High mobility group protein B3; HMG-box domain, mobility group protein 2A, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wgf_A Upstream binding factor 1; transcription factor, DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2co9_A Thymus high mobility group box protein TOX; TOX protein, HMG box domain, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2e6o_A HMG box-containing protein 1; HMG-box domain, HMG-box transcription factor 1, high mobility group box transcription factor 1, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1aab_A High mobility group protein; HMG-BOX, DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 Back     alignment and structure
>1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A Back     alignment and structure
>1v64_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2lhj_A High mobility group protein homolog NHP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid; NMR {Babesia bovis} Back     alignment and structure
>3nm9_A HMG-D, high mobility group protein D; DNA bending, non-sequence-specific, HMG chromosomal protein; HET: DNA; 2.85A {Drosophila melanogaster} SCOP: a.21.1.1 PDB: 1e7j_A* 1hma_A 1qrv_A* Back     alignment and structure
>1cg7_A Protein (NON histone protein 6 A); HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.21.1.1 PDB: 1j5n_A 1lwm_A Back     alignment and structure
>2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} Back     alignment and structure
>2yuk_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2d7l_A WD repeat and HMG-box DNA binding protein 1; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wxl_A Single-strand recognition protein; FACT, SSRP1, HMG, DNA binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>1hry_A Human SRY; DNA, DNA-binding protein, DNA binding protein/DNA complex; HET: DNA; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1hrz_A* Back     alignment and structure
>2cto_A Novel protein; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cs1_A PMS1 protein homolog 1; DNA mismatch repair protein PMS1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fgh_A Transcription factor A, mitochondrial; HMG domain, mitochondrial transcription, activator, DNA- binding, mitochondrion, phosphoprotein; 1.35A {Homo sapiens} Back     alignment and structure
>1ckt_A High mobility group 1 protein; high-mobility group domain, BENT DNA, protein-drug-DNA compl regulation-DNA complex; HET: DNA 5IU; 2.50A {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1j3x_A Back     alignment and structure
>1wz6_A HMG-box transcription factor BBX; bobby SOX homolog, HMG_BOX domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative; NMR {Mus musculus} Back     alignment and structure
>4euw_A Transcription factor SOX-9; protein-DNA complex, HMG domain, activator, DNA-binding, NUC transcription; HET: DNA; 2.77A {Homo sapiens} Back     alignment and structure
>1j46_A SRY, sex-determining region Y protein; MALE sex determining factor, SRY, sex-reversal mutation; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1j47_A Back     alignment and structure
>1i11_A Transcription factor SOX-5; HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein, DNA sequence specific, testis determining.; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>1gt0_D Transcription factor SOX-2; POU factors, SOX proteins; 2.6A {Mus musculus} SCOP: a.21.1.1 PDB: 2le4_A 1o4x_B Back     alignment and structure
>2qgu_A Probable signal peptide protein; NESG, RSR89, Q8XV73, structural genomics, PSI-2, protein STR initiative; HET: MSE PEF; 1.50A {Ralstonia solanacearum} Back     alignment and structure
>3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, DNA- nucleus, transcription regulation, transcrip complex; HET: DNA; 2.75A {Mus musculus} SCOP: a.21.1.1 PDB: 2yul_A Back     alignment and structure
>4a3n_A Transcription factor SOX-17; 2.40A {Homo sapiens} SCOP: a.21.1.0 Back     alignment and structure
>2lef_A LEF-1 HMG, protein (lymphoid enhancer-binding factor); LEF1, HMG, TCR-A, transcription factor; HET: DNA; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 146
d1gt0d_80 a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 8e-24
d2lefa_86 a.21.1.1 (A:) Lymphoid enhancer-binding factor, LE 1e-22
d1j46a_85 a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 96 7e-22
d1i11a_70 a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 1e-20
d1hsma_79 a.21.1.1 (A:) High mobility group protein 1, HMG1 5e-20
d1qrva_73 a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxI 4e-16
d1lwma_93 a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces 5e-15
d1ckta_71 a.21.1.1 (A:) High mobility group protein 1, HMG1 3e-14
d1v63a_101 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 5e-14
d1k99a_91 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 7e-14
d1v64a_108 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 8e-14
d1wgfa_90 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 1e-12
>d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure

class: All alpha proteins
fold: HMG-box
superfamily: HMG-box
family: HMG-box
domain: Sox-2
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 86.0 bits (213), Expect = 8e-24
 Identities = 42/72 (58%), Positives = 54/72 (75%)

Query: 1  MNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNAEKQPYYEEQSRLSKLHMEK 60
          MNAFMVW++ +RRK+ +  P MHNS ISK LGA WK +S  EK+P+ +E  RL  LHM++
Sbjct: 7  MNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKE 66

Query: 61 HPDYRYRPRPKR 72
          HPDY+YRPR K 
Sbjct: 67 HPDYKYRPRRKT 78
>d2lefa_ a.21.1.1 (A:) Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1j46a_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 70 Back     information, alignment and structure
>d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} Length = 79 Back     information, alignment and structure
>d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxId: 7227]} Length = 73 Back     information, alignment and structure
>d1lwma_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 93 Back     information, alignment and structure
>d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 Back     information, alignment and structure
>d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1v64a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query146
d1gt0d_80 Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.93
d2lefa_86 Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus 99.92
d1j46a_85 SRY {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1i11a_70 Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} 99.9
d1hsma_79 High mobility group protein 1, HMG1 {Hamster (Cric 99.83
d1ckta_71 High mobility group protein 1, HMG1 {Rat (Rattus n 99.82
d1qrva_73 HMG-D {Drosophila melanogaster [TaxId: 7227]} 99.78
d1lwma_93 NHP6a {Baker's yeast (Saccharomyces cerevisiae) [T 99.77
d1k99a_91 Nucleolar transcription factor 1 (Upstream binding 99.76
d1wgfa_90 Nucleolar transcription factor 1 (Upstream binding 99.75
d1v63a_101 Nucleolar transcription factor 1 (Upstream binding 99.69
d1v64a_108 Nucleolar transcription factor 1 (Upstream binding 99.66
d1l8ya_84 Nucleolar transcription factor 1 (Upstream binding 95.03
d1k99a_91 Nucleolar transcription factor 1 (Upstream binding 93.92
d1lwma_93 NHP6a {Baker's yeast (Saccharomyces cerevisiae) [T 93.43
d1qrva_73 HMG-D {Drosophila melanogaster [TaxId: 7227]} 93.37
d1wgfa_90 Nucleolar transcription factor 1 (Upstream binding 93.22
d1hsma_79 High mobility group protein 1, HMG1 {Hamster (Cric 92.33
d1ckta_71 High mobility group protein 1, HMG1 {Rat (Rattus n 90.01
d1j46a_85 SRY {Human (Homo sapiens) [TaxId: 9606]} 87.55
d1gt0d_80 Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} 86.46
d1v64a_108 Nucleolar transcription factor 1 (Upstream binding 84.2
d1i11a_70 Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} 83.65
>d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: HMG-box
superfamily: HMG-box
family: HMG-box
domain: Sox-2
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.93  E-value=4e-26  Score=149.75  Aligned_cols=72  Identities=58%  Similarity=1.082  Sum_probs=69.7

Q ss_pred             CchhHHHHHHHHHHHHHhCCCCChhHHHHHHHHHHhcCChhhhhhhHHHHHHHHHHHHHhCCCCCCCCCCCC
Q psy12430          1 MNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNAEKQPYYEEQSRLSKLHMEKHPDYRYRPRPKR   72 (146)
Q Consensus         1 mnay~lF~~~~r~~i~~~~P~~~~~eisk~lg~~Wk~Ls~eeK~~y~~~A~~~k~~~~~~~p~Yk~~p~~kr   72 (146)
                      |||||||++++|.+|+.+||+++++||+++||++|++|+++||++|+++|+.++++|.++||+|+|+|+++.
T Consensus         7 ~nAy~lF~~~~r~~~~~~~p~~~~~eisk~~g~~W~~l~~eeK~~y~~~A~~~k~~y~~~~p~Yk~~p~rk~   78 (80)
T d1gt0d_           7 MNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKT   78 (80)
T ss_dssp             CCHHHHHHHHHHHHHHTTSTTSCHHHHHHHHHHHHTTSCHHHHHHHHHHHHHHHHHHHHHCTTCCCCCCCCC
T ss_pred             CcHHHHHHHHHHHHHHHHcCCCCHHHHHHHHHHHHCcCCHHHHHHHHHHHHHHHHHHHHHCccccCCCCCCC
Confidence            799999999999999999999999999999999999999999999999999999999999999999997653
>d2lefa_ a.21.1.1 (A:) Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j46a_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1lwma_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v64a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l8ya_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lwma_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1j46a_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v64a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure