Psyllid ID: psy12546
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 765 | ||||||
| 307215202 | 602 | BTB/POZ domain-containing protein 9 [Har | 0.677 | 0.860 | 0.509 | 1e-170 | |
| 383862423 | 604 | PREDICTED: BTB/POZ domain-containing pro | 0.691 | 0.875 | 0.500 | 1e-167 | |
| 66564756 | 617 | PREDICTED: BTB/POZ domain-containing pro | 0.729 | 0.904 | 0.483 | 1e-165 | |
| 350413268 | 615 | PREDICTED: BTB/POZ domain-containing pro | 0.691 | 0.860 | 0.499 | 1e-165 | |
| 380023366 | 617 | PREDICTED: BTB/POZ domain-containing pro | 0.729 | 0.904 | 0.483 | 1e-164 | |
| 340708503 | 615 | PREDICTED: BTB/POZ domain-containing pro | 0.691 | 0.860 | 0.486 | 1e-156 | |
| 291226013 | 630 | PREDICTED: CG1826-like [Saccoglossus kow | 0.652 | 0.792 | 0.478 | 1e-154 | |
| 357622576 | 716 | hypothetical protein KGM_13514 [Danaus p | 0.745 | 0.796 | 0.428 | 1e-151 | |
| 190360739 | 611 | BTB/POZ domain-containing protein 9 [Bos | 0.684 | 0.857 | 0.467 | 1e-150 | |
| 301782813 | 779 | PREDICTED: BTB/POZ domain-containing pro | 0.684 | 0.672 | 0.465 | 1e-150 |
| >gi|307215202|gb|EFN89974.1| BTB/POZ domain-containing protein 9 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
Score = 605 bits (1559), Expect = e-170, Method: Compositional matrix adjust.
Identities = 309/606 (50%), Positives = 398/606 (65%), Gaps = 88/606 (14%)
Query: 128 DVILDILGKKQNKGTTL----TQNFRALLYGGLCESNQNEIELHDTNIVAFKCLLKYIYS 183
DV L + G+K N + + FRALL+GG+ ES QN IEL + AFK LLKYIY+
Sbjct: 33 DVTLVVAGQKFNTHKLILAARSDYFRALLFGGMRESTQNVIELPSATLPAFKGLLKYIYT 92
Query: 184 GKLSFRNLKDDVILDILGLSHKYGFQDLENSISDYLRVILTVHNACSIFDCAYYYDLKQL 243
G++S N +D+VILD LGL+H YGF DLE +ISDYLR IL++ N C I D A+ Y L L
Sbjct: 93 GRMSLANERDEVILDTLGLAHLYGFLDLEAAISDYLREILSIKNVCLIIDTAFLYQLDFL 152
Query: 244 NKIVLSFIDYNAKQIISENSFYNLSQNGLIQLIQRDSFYAPEIDIFRAVVDWIKANSPEV 303
++ L ++D +A ++I +F LS L +LI RDSFYAPEIDIF AV W+KAN PEV
Sbjct: 153 TRVCLEYMDKHAPEVIQHENFLQLSPEALNKLISRDSFYAPEIDIFLAVESWVKAN-PEV 211
Query: 304 EEDGESSFRAPINMDEILTYVRLPLISLDELLTTVRSSGIISADKILDAIELQTNDKVQY 363
N E+L+ +RL LIS+ +LL VR +G++S++ ILDAI +T +
Sbjct: 212 ------------NASEVLSRLRLSLISITDLLNVVRPTGLVSSEAILDAISARTQTR--- 256
Query: 364 RANSPEVEEDGESSFRAPINMDEILTYVRLPLISLDELLTTVRSSGIISADKILDAIELQ 423
D E +R + +DE
Sbjct: 257 ---------DSELEYRGRLLVDE------------------------------------- 270
Query: 424 TNDKVQYRGYLKPEENLATSKMGTMVMQGEMKNALLNGDVNNYDMENGYTRHTITEATSS 483
N+A G V+QGEM++ LLNGD NYDME GYTRHTITE
Sbjct: 271 ---------------NVAHPMHGAQVLQGEMRSYLLNGDTINYDMERGYTRHTITE---- 311
Query: 484 TSCDNGILIKLGTQAIVNHIKLLLWDKDLRSYSYFIEVSIDQKKWTRVIDYTRFYCRSWQ 543
S + GILIKLGTQ I+NH+K+LLWD+D+RSYSY+IE S+DQK W ++ID++ ++CRSWQ
Sbjct: 312 -SAEQGILIKLGTQCIINHVKMLLWDRDMRSYSYYIEGSMDQKDWVKLIDHSDYFCRSWQ 370
Query: 544 FLYFPTQVVQYIRVVGTNNTVNKVFHIVSFEIMYTAQTVQLSEEGIIIPKHNVATRELSA 603
+LYF +VV YIR+VGTNNTVN+VFH+V+FE YT T +LS +G ++P NVA E SA
Sbjct: 371 YLYFEPRVVLYIRIVGTNNTVNRVFHVVNFEAYYTNHTEELS-DGFVVPTQNVAVAERSA 429
Query: 604 KVVEGVSRSLSSLIDGNTVKYDWDSGYTCHQLGSGAILVQLGQPYMLDSMRLLLWDCDDR 663
V+EGVSRS ++L++G+T YDWDSGYTCHQLGSGAILVQLGQPYM+ SMRLLLWDCD+R
Sbjct: 430 CVIEGVSRSRNNLLNGDTSNYDWDSGYTCHQLGSGAILVQLGQPYMIHSMRLLLWDCDNR 489
Query: 664 SYSYLVDVSINLWDWEIVADHTRDLCRSWQSISFS-RRPVVFVRIIGTHNTMNEVFHCVH 722
SYSY ++V+ N WDW ++AD TR+ CRSWQ+I + RPVV++RI+GTHNT NEVFHCVH
Sbjct: 490 SYSYYIEVAGNTWDWSVIADKTRESCRSWQTIHINPPRPVVYIRIVGTHNTANEVFHCVH 549
Query: 723 FECPDQ 728
FECP Q
Sbjct: 550 FECPAQ 555
|
Source: Harpegnathos saltator Species: Harpegnathos saltator Genus: Harpegnathos Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|383862423|ref|XP_003706683.1| PREDICTED: BTB/POZ domain-containing protein 9 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|66564756|ref|XP_395842.2| PREDICTED: BTB/POZ domain-containing protein 9 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|350413268|ref|XP_003489942.1| PREDICTED: BTB/POZ domain-containing protein 9-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|380023366|ref|XP_003695494.1| PREDICTED: BTB/POZ domain-containing protein 9 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|340708503|ref|XP_003392865.1| PREDICTED: BTB/POZ domain-containing protein 9-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|291226013|ref|XP_002732994.1| PREDICTED: CG1826-like [Saccoglossus kowalevskii] | Back alignment and taxonomy information |
|---|
| >gi|357622576|gb|EHJ74003.1| hypothetical protein KGM_13514 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|190360739|ref|NP_001121970.1| BTB/POZ domain-containing protein 9 [Bos taurus] gi|218563527|sp|A4IFG2.2|BTBD9_BOVIN RecName: Full=BTB/POZ domain-containing protein 9 gi|158455144|gb|AAI34568.2| BTBD9 protein [Bos taurus] | Back alignment and taxonomy information |
|---|
| >gi|301782813|ref|XP_002926823.1| PREDICTED: BTB/POZ domain-containing protein 9-like [Ailuropoda melanoleuca] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 765 | ||||||
| UNIPROTKB|A4IFG2 | 611 | BTBD9 "BTB/POZ domain-containi | 0.475 | 0.595 | 0.580 | 9.3e-165 | |
| UNIPROTKB|Q96Q07 | 612 | BTBD9 "BTB/POZ domain-containi | 0.444 | 0.555 | 0.604 | 8.3e-164 | |
| RGD|1306975 | 612 | Btbd9 "BTB (POZ) domain contai | 0.475 | 0.594 | 0.581 | 1.7e-163 | |
| MGI|MGI:1916625 | 612 | Btbd9 "BTB (POZ) domain contai | 0.475 | 0.594 | 0.576 | 1.5e-162 | |
| UNIPROTKB|Q5ZK96 | 647 | BTBD9 "Uncharacterized protein | 0.445 | 0.527 | 0.594 | 2.9e-161 | |
| UNIPROTKB|E1C497 | 650 | BTBD9 "Uncharacterized protein | 0.445 | 0.524 | 0.589 | 6.8e-160 | |
| ZFIN|ZDB-GENE-040704-39 | 602 | btbd9 "BTB (POZ) domain contai | 0.457 | 0.581 | 0.572 | 4.8e-157 | |
| FB|FBgn0030228 | 722 | BTBD9 "BTB (POZ) domain contai | 0.453 | 0.480 | 0.556 | 5.3e-132 | |
| WB|WBGene00015463 | 581 | hpo-9 [Caenorhabditis elegans | 0.305 | 0.402 | 0.429 | 2.1e-94 | |
| UNIPROTKB|I3LAI4 | 228 | BTBD9 "Uncharacterized protein | 0.228 | 0.767 | 0.664 | 8.5e-65 |
| UNIPROTKB|A4IFG2 BTBD9 "BTB/POZ domain-containing protein 9" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Score = 1160 (413.4 bits), Expect = 9.3e-165, Sum P(2) = 9.3e-165
Identities = 217/374 (58%), Positives = 283/374 (75%)
Query: 383 NMDEILTYVRLPLISLDELLTTVRSSGIISADKILDAIELQTNDK---VQYRGYLKPEEN 439
N EI+ VRLPL+SL ELL VR SG++S D ILDAI++++ + + YRG L PEEN
Sbjct: 217 NHAEIMQAVRLPLMSLTELLNVVRPSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEEN 276
Query: 440 LATSKMGTMVMQGEMKNALLNGDVNNYDMENGYTRHTITEATSSTSCDNGILIKLGTQAI 499
+AT K G V++GE+K+ALL+GD NYD+++G++RH I + C +GI IKLG +I
Sbjct: 277 IATMKYGAQVVKGELKSALLDGDTQNYDLDHGFSRHPIDD-----DCRSGIEIKLGQPSI 331
Query: 500 VNHIKLLLWDKDLRSYSYFIEVSIDQKKWTRVIDYTRFYCRSWQFLYFPTQVVQYIRVVG 559
+NHI++LLWD+D RSYSYFIEVS+D+ W RVID++++ CRSWQ LYFP +V +YIR+VG
Sbjct: 332 INHIRILLWDRDSRSYSYFIEVSMDELDWIRVIDHSQYLCRSWQKLYFPARVCRYIRIVG 391
Query: 560 TNNTVNKVFHIVSFEIMYTAQTVQLSEEGIIIPKHNVATRELSAKVVEGVSRSLSSLIDG 619
T+NTVNK+FHIV+FE M+T +T L E+G+I+P NVAT A V+EGVSRS ++L++G
Sbjct: 392 THNTVNKIFHIVAFECMFTNKTFTL-EKGLIVPMENVATIADCASVIEGVSRSRNALLNG 450
Query: 620 NTVKYDWDSGYTCHQLGSGAILVQLGQPYMLDSMRLLLWDCDDRSYSYLVDVSINLWDWE 679
+T YDWDS YTCHQLGSGAI+VQL QPYM+ S+RLLLWDCDDRSYSY V+VS N W
Sbjct: 451 DTKNYDWDSSYTCHQLGSGAIVVQLAQPYMIGSIRLLLWDCDDRSYSYYVEVSTNQQQWT 510
Query: 680 IVADHTRDLCRSWQSISFSRRPVVFVRIIGTHNTMNEVFHCVHFECPDQ-SIKLPSAGQP 738
+VAD T+ C+SWQS++F RRP F+RI+GTHNT NEVFHCVHFECP+Q S + S+ +P
Sbjct: 511 MVADRTKVSCKSWQSVTFERRPASFIRIVGTHNTANEVFHCVHFECPEQQSAQKDSSDEP 570
Query: 739 SPSCLSVVTAQFQP 752
S Q P
Sbjct: 571 GTGGASAAGQQLDP 584
|
|
| UNIPROTKB|Q96Q07 BTBD9 "BTB/POZ domain-containing protein 9" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|1306975 Btbd9 "BTB (POZ) domain containing 9" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1916625 Btbd9 "BTB (POZ) domain containing 9" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZK96 BTBD9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C497 BTBD9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040704-39 btbd9 "BTB (POZ) domain containing 9" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0030228 BTBD9 "BTB (POZ) domain containing 9 ortholog" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00015463 hpo-9 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LAI4 BTBD9 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 765 | |||
| pfam00651 | 101 | pfam00651, BTB, BTB/POZ domain | 8e-18 | |
| pfam07707 | 101 | pfam07707, BACK, BTB And C-terminal Kelch | 3e-17 | |
| smart00225 | 97 | smart00225, BTB, Broad-Complex, Tramtrack and Bric | 3e-16 | |
| smart00875 | 101 | smart00875, BACK, BTB And C-terminal Kelch | 1e-14 | |
| smart00225 | 97 | smart00225, BTB, Broad-Complex, Tramtrack and Bric | 7e-07 | |
| PHA03098 | 534 | PHA03098, PHA03098, kelch-like protein; Provisiona | 4e-06 | |
| pfam00651 | 101 | pfam00651, BTB, BTB/POZ domain | 9e-06 | |
| PHA03098 | 534 | PHA03098, PHA03098, kelch-like protein; Provisiona | 4e-04 |
| >gnl|CDD|216043 pfam00651, BTB, BTB/POZ domain | Back alignment and domain information |
|---|
Score = 79.2 bits (196), Expect = 8e-18
Identities = 31/85 (36%), Positives = 44/85 (51%), Gaps = 4/85 (4%)
Query: 49 NLYLNDEFSDTVLIVQNEKISVHKVILAARSEYFRALLYGGLCESNQNEIELHDTNIVAF 108
L N E D L+V +++ HK +LAA S YF+AL G EI L D + F
Sbjct: 3 ELRENGELCDVTLVVGDKEFHAHKAVLAACSPYFKALFTGNKEV----EITLEDVSPEDF 58
Query: 109 KCLLKYIYSGKLSFRNLKDDVILDI 133
+ LL++IY+GKL D +L +
Sbjct: 59 EALLEFIYTGKLEITEENVDDLLAL 83
|
The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain is present near the N-terminus of a fraction of zinc finger (pfam00096) proteins and in proteins that contain the pfam01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT. The POZ or BTB domain is also known as BR-C/Ttk or ZiN. Length = 101 |
| >gnl|CDD|149006 pfam07707, BACK, BTB And C-terminal Kelch | Back alignment and domain information |
|---|
| >gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac | Back alignment and domain information |
|---|
| >gnl|CDD|197943 smart00875, BACK, BTB And C-terminal Kelch | Back alignment and domain information |
|---|
| >gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac | Back alignment and domain information |
|---|
| >gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216043 pfam00651, BTB, BTB/POZ domain | Back alignment and domain information |
|---|
| >gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 765 | |||
| KOG4350|consensus | 620 | 100.0 | ||
| KOG4441|consensus | 571 | 100.0 | ||
| KOG4350|consensus | 620 | 100.0 | ||
| PHA02713 | 557 | hypothetical protein; Provisional | 100.0 | |
| PHA03098 | 534 | kelch-like protein; Provisional | 100.0 | |
| PHA02790 | 480 | Kelch-like protein; Provisional | 100.0 | |
| PHA02713 | 557 | hypothetical protein; Provisional | 100.0 | |
| KOG4441|consensus | 571 | 99.96 | ||
| KOG2075|consensus | 521 | 99.95 | ||
| PHA03098 | 534 | kelch-like protein; Provisional | 99.94 | |
| PHA02790 | 480 | Kelch-like protein; Provisional | 99.92 | |
| KOG0783|consensus | 1267 | 99.88 | ||
| KOG4591|consensus | 280 | 99.76 | ||
| KOG4682|consensus | 488 | 99.71 | ||
| PF00651 | 111 | BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( | 99.69 | |
| smart00225 | 90 | BTB Broad-Complex, Tramtrack and Bric a brac. Doma | 99.47 | |
| PF07707 | 103 | BACK: BTB And C-terminal Kelch; InterPro: IPR01170 | 99.43 | |
| TIGR03547 | 346 | muta_rot_YjhT mutatrotase, YjhT family. Members of | 99.29 | |
| smart00875 | 101 | BACK BTB And C-terminal Kelch. The BACK domain is | 99.27 | |
| KOG2838|consensus | 401 | 99.24 | ||
| TIGR03548 | 323 | mutarot_permut cyclically-permuted mutatrotase fam | 99.17 | |
| KOG0511|consensus | 516 | 99.1 | ||
| TIGR03547 | 346 | muta_rot_YjhT mutatrotase, YjhT family. Members of | 99.08 | |
| PRK14131 | 376 | N-acetylneuraminic acid mutarotase; Provisional | 99.04 | |
| PLN02153 | 341 | epithiospecifier protein | 99.02 | |
| PLN02193 | 470 | nitrile-specifier protein | 99.01 | |
| PLN02153 | 341 | epithiospecifier protein | 98.99 | |
| KOG2075|consensus | 521 | 98.94 | ||
| PRK14131 | 376 | N-acetylneuraminic acid mutarotase; Provisional | 98.92 | |
| TIGR03548 | 323 | mutarot_permut cyclically-permuted mutatrotase fam | 98.89 | |
| PF00754 | 129 | F5_F8_type_C: F5/8 type C domain; InterPro: IPR000 | 98.85 | |
| cd00057 | 143 | FA58C Substituted updates: Jan 31, 2002 | 98.78 | |
| KOG0783|consensus | 1267 | 98.73 | ||
| PLN02193 | 470 | nitrile-specifier protein | 98.62 | |
| smart00612 | 47 | Kelch Kelch domain. | 98.02 | |
| KOG4693|consensus | 392 | 98.02 | ||
| KOG4682|consensus | 488 | 98.01 | ||
| PF01344 | 47 | Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is | 97.79 | |
| smart00231 | 139 | FA58C Coagulation factor 5/8 C-terminal domain, di | 97.7 | |
| KOG2716|consensus | 230 | 97.65 | ||
| KOG0379|consensus | 482 | 97.63 | ||
| PF13964 | 50 | Kelch_6: Kelch motif | 97.62 | |
| PF00651 | 111 | BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( | 97.58 | |
| PF13964 | 50 | Kelch_6: Kelch motif | 97.57 | |
| smart00607 | 151 | FTP eel-Fucolectin Tachylectin-4 Pentaxrin-1 Domai | 97.45 | |
| PF13415 | 49 | Kelch_3: Galactose oxidase, central domain | 97.3 | |
| KOG1230|consensus | 521 | 97.29 | ||
| PF02214 | 94 | BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassi | 97.21 | |
| PF01344 | 47 | Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is | 97.1 | |
| KOG0511|consensus | 516 | 97.05 | ||
| PF07646 | 49 | Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is | 97.04 | |
| smart00225 | 90 | BTB Broad-Complex, Tramtrack and Bric a brac. Doma | 97.03 | |
| KOG2838|consensus | 401 | 96.97 | ||
| KOG0379|consensus | 482 | 96.92 | ||
| PF07707 | 103 | BACK: BTB And C-terminal Kelch; InterPro: IPR01170 | 96.78 | |
| KOG1987|consensus | 297 | 96.74 | ||
| PF11822 | 317 | DUF3342: Domain of unknown function (DUF3342); Int | 96.47 | |
| KOG1230|consensus | 521 | 96.3 | ||
| PF13418 | 49 | Kelch_4: Galactose oxidase, central domain; PDB: 2 | 96.05 | |
| smart00875 | 101 | BACK BTB And C-terminal Kelch. The BACK domain is | 95.69 | |
| cd00057 | 143 | FA58C Substituted updates: Jan 31, 2002 | 95.68 | |
| PF00754 | 129 | F5_F8_type_C: F5/8 type C domain; InterPro: IPR000 | 95.65 | |
| KOG4693|consensus | 392 | 95.54 | ||
| PF13418 | 49 | Kelch_4: Galactose oxidase, central domain; PDB: 2 | 95.33 | |
| KOG1724|consensus | 162 | 95.31 | ||
| smart00512 | 104 | Skp1 Found in Skp1 protein family. Family of Skp1 | 95.09 | |
| PF07646 | 49 | Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is | 95.03 | |
| KOG3473|consensus | 112 | 94.96 | ||
| PF13854 | 42 | Kelch_5: Kelch motif | 94.65 | |
| PLN02772 | 398 | guanylate kinase | 94.56 | |
| KOG2714|consensus | 465 | 94.43 | ||
| PF03931 | 62 | Skp1_POZ: Skp1 family, tetramerisation domain; Int | 94.37 | |
| KOG4276|consensus | 113 | 93.5 | ||
| PF13163 | 429 | DUF3999: Protein of unknown function (DUF3999) | 92.88 | |
| cd08366 | 139 | APC10 APC10 subunit of the anaphase-promoting comp | 92.16 | |
| PF07738 | 135 | Sad1_UNC: Sad1 / UNC-like C-terminal ; InterPro: I | 91.71 | |
| KOG1665|consensus | 302 | 90.97 | ||
| KOG4152|consensus | 830 | 90.15 | ||
| COG3055 | 381 | Uncharacterized protein conserved in bacteria [Fun | 87.86 | |
| smart00612 | 47 | Kelch Kelch domain. | 87.82 | |
| PF13415 | 49 | Kelch_3: Galactose oxidase, central domain | 87.69 | |
| COG5201 | 158 | SKP1 SCF ubiquitin ligase, SKP1 component [Posttra | 87.43 | |
| PF01466 | 78 | Skp1: Skp1 family, dimerisation domain; InterPro: | 86.63 | |
| smart00231 | 139 | FA58C Coagulation factor 5/8 C-terminal domain, di | 83.79 | |
| PF07250 | 243 | Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP | 82.85 | |
| PF06588 | 199 | Muskelin_N: Muskelin N-terminus; InterPro: IPR0105 | 82.07 | |
| KOG1778|consensus | 319 | 81.92 | ||
| KOG2716|consensus | 230 | 81.06 |
| >KOG4350|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.1e-142 Score=1085.14 Aligned_cols=549 Identities=51% Similarity=0.920 Sum_probs=523.7
Q ss_pred CCCccchHHHHHHHHHHHHcCCCCccEEEEECCEEEEeehhHHHhcCHHHHHHhcCCccCCCCeeEEecCCCHHHHHHHH
Q psy12546 33 HSYEIEHVQFLSEMIGNLYLNDEFSDTVLIVQNEKISVHKVILAARSEYFRALLYGGLCESNQNEIELHDTNIVAFKCLL 112 (765)
Q Consensus 33 ~~~~~~~~~~l~~~l~~l~~~~~~sDv~~~v~~~~~~aHr~ILaarS~yF~~lf~~~~~es~~~~I~l~~v~~~~f~~lL 112 (765)
.....+....|++++..++.+++++||+|+|++++|||||.|||+||.|||+|++|||.|+.+..|.|++...++|
T Consensus 21 ~t~~~~i~~~fS~~~~~l~~~e~y~DVtfvve~~rfpAHRvILAaRs~yFRAlLYgGm~Es~q~~ipLq~t~~eAF---- 96 (620)
T KOG4350|consen 21 RTESAAISNNFSQSFDELFTSEDYSDVTFVVEDTRFPAHRVILAARSSYFRALLYGGMQESHQQLIPLQETNSEAF---- 96 (620)
T ss_pred hhhhhhhccchhHHHHHHhhcCcccceEEEEeccccchhhhhHHHHHHHHHHHHhhhhhhhhhcccccccccHHHH----
Confidence 3455667778899999999999999999999999999999999999999999999999999988999988888888
Q ss_pred HHHhcCCccccCcchhHHHHHhhhccCCCCcchHhHHHhhhcCcccCCccccccccccHHHHHHHHHhHhcCceecccCC
Q psy12546 113 KYIYSGKLSFRNLKDDVILDILGKKQNKGTTLTQNFRALLYGGLCESNQNEIELHDTNIVAFKCLLKYIYSGKLSFRNLK 192 (765)
Q Consensus 113 ~ylYtg~l~~~~~~~~~ll~i~~~~~~~~~~~S~yF~amf~~~~~Es~~~~i~l~~v~~~~f~~lL~yiYtg~i~l~~~~ 192 (765)
+.+|+|||||++.+++++
T Consensus 97 --------------------------------------------------------------~~lLrYiYtg~~~l~~~~ 114 (620)
T KOG4350|consen 97 --------------------------------------------------------------RALLRYIYTGKIDLAGVE 114 (620)
T ss_pred --------------------------------------------------------------HHHHHHHhhcceecccch
Confidence 666666666667776778
Q ss_pred hhHHHHHHHHHhhhCcHHHHHHHHHHHHhhcChhhHHHHHHHHHHcCcHHHHHHHHHHHhcccccccCccccccCCHHHH
Q psy12546 193 DDVILDILGLSHKYGFQDLENSISDYLRVILTVHNACSIFDCAYYYDLKQLNKIVLSFIDYNAKQIISENSFYNLSQNGL 272 (765)
Q Consensus 193 ~~~vl~ll~~A~~~~l~~L~~~c~~~L~~~l~~~nv~~il~~A~~~~~~~L~~~c~~fi~~n~~~v~~~~~f~~L~~~~l 272 (765)
++.++++|.+|++|++.+|+.++.+||+..|..+|+|.++.+|..|++++|...|+.|+.+|+.+++..+.|..|+.+.|
T Consensus 115 ed~lld~LslAh~Ygf~~Le~aiSeYl~~iL~~~NvCmifdaA~ly~l~~Lt~~C~mfmDrnA~~lL~~~sFn~LSk~sL 194 (620)
T KOG4350|consen 115 EDILLDYLSLAHRYGFIQLETAISEYLKEILKNENVCMIFDAAYLYQLTDLTDYCMMFMDRNADQLLEDPSFNRLSKDSL 194 (620)
T ss_pred HHHHHHHHHHHHhcCcHHHHHHHHHHHHHHHcccceeeeeeHHHHhcchHHHHHHHHHHhcCHHhhhcCcchhhhhHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHhccCCCCCCHHHHHHHHHHHHhhCCCcccccCCcccCCCCchhhhhccccCCCCCHHHHHHhcccCCCCChhHHHHH
Q psy12546 273 IQLIQRDSFYAPEIDIFRAVVDWIKANSPEVEEDGESSFRAPINMDEILTYVRLPLISLDELLTTVRSSGIISADKILDA 352 (765)
Q Consensus 273 ~~ll~~d~l~v~E~~l~~av~~Wi~~n~~~~~~~~~~~~~~~~~~~~ll~~VR~~lls~~~L~~~v~~~~l~~~~~i~~a 352 (765)
.+++.+|.|.++|.+||.|+.+|.++|..+ ..+.+++.||+|+|+..+|+++|++++|++++.|++|
T Consensus 195 ~e~l~RDsFfApE~~IFlAv~~W~~~Nske-------------~~k~~~~~VRLPLm~lteLLnvVRPsGllspD~iLDA 261 (620)
T KOG4350|consen 195 KELLARDSFFAPELKIFLAVRSWHQNNSKE-------------ASKVLLELVRLPLMTLTELLNVVRPSGLLSPDTILDA 261 (620)
T ss_pred HHHHhhhcccchHHHHHHHHHHHHhcCchh-------------hHHHHHHHHhhhhccHHHHHhccCcccCcCHHHHHHH
Confidence 999999999999999999999999999532 6789999999999999999999999999999999999
Q ss_pred HHhhcccccccccCCCcccccCCcccccccccccccceecccccCccceeeeeeccccccchhhHhHhhhccccCcCCCc
Q psy12546 353 IELQTNDKVQYRANSPEVEEDGESSFRAPINMDEILTYVRLPLISLDELLTTVRSSGIISADKILDAIELQTNDKVQYRG 432 (765)
Q Consensus 353 i~~~~~~~~~f~~~~~~~~~~~~~~~R~~~~~~~ll~~VRlpli~~~~l~~~v~~~~l~~~~~l~ea~~~~~~~~l~~~~ 432 (765)
|..+.+.+ +.+|+|+
T Consensus 262 I~vrs~s~-----------------------------------------------------------------~~lpyRg 276 (620)
T KOG4350|consen 262 IEVRSQSP-----------------------------------------------------------------HELPYRG 276 (620)
T ss_pred HHhhccCc-----------------------------------------------------------------ccCCccc
Confidence 98554321 5799999
Q ss_pred cCCCCccccccCCcEEEEeeccCCccCCCCeeeecCCCCeeeecccccCCCCCCCccEEEEcCeeEEEcceeeeeecCCC
Q psy12546 433 YLKPEENLATSKMGTMVMQGEMKNALLNGDVNNYDMENGYTRHTITEATSSTSCDNGILIKLGTQAIVNHIKLLLWDKDL 512 (765)
Q Consensus 433 ~~~~~~~~a~~~~~~~viGG~~~~~~l~~~v~~YD~~~~~W~~~~~~~m~~~R~~~~vvvl~g~iYiiGG~~~~~~~~~~ 512 (765)
++.|+.|+++...++.++.|+.++++++|++..||...|+.+|.+.+ -+..|+.+..|+.++|+.|++++||+|+
T Consensus 277 ~l~peeNia~~~~~aq~~~ge~r~alldgd~~~ydl~~gysRh~i~D-----~~~sgi~i~LG~p~iINhIrmllWdrds 351 (620)
T KOG4350|consen 277 CLSPEENIAPHYPHAQPLSGECRDALLDGDVTTYDLSNGYSRHCIND-----ENISGIQIDLGKPFIINHIRMLLWDRDS 351 (620)
T ss_pred ccCchhcccccccccccccchhhhhhccCCcceeecccCccccccCc-----ccceeEEEecCCchhhhhhhhhhhcccc
Confidence 99999999999999999999999999999999999999999998874 5778999999999999999999999999
Q ss_pred ceeeEEEEEEecCCCeEEEecccccccCceEEEEeecccEEEEEEEeecCCcceeEEEEEEEEEeecccccccCCccccc
Q psy12546 513 RSYSYFIEVSIDQKKWTRVIDYTRFYCRSWQFLYFPTQVVQYIRVVGTNNTVNKVFHIVSFEIMYTAQTVQLSEEGIIIP 592 (765)
Q Consensus 513 ~~y~y~v~vs~~~~~W~~v~~~~~~~~~~~~~~~f~~~~~ryI~ivg~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~p 592 (765)
++|+|+||||+|+.+|.+|+|++.|.||+||.+||++|+|||||+||++|++|..||.+.+|||+++++++++ .++++|
T Consensus 352 raysY~veVSmD~~hW~rV~DyS~Y~CRswQ~LyF~arvvR~Irlvgt~Ntvn~~fh~v~~EaMft~kt~~le-~~~ivP 430 (620)
T KOG4350|consen 352 RAYSYQVEVSMDDAHWNRVADYSEYDCRSWQRLYFTARVVRHIRLVGTNNTVNCKFHGVRIEAMFTTKTMPLE-HKVIVP 430 (620)
T ss_pred cceEEEEEEecchhhhHHhhhhhhhccccceeeeeecceeEEEEEEeeccceeeEEEEEEEEEEecccccccc-ceeecc
Confidence 9999999999999999999999999999999999999999999999999999999999999999999999999 999999
Q ss_pred CCcccccccceeEeecccccccccccCCcccccCCCCCcccccCCccEEEecCCceeeccEEEEeeecCCCeeeEEEEEE
Q psy12546 593 KHNVATRELSAKVVEGVSRSLSSLIDGNTVKYDWDSGYTCHQLGSGAILVQLGQPYMLDSMRLLLWDCDDRSYSYLVDVS 672 (765)
Q Consensus 593 ~~nva~~~~~~~~~~g~~~~~~~~~~gd~~~~~w~~g~~~~~~~~~~i~v~l~~~y~i~~~~~~~w~~~~~~y~y~i~vs 672 (765)
..||||++++|.|++|+||+||||||||..+||||+||||||+|+|.|+|||||||+||+|||||||||+|+||||||||
T Consensus 431 ~~NvaTie~~A~V~eGVSR~RNALiNGD~~~YDWDsGYTCHQlGSG~IvvqLaQPY~igSmRlLLWdCDDR~YSyYvevS 510 (620)
T KOG4350|consen 431 HRNVATIENHARVVEGVSRCRNALINGDSSSYDWDSGYTCHQLGSGLIVVQLAQPYIIGSMRLLLWDCDDRFYSYYVEVS 510 (620)
T ss_pred ccchhhhhhhhHhhhhhhhhhhhhccCCcccccCcCCcchhhcCCceEEEEecCceeeeeeeEEEEecCCCceeEEEEEE
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ecCCcceeeeeccCccccceEEEEeecCCEEEEEEEeccCCcceeEEEEeeeecCCCCC
Q psy12546 673 INLWDWEIVADHTRDLCRSWQSISFSRRPVVFVRIIGTHNTMNEVFHCVHFECPDQSIK 731 (765)
Q Consensus 673 ~d~~~w~~v~~~~~~~~~~~~~~~f~~~~~~~ir~~~~~~~~~~~~~~~~~e~~~~~~~ 731 (765)
+|++.|++|+|+++..|+|||+++|+|+||+|||||||+|++|++|||||||||+|++.
T Consensus 511 tNq~eW~mvvDRtn~~c~sWQ~~~F~p~PvvyIRiVGTrNtaNEvFHcVHlEcP~q~~~ 569 (620)
T KOG4350|consen 511 TNQDEWVMVVDRTNEECHSWQELIFDPLPVVYIRIVGTRNTANEVFHCVHLECPSQVPI 569 (620)
T ss_pred eCchheEEeeecccccccchhheeecCCceEEEEEEeccccccceeEEEEeecCccChh
Confidence 99999999999999999999999999999999999999999999999999999999854
|
|
| >KOG4441|consensus | Back alignment and domain information |
|---|
| >KOG4350|consensus | Back alignment and domain information |
|---|
| >PHA02713 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA03098 kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02790 Kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02713 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4441|consensus | Back alignment and domain information |
|---|
| >KOG2075|consensus | Back alignment and domain information |
|---|
| >PHA03098 kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02790 Kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0783|consensus | Back alignment and domain information |
|---|
| >KOG4591|consensus | Back alignment and domain information |
|---|
| >KOG4682|consensus | Back alignment and domain information |
|---|
| >PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins | Back alignment and domain information |
|---|
| >smart00225 BTB Broad-Complex, Tramtrack and Bric a brac | Back alignment and domain information |
|---|
| >PF07707 BACK: BTB And C-terminal Kelch; InterPro: IPR011705 This domain is found associated with (IPR000210 from INTERPRO) and (IPR006652 from INTERPRO) | Back alignment and domain information |
|---|
| >TIGR03547 muta_rot_YjhT mutatrotase, YjhT family | Back alignment and domain information |
|---|
| >smart00875 BACK BTB And C-terminal Kelch | Back alignment and domain information |
|---|
| >KOG2838|consensus | Back alignment and domain information |
|---|
| >TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein | Back alignment and domain information |
|---|
| >KOG0511|consensus | Back alignment and domain information |
|---|
| >TIGR03547 muta_rot_YjhT mutatrotase, YjhT family | Back alignment and domain information |
|---|
| >PRK14131 N-acetylneuraminic acid mutarotase; Provisional | Back alignment and domain information |
|---|
| >PLN02153 epithiospecifier protein | Back alignment and domain information |
|---|
| >PLN02193 nitrile-specifier protein | Back alignment and domain information |
|---|
| >PLN02153 epithiospecifier protein | Back alignment and domain information |
|---|
| >KOG2075|consensus | Back alignment and domain information |
|---|
| >PRK14131 N-acetylneuraminic acid mutarotase; Provisional | Back alignment and domain information |
|---|
| >TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein | Back alignment and domain information |
|---|
| >PF00754 F5_F8_type_C: F5/8 type C domain; InterPro: IPR000421 Blood coagulation factors V and VIII contain a C-terminal, twice repeated, domain of about 150 amino acids, which is called F5/8 type C, FA58C, or C1/C2- like domain | Back alignment and domain information |
|---|
| >cd00057 FA58C Substituted updates: Jan 31, 2002 | Back alignment and domain information |
|---|
| >KOG0783|consensus | Back alignment and domain information |
|---|
| >PLN02193 nitrile-specifier protein | Back alignment and domain information |
|---|
| >smart00612 Kelch Kelch domain | Back alignment and domain information |
|---|
| >KOG4693|consensus | Back alignment and domain information |
|---|
| >KOG4682|consensus | Back alignment and domain information |
|---|
| >PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] | Back alignment and domain information |
|---|
| >smart00231 FA58C Coagulation factor 5/8 C-terminal domain, discoidin domain | Back alignment and domain information |
|---|
| >KOG2716|consensus | Back alignment and domain information |
|---|
| >KOG0379|consensus | Back alignment and domain information |
|---|
| >PF13964 Kelch_6: Kelch motif | Back alignment and domain information |
|---|
| >PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins | Back alignment and domain information |
|---|
| >PF13964 Kelch_6: Kelch motif | Back alignment and domain information |
|---|
| >smart00607 FTP eel-Fucolectin Tachylectin-4 Pentaxrin-1 Domain | Back alignment and domain information |
|---|
| >PF13415 Kelch_3: Galactose oxidase, central domain | Back alignment and domain information |
|---|
| >KOG1230|consensus | Back alignment and domain information |
|---|
| >PF02214 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ] | Back alignment and domain information |
|---|
| >PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] | Back alignment and domain information |
|---|
| >KOG0511|consensus | Back alignment and domain information |
|---|
| >PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] | Back alignment and domain information |
|---|
| >smart00225 BTB Broad-Complex, Tramtrack and Bric a brac | Back alignment and domain information |
|---|
| >KOG2838|consensus | Back alignment and domain information |
|---|
| >KOG0379|consensus | Back alignment and domain information |
|---|
| >PF07707 BACK: BTB And C-terminal Kelch; InterPro: IPR011705 This domain is found associated with (IPR000210 from INTERPRO) and (IPR006652 from INTERPRO) | Back alignment and domain information |
|---|
| >KOG1987|consensus | Back alignment and domain information |
|---|
| >PF11822 DUF3342: Domain of unknown function (DUF3342); InterPro: IPR021777 This family of proteins are functionally uncharacterised | Back alignment and domain information |
|---|
| >KOG1230|consensus | Back alignment and domain information |
|---|
| >PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B | Back alignment and domain information |
|---|
| >smart00875 BACK BTB And C-terminal Kelch | Back alignment and domain information |
|---|
| >cd00057 FA58C Substituted updates: Jan 31, 2002 | Back alignment and domain information |
|---|
| >PF00754 F5_F8_type_C: F5/8 type C domain; InterPro: IPR000421 Blood coagulation factors V and VIII contain a C-terminal, twice repeated, domain of about 150 amino acids, which is called F5/8 type C, FA58C, or C1/C2- like domain | Back alignment and domain information |
|---|
| >KOG4693|consensus | Back alignment and domain information |
|---|
| >PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B | Back alignment and domain information |
|---|
| >KOG1724|consensus | Back alignment and domain information |
|---|
| >smart00512 Skp1 Found in Skp1 protein family | Back alignment and domain information |
|---|
| >PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] | Back alignment and domain information |
|---|
| >KOG3473|consensus | Back alignment and domain information |
|---|
| >PF13854 Kelch_5: Kelch motif | Back alignment and domain information |
|---|
| >PLN02772 guanylate kinase | Back alignment and domain information |
|---|
| >KOG2714|consensus | Back alignment and domain information |
|---|
| >PF03931 Skp1_POZ: Skp1 family, tetramerisation domain; InterPro: IPR016073 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] | Back alignment and domain information |
|---|
| >KOG4276|consensus | Back alignment and domain information |
|---|
| >PF13163 DUF3999: Protein of unknown function (DUF3999) | Back alignment and domain information |
|---|
| >cd08366 APC10 APC10 subunit of the anaphase-promoting complex (APC) that mediates substrate ubiquitination | Back alignment and domain information |
|---|
| >PF07738 Sad1_UNC: Sad1 / UNC-like C-terminal ; InterPro: IPR012919 The Caenorhabditis elegans UNC-84 protein is a nuclear envelope protein that is involved in nuclear anchoring and migration during development | Back alignment and domain information |
|---|
| >KOG1665|consensus | Back alignment and domain information |
|---|
| >KOG4152|consensus | Back alignment and domain information |
|---|
| >COG3055 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >smart00612 Kelch Kelch domain | Back alignment and domain information |
|---|
| >PF13415 Kelch_3: Galactose oxidase, central domain | Back alignment and domain information |
|---|
| >COG5201 SKP1 SCF ubiquitin ligase, SKP1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF01466 Skp1: Skp1 family, dimerisation domain; InterPro: IPR016072 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] | Back alignment and domain information |
|---|
| >smart00231 FA58C Coagulation factor 5/8 C-terminal domain, discoidin domain | Back alignment and domain information |
|---|
| >PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes | Back alignment and domain information |
|---|
| >PF06588 Muskelin_N: Muskelin N-terminus; InterPro: IPR010565 This entry represents the N-terminal region of muskelin and is found in conjunction with several IPR006652 from INTERPRO repeats | Back alignment and domain information |
|---|
| >KOG1778|consensus | Back alignment and domain information |
|---|
| >KOG2716|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 765 | ||||
| 3hqi_A | 312 | Structures Of Spop-Substrate Complexes: Insights In | 8e-10 | ||
| 3hqi_A | 312 | Structures Of Spop-Substrate Complexes: Insights In | 7e-07 | ||
| 4eoz_A | 145 | Crystal Structure Of The Spop Btb Domain Complexed | 1e-09 | ||
| 4eoz_A | 145 | Crystal Structure Of The Spop Btb Domain Complexed | 4e-04 | ||
| 3htm_A | 172 | Structures Of Spop-Substrate Complexes: Insights In | 1e-07 | ||
| 3hve_A | 256 | Structures Of Spop-Substrate Complexes: Insights In | 3e-05 | ||
| 2ppi_A | 144 | Structure Of The Btb (Tramtrack And Bric A Brac) Do | 6e-04 |
| >pdb|3HQI|A Chain A, Structures Of Spop-Substrate Complexes: Insights Into Molecular Architectures Of Btb-Cul3 Ubiquitin Ligases: SpopmathxBTB3-Box-Pucsbc1 Length = 312 | Back alignment and structure |
|
| >pdb|3HQI|A Chain A, Structures Of Spop-Substrate Complexes: Insights Into Molecular Architectures Of Btb-Cul3 Ubiquitin Ligases: SpopmathxBTB3-Box-Pucsbc1 Length = 312 | Back alignment and structure |
| >pdb|4EOZ|A Chain A, Crystal Structure Of The Spop Btb Domain Complexed With The Cul3 N- Terminal Domain Length = 145 | Back alignment and structure |
| >pdb|4EOZ|A Chain A, Crystal Structure Of The Spop Btb Domain Complexed With The Cul3 N- Terminal Domain Length = 145 | Back alignment and structure |
| >pdb|3HTM|A Chain A, Structures Of Spop-Substrate Complexes: Insights Into Molecular Architectures Of Btb-Cul3 Ubiquitin Ligases: Spopbtb3-Box Length = 172 | Back alignment and structure |
| >pdb|3HVE|A Chain A, Structures Of Spop-Substrate Complexes: Insights Into Molecular Architectures Of Btb-Cul3 Ubiquitin Ligases: Gigaxoninbtb3-Box Length = 256 | Back alignment and structure |
| >pdb|2PPI|A Chain A, Structure Of The Btb (Tramtrack And Bric A Brac) Domain Of Human Gigaxonin Length = 144 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 765 | |||
| 3i3n_A | 279 | Kelch-like protein 11; structural genomics, BTB, K | 3e-27 | |
| 3i3n_A | 279 | Kelch-like protein 11; structural genomics, BTB, K | 1e-16 | |
| 3hve_A | 256 | Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis | 5e-26 | |
| 3hve_A | 256 | Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis | 5e-18 | |
| 3htm_A | 172 | Speckle-type POZ protein; BTB, SPOP, ubiquitin, li | 6e-26 | |
| 3htm_A | 172 | Speckle-type POZ protein; BTB, SPOP, ubiquitin, li | 1e-23 | |
| 4eoz_A | 145 | Speckle-type POZ protein; E3 ubiquitin ligase, nuc | 2e-25 | |
| 4eoz_A | 145 | Speckle-type POZ protein; E3 ubiquitin ligase, nuc | 3e-17 | |
| 2vkp_A | 109 | BTB/POZ domain-containing protein 6; protein-bindi | 1e-22 | |
| 2vkp_A | 109 | BTB/POZ domain-containing protein 6; protein-bindi | 2e-13 | |
| 2if5_A | 120 | Zinc finger and BTB domain-containing protein 7A; | 2e-21 | |
| 2if5_A | 120 | Zinc finger and BTB domain-containing protein 7A; | 2e-09 | |
| 3hqi_A | 312 | Speckle-type POZ protein; SPOP, ubiquitin, puckere | 2e-21 | |
| 3hqi_A | 312 | Speckle-type POZ protein; SPOP, ubiquitin, puckere | 4e-21 | |
| 1r29_A | 127 | B-cell lymphoma 6 protein; BTB domain, transcripti | 1e-20 | |
| 1r29_A | 127 | B-cell lymphoma 6 protein; BTB domain, transcripti | 6e-08 | |
| 2ppi_A | 144 | Gigaxonin; BTB domain, protein degradation, struct | 1e-19 | |
| 2ppi_A | 144 | Gigaxonin; BTB domain, protein degradation, struct | 2e-06 | |
| 2z8h_A | 138 | Transcription regulator protein BACH1; BTB, POZ, d | 7e-18 | |
| 2z8h_A | 138 | Transcription regulator protein BACH1; BTB, POZ, d | 4e-06 | |
| 3ohu_A | 125 | Transcription regulator protein BACH2; BTB/POZ dom | 1e-17 | |
| 3ohu_A | 125 | Transcription regulator protein BACH2; BTB/POZ dom | 4e-06 | |
| 2ihc_A | 124 | Transcription regulator protein BACH1; BRIC-A-BRAC | 1e-17 | |
| 2ihc_A | 124 | Transcription regulator protein BACH1; BRIC-A-BRAC | 2e-06 | |
| 2vpk_A | 116 | Myoneurin; transcription regulation, transcription | 2e-17 | |
| 2vpk_A | 116 | Myoneurin; transcription regulation, transcription | 6e-06 | |
| 3b84_A | 119 | Zinc finger and BTB domain-containing protein 48; | 6e-17 | |
| 3b84_A | 119 | Zinc finger and BTB domain-containing protein 48; | 1e-05 | |
| 3fkc_A | 116 | Transcriptional regulator kaiso; zinc finger and B | 6e-17 | |
| 3fkc_A | 116 | Transcriptional regulator kaiso; zinc finger and B | 3e-05 | |
| 2yy9_A | 135 | Zinc finger and BTB domain-containing protein 48; | 6e-17 | |
| 2yy9_A | 135 | Zinc finger and BTB domain-containing protein 48; | 7e-06 | |
| 1buo_A | 121 | POZ domain, protein (promyelocytic leukemia zinc f | 7e-17 | |
| 1buo_A | 121 | POZ domain, protein (promyelocytic leukemia zinc f | 8e-06 | |
| 2q81_A | 119 | MIZ-1 protein; BTB/POZ domain, transcription; HET: | 4e-16 | |
| 2q81_A | 119 | MIZ-1 protein; BTB/POZ domain, transcription; HET: | 3e-04 | |
| 3ga1_A | 129 | Nucleus accumbens-associated protein 1; BTB/POZ do | 3e-14 | |
| 2jda_A | 145 | Yecbm32; hypothetical protein, carbohydrate- bindi | 2e-13 | |
| 2jda_A | 145 | Yecbm32; hypothetical protein, carbohydrate- bindi | 8e-09 | |
| 3m5b_A | 119 | Zinc finger and BTB domain-containing protein 32; | 2e-13 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-05 | |
| 4a3z_A | 161 | GH89_CBM32, alpha-N-acetylglucosaminidase family p | 2e-08 | |
| 4a4a_A | 914 | Alpha-N-acetylglucosaminidase family protein; hydr | 1e-07 | |
| 4a4a_A | 914 | Alpha-N-acetylglucosaminidase family protein; hydr | 8e-04 | |
| 4a41_A | 161 | GH89_CBM32-5, alpha-N-acetylglucosaminidase family | 2e-07 | |
| 4a41_A | 161 | GH89_CBM32-5, alpha-N-acetylglucosaminidase family | 1e-05 | |
| 4a42_A | 149 | GH89_CBM32-4, alpha-N-acetylglucosaminidase family | 7e-07 | |
| 2eqx_A | 105 | Kelch repeat and BTB domain-containing protein 4; | 1e-06 | |
| 2j1a_A | 150 | Hyaluronidase, CBM32; protein-carbohydrate interac | 3e-06 | |
| 2j1a_A | 150 | Hyaluronidase, CBM32; protein-carbohydrate interac | 1e-05 | |
| 3f2z_A | 159 | Uncharacterized protein BF3579; the present C-term | 4e-06 | |
| 3f2z_A | 159 | Uncharacterized protein BF3579; the present C-term | 2e-04 | |
| 3ggl_A | 169 | Putative chitobiase; X-RAY, structure genomics, NE | 1e-05 | |
| 3ggl_A | 169 | Putative chitobiase; X-RAY, structure genomics, NE | 3e-05 | |
| 2zxq_A | 1376 | Endo-alpha-N-acetylgalactosaminidase; broken TIM b | 1e-04 | |
| 2w1s_A | 192 | Hyaluronoglucosaminidase; hexosaminidase, family 3 | 1e-04 | |
| 2v5d_A | 737 | O-GLCNACASE NAGJ; family 32 carbohydrate binding m | 2e-04 |
| >3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} Length = 279 | Back alignment and structure |
|---|
Score = 111 bits (279), Expect = 3e-27
Identities = 40/207 (19%), Positives = 85/207 (41%), Gaps = 20/207 (9%)
Query: 148 FRALLYGGLCESNQNEIELHDTNIV------AFKCLLKYIYSGKLSFRNLKDDVILDILG 201
F LL G ES +E+ + + +++Y+Y+G++ + + ++L
Sbjct: 61 FTPLLSGQFSESRSGRVEMRKWSSEPGPEPDTVEAVIEYMYTGRI---RVSTGSVHEVLE 117
Query: 202 LSHKYGFQDLENSISDYLRVILTVHNACSIFDCAYYYDLKQLNKIVLSFIDYNAKQIISE 261
L+ ++ L+ ++L+ L + N +I A+ Y L QL I N ++I +
Sbjct: 118 LADRFLLIRLKEFCGEFLKKKLHLSNCVAIHSLAHMYTLSQLALKAADMIRRNFHKVIQD 177
Query: 262 NSFYNLSQNGLIQLIQRDSFYAP-EIDIFRAVVDWIKANSPEVEEDGESSFRAPINMDEI 320
FY L + + + E +F V+ W++ N+ E R +E+
Sbjct: 178 EEFYTLPFHLIRDWLSDLEITVDSEEVLFETVLKWVQRNAEE---------RERY-FEEL 227
Query: 321 LTYVRLPLISLDELLTTVRSSGIISAD 347
+RL + L V+ +++ +
Sbjct: 228 FKLLRLSQMKPTYLTRHVKPERLVANN 254
|
| >3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} Length = 279 | Back alignment and structure |
|---|
| >3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Length = 256 | Back alignment and structure |
|---|
| >3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Length = 256 | Back alignment and structure |
|---|
| >3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Length = 172 | Back alignment and structure |
|---|
| >3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Length = 172 | Back alignment and structure |
|---|
| >4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Length = 145 | Back alignment and structure |
|---|
| >4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Length = 145 | Back alignment and structure |
|---|
| >2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Length = 120 | Back alignment and structure |
|---|
| >2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Length = 120 | Back alignment and structure |
|---|
| >3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 | Back alignment and structure |
|---|
| >3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 | Back alignment and structure |
|---|
| >1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Length = 127 | Back alignment and structure |
|---|
| >1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Length = 127 | Back alignment and structure |
|---|
| >2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Length = 144 | Back alignment and structure |
|---|
| >2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Length = 144 | Back alignment and structure |
|---|
| >2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Length = 138 | Back alignment and structure |
|---|
| >2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Length = 138 | Back alignment and structure |
|---|
| >3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} PDB: 3ohv_A Length = 125 | Back alignment and structure |
|---|
| >3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} PDB: 3ohv_A Length = 125 | Back alignment and structure |
|---|
| >2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Length = 116 | Back alignment and structure |
|---|
| >3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Length = 116 | Back alignment and structure |
|---|
| >2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Length = 135 | Back alignment and structure |
|---|
| >2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Length = 135 | Back alignment and structure |
|---|
| >1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Length = 121 | Back alignment and structure |
|---|
| >1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Length = 121 | Back alignment and structure |
|---|
| >2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Length = 119 | Back alignment and structure |
|---|
| >2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Length = 119 | Back alignment and structure |
|---|
| >3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Length = 129 | Back alignment and structure |
|---|
| >2jda_A Yecbm32; hypothetical protein, carbohydrate- binding module, sugar-binding protein, pectin, plant cell WALL, galacturonic acid; 1.35A {Yersinia enterocolitica} PDB: 2jd9_A Length = 145 | Back alignment and structure |
|---|
| >2jda_A Yecbm32; hypothetical protein, carbohydrate- binding module, sugar-binding protein, pectin, plant cell WALL, galacturonic acid; 1.35A {Yersinia enterocolitica} PDB: 2jd9_A Length = 145 | Back alignment and structure |
|---|
| >3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >4a3z_A GH89_CBM32, alpha-N-acetylglucosaminidase family protein; hydrolase, family 32 carbohydrate-binding module; HET: MSE; 1.55A {Clostridium perfringens} PDB: 4a6o_A* Length = 161 | Back alignment and structure |
|---|
| >4a4a_A Alpha-N-acetylglucosaminidase family protein; hydrolase, 2 hydrolase, family 89 glycoside hydrolase, mucin carbohydrate-active enzyme; HET: NDG GAL; 1.90A {Clostridium perfringens} PDB: 2vcc_A 2vc9_A* 2vcb_A* 2vca_A Length = 914 | Back alignment and structure |
|---|
| >4a4a_A Alpha-N-acetylglucosaminidase family protein; hydrolase, 2 hydrolase, family 89 glycoside hydrolase, mucin carbohydrate-active enzyme; HET: NDG GAL; 1.90A {Clostridium perfringens} PDB: 2vcc_A 2vc9_A* 2vcb_A* 2vca_A Length = 914 | Back alignment and structure |
|---|
| >4a41_A GH89_CBM32-5, alpha-N-acetylglucosaminidase family protein; hydrolase, family 89 glycoside hydrolase, family 32 carbohyd binding module; HET: GAL; 1.55A {Clostridium perfringens} PDB: 4a44_A* 4a45_A* 4aax_A* Length = 161 | Back alignment and structure |
|---|
| >4a41_A GH89_CBM32-5, alpha-N-acetylglucosaminidase family protein; hydrolase, family 89 glycoside hydrolase, family 32 carbohyd binding module; HET: GAL; 1.55A {Clostridium perfringens} PDB: 4a44_A* 4a45_A* 4aax_A* Length = 161 | Back alignment and structure |
|---|
| >4a42_A GH89_CBM32-4, alpha-N-acetylglucosaminidase family protein; hydrolase, family 89 glycoside hydrolase, family 32 carbohyd binding module; HET: MSE; 1.55A {Clostridium perfringens} Length = 149 | Back alignment and structure |
|---|
| >2eqx_A Kelch repeat and BTB domain-containing protein 4; BACK domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >2j1a_A Hyaluronidase, CBM32; protein-carbohydrate interaction, glycoside hydrolase, GH84C, hydrolase; HET: GAL; 1.49A {Clostridium perfringens} PDB: 2j1e_A* 2j7m_A* Length = 150 | Back alignment and structure |
|---|
| >2j1a_A Hyaluronidase, CBM32; protein-carbohydrate interaction, glycoside hydrolase, GH84C, hydrolase; HET: GAL; 1.49A {Clostridium perfringens} PDB: 2j1e_A* 2j7m_A* Length = 150 | Back alignment and structure |
|---|
| >3f2z_A Uncharacterized protein BF3579; the present C-terminal domain is predominantly composed of B strands., structural genomics, PSI-2; 1.30A {Bacteroides fragilis} PDB: 2kd7_A Length = 159 | Back alignment and structure |
|---|
| >3f2z_A Uncharacterized protein BF3579; the present C-terminal domain is predominantly composed of B strands., structural genomics, PSI-2; 1.30A {Bacteroides fragilis} PDB: 2kd7_A Length = 159 | Back alignment and structure |
|---|
| >3ggl_A Putative chitobiase; X-RAY, structure genomics, NESG, BTR324A, Q8A9F0_bactn, BT_0865, PSI-2, protein structure initiative; 3.00A {Bacteroides thetaiotaomicron} Length = 169 | Back alignment and structure |
|---|
| >3ggl_A Putative chitobiase; X-RAY, structure genomics, NESG, BTR324A, Q8A9F0_bactn, BT_0865, PSI-2, protein structure initiative; 3.00A {Bacteroides thetaiotaomicron} Length = 169 | Back alignment and structure |
|---|
| >2zxq_A Endo-alpha-N-acetylgalactosaminidase; broken TIM barrel, glycosidase, hydrolase; 2.00A {Bifidobacterium longum} Length = 1376 | Back alignment and structure |
|---|
| >2w1s_A Hyaluronoglucosaminidase; hexosaminidase, family 32 carbohydrate binding module, toxin, secreted, virulence, hydrolase, glycosidase; HET: MSE BTB; 1.45A {Clostridium perfringens} PDB: 2w1q_A* 2w1u_A* 2wdb_A* Length = 192 | Back alignment and structure |
|---|
| >2v5d_A O-GLCNACASE NAGJ; family 32 carbohydrate binding module, glycosidase, GH84, GH84C, CBM32, hydrolase, coiled coil; 3.30A {Clostridium perfringens} Length = 737 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 765 | |||
| 3i3n_A | 279 | Kelch-like protein 11; structural genomics, BTB, K | 100.0 | |
| 3hve_A | 256 | Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis | 100.0 | |
| 3htm_A | 172 | Speckle-type POZ protein; BTB, SPOP, ubiquitin, li | 99.94 | |
| 3hqi_A | 312 | Speckle-type POZ protein; SPOP, ubiquitin, puckere | 99.92 | |
| 4eoz_A | 145 | Speckle-type POZ protein; E3 ubiquitin ligase, nuc | 99.9 | |
| 2if5_A | 120 | Zinc finger and BTB domain-containing protein 7A; | 99.88 | |
| 1r29_A | 127 | B-cell lymphoma 6 protein; BTB domain, transcripti | 99.87 | |
| 2z8h_A | 138 | Transcription regulator protein BACH1; BTB, POZ, d | 99.87 | |
| 2ppi_A | 144 | Gigaxonin; BTB domain, protein degradation, struct | 99.87 | |
| 3b84_A | 119 | Zinc finger and BTB domain-containing protein 48; | 99.86 | |
| 1buo_A | 121 | POZ domain, protein (promyelocytic leukemia zinc f | 99.85 | |
| 2yy9_A | 135 | Zinc finger and BTB domain-containing protein 48; | 99.85 | |
| 2vpk_A | 116 | Myoneurin; transcription regulation, transcription | 99.85 | |
| 2vkp_A | 109 | BTB/POZ domain-containing protein 6; protein-bindi | 99.84 | |
| 3ohu_A | 125 | Transcription regulator protein BACH2; BTB/POZ dom | 99.84 | |
| 2q81_A | 119 | MIZ-1 protein; BTB/POZ domain, transcription; HET: | 99.83 | |
| 2ihc_A | 124 | Transcription regulator protein BACH1; BRIC-A-BRAC | 99.83 | |
| 3ga1_A | 129 | Nucleus accumbens-associated protein 1; BTB/POZ do | 99.82 | |
| 3fkc_A | 116 | Transcriptional regulator kaiso; zinc finger and B | 99.79 | |
| 3m5b_A | 119 | Zinc finger and BTB domain-containing protein 32; | 99.78 | |
| 3i3n_A | 279 | Kelch-like protein 11; structural genomics, BTB, K | 99.59 | |
| 3hve_A | 256 | Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis | 99.58 | |
| 4a3z_A | 161 | GH89_CBM32, alpha-N-acetylglucosaminidase family p | 99.53 | |
| 3cqo_A | 293 | FBP32; F-lectin, fucolectin, sugar binding protein | 99.47 | |
| 1zgk_A | 308 | Kelch-like ECH-associated protein 1; beta-propelle | 99.41 | |
| 3ii7_A | 306 | Kelch-like protein 7; protein-binding, kelch-repea | 99.39 | |
| 2eqx_A | 105 | Kelch repeat and BTB domain-containing protein 4; | 99.37 | |
| 2xn4_A | 302 | Kelch-like protein 2; structural protein, cytoskel | 99.36 | |
| 2vpj_A | 301 | Kelch-like protein 12; adaptor protein, WNT signal | 99.35 | |
| 2xn4_A | 302 | Kelch-like protein 2; structural protein, cytoskel | 99.34 | |
| 4a41_A | 161 | GH89_CBM32-5, alpha-N-acetylglucosaminidase family | 99.34 | |
| 3ii7_A | 306 | Kelch-like protein 7; protein-binding, kelch-repea | 99.34 | |
| 4asc_A | 315 | Kelch repeat and BTB domain-containing protein 5; | 99.33 | |
| 1zgk_A | 308 | Kelch-like ECH-associated protein 1; beta-propelle | 99.31 | |
| 2woz_A | 318 | Kelch repeat and BTB domain-containing protein 10; | 99.3 | |
| 4gwi_A | 153 | Lectinolysin, platelet aggregation factor SM-HPAF; | 99.29 | |
| 3f2z_A | 159 | Uncharacterized protein BF3579; the present C-term | 99.28 | |
| 4asc_A | 315 | Kelch repeat and BTB domain-containing protein 5; | 99.27 | |
| 2vpj_A | 301 | Kelch-like protein 12; adaptor protein, WNT signal | 99.27 | |
| 3lei_A | 153 | Platelet aggregation factor SM-HPAF; lectin domain | 99.27 | |
| 2zwa_A | 695 | Leucine carboxyl methyltransferase 2; HET: SAH CIT | 99.26 | |
| 2ast_A | 159 | S-phase kinase-associated protein 1A; SCF-substrat | 99.24 | |
| 4a42_A | 149 | GH89_CBM32-4, alpha-N-acetylglucosaminidase family | 99.23 | |
| 2qqi_A | 318 | Neuropilin-1; VEGF receptor, semaphorin receptor, | 99.21 | |
| 3ggl_A | 169 | Putative chitobiase; X-RAY, structure genomics, NE | 99.21 | |
| 2woz_A | 318 | Kelch repeat and BTB domain-containing protein 10; | 99.19 | |
| 2uvk_A | 357 | YJHT; unknown function, hypothetical protein, sial | 99.19 | |
| 2j1a_A | 150 | Hyaluronidase, CBM32; protein-carbohydrate interac | 99.17 | |
| 2j1v_A | 151 | Fucolectin-related protein; carbohydrate-binding p | 99.16 | |
| 2uvk_A | 357 | YJHT; unknown function, hypothetical protein, sial | 99.14 | |
| 2jda_A | 145 | Yecbm32; hypothetical protein, carbohydrate- bindi | 99.14 | |
| 2j22_A | 148 | Fucolectin-related protein; carbohydrate-binding p | 99.08 | |
| 2qqj_A | 325 | Neuropilin-2; VEGF receptor, semaphorin receptor, | 99.03 | |
| 1k12_A | 158 | Lectin; beta barrel, protein carbohydrate complex, | 99.02 | |
| 2qqm_A | 450 | Neuropilin-1; VEGF receptor, semaphorin receptor, | 98.94 | |
| 2v72_A | 143 | CBM32, EXO-alpha-sialidase; galactose, bacterial p | 98.93 | |
| 2zwa_A | 695 | Leucine carboxyl methyltransferase 2; HET: SAH CIT | 98.92 | |
| 4a4a_A | 914 | Alpha-N-acetylglucosaminidase family protein; hydr | 98.91 | |
| 3hnm_A | 172 | Putative chitobiase; PSI-2, protein structure init | 98.88 | |
| 4ajy_C | 97 | Transcription elongation factor B polypeptide 1; E | 98.84 | |
| 2qqo_A | 460 | Neuropilin-2; VEGF receptor, semaphorin receptor, | 98.83 | |
| 1fs1_B | 141 | SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le | 98.77 | |
| 1tvg_A | 153 | LOC51668 protein; cell cycle, structural genomics, | 98.76 | |
| 2qqk_A | 579 | Neuropilin-2; VEGF receptor, semaphorin receptor, | 98.76 | |
| 2v5d_A | 737 | O-GLCNACASE NAGJ; family 32 carbohydrate binding m | 98.7 | |
| 1w8o_A | 601 | Bacterial sialidase; 3D-structure, glycosidase, hy | 98.68 | |
| 1k3i_A | 656 | Galactose oxidase precursor; blade beta propeller, | 98.67 | |
| 2vkp_A | 109 | BTB/POZ domain-containing protein 6; protein-bindi | 98.62 | |
| 3cqo_A | 293 | FBP32; F-lectin, fucolectin, sugar binding protein | 98.6 | |
| 2yc2_A | 139 | IFT25, intraflagellar transport protein 25; transp | 98.59 | |
| 3htm_A | 172 | Speckle-type POZ protein; BTB, SPOP, ubiquitin, li | 98.57 | |
| 2p1m_A | 160 | SKP1-like protein 1A; F-BOX, leucine rich repeat, | 98.56 | |
| 1sdd_B | 647 | Coagulation factor V; copper-binding protein, cofa | 98.55 | |
| 1k3i_A | 656 | Galactose oxidase precursor; blade beta propeller, | 98.51 | |
| 3eyp_A | 469 | Putative alpha-L-fucosidase; structural genomics, | 98.5 | |
| 2w1s_A | 192 | Hyaluronoglucosaminidase; hexosaminidase, family 3 | 98.49 | |
| 2if5_A | 120 | Zinc finger and BTB domain-containing protein 7A; | 98.49 | |
| 4gz9_A | 577 | Neuropilin-1, A5 protein; multi-domain, cell-CELL | 98.48 | |
| 1r29_A | 127 | B-cell lymphoma 6 protein; BTB domain, transcripti | 98.44 | |
| 3hqi_A | 312 | Speckle-type POZ protein; SPOP, ubiquitin, puckere | 98.36 | |
| 3bn6_A | 158 | Lactadherin; anticoagulation, anti-coagulation, an | 98.35 | |
| 2r7e_B | 770 | Coagulation factor VIII; ceruloplasmin fold, cuppe | 98.32 | |
| 2ppi_A | 144 | Gigaxonin; BTB domain, protein degradation, struct | 98.28 | |
| 3b84_A | 119 | Zinc finger and BTB domain-containing protein 48; | 98.25 | |
| 2yy9_A | 135 | Zinc finger and BTB domain-containing protein 48; | 98.23 | |
| 2z8h_A | 138 | Transcription regulator protein BACH1; BTB, POZ, d | 98.2 | |
| 1czt_A | 160 | Protein (coagulation factor V); membrane-binding, | 98.13 | |
| 4eoz_A | 145 | Speckle-type POZ protein; E3 ubiquitin ligase, nuc | 98.13 | |
| 2vpk_A | 116 | Myoneurin; transcription regulation, transcription | 98.12 | |
| 2yfu_A | 155 | Carbohydrate binding family 6; sugar binding prote | 98.11 | |
| 2zxq_A | 1376 | Endo-alpha-N-acetylgalactosaminidase; broken TIM b | 98.07 | |
| 1buo_A | 121 | POZ domain, protein (promyelocytic leukemia zinc f | 98.06 | |
| 3v7d_A | 169 | Suppressor of kinetochore protein 1; WD 40 domain, | 98.05 | |
| 2q81_A | 119 | MIZ-1 protein; BTB/POZ domain, transcription; HET: | 98.03 | |
| 2cho_A | 716 | Glucosaminidase, hexosaminiase; O-GLCNACASE, hydro | 98.0 | |
| 2wuh_A | 178 | Discoidin domain receptor 2; receptor-peptide comp | 97.98 | |
| 3drz_A | 107 | BTB/POZ domain-containing protein KCTD5; potassium | 97.97 | |
| 1hv2_A | 99 | Elongin C, ELC1; protein-peptide complex, signalin | 97.95 | |
| 3ga1_A | 129 | Nucleus accumbens-associated protein 1; BTB/POZ do | 97.92 | |
| 2ihc_A | 124 | Transcription regulator protein BACH1; BRIC-A-BRAC | 97.88 | |
| 3ues_A | 478 | Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydr | 97.82 | |
| 3ohu_A | 125 | Transcription regulator protein BACH2; BTB/POZ dom | 97.82 | |
| 2fnj_C | 96 | Transcription elongation factor B polypeptide 1; b | 97.81 | |
| 4deq_A | 218 | Neuropilin-1, vascular endothelial growth factor; | 97.73 | |
| 4a3z_A | 161 | GH89_CBM32, alpha-N-acetylglucosaminidase family p | 97.7 | |
| 2ast_A | 159 | S-phase kinase-associated protein 1A; SCF-substrat | 97.62 | |
| 3hny_M | 159 | Coagulation factor VIII; blood clotting, acute pha | 97.53 | |
| 2qqi_A | 318 | Neuropilin-1; VEGF receptor, semaphorin receptor, | 97.43 | |
| 2vm9_A | 257 | Discoidin-2, discoidin II; DDR, lectin, aggregatio | 97.38 | |
| 3f2z_A | 159 | Uncharacterized protein BF3579; the present C-term | 97.37 | |
| 2jda_A | 145 | Yecbm32; hypothetical protein, carbohydrate- bindi | 97.36 | |
| 4a41_A | 161 | GH89_CBM32-5, alpha-N-acetylglucosaminidase family | 97.33 | |
| 2j1a_A | 150 | Hyaluronidase, CBM32; protein-carbohydrate interac | 97.22 | |
| 3ggl_A | 169 | Putative chitobiase; X-RAY, structure genomics, NE | 97.22 | |
| 3m5b_A | 119 | Zinc finger and BTB domain-containing protein 32; | 97.21 | |
| 1vcb_B | 112 | Protein (elongin C); tumor suppressor, cancer, ubi | 97.16 | |
| 1sdd_B | 647 | Coagulation factor V; copper-binding protein, cofa | 97.16 | |
| 4ag4_A | 351 | Epithelial discoidin domain-containing receptor 1; | 97.08 | |
| 2qqj_A | 325 | Neuropilin-2; VEGF receptor, semaphorin receptor, | 97.08 | |
| 3fkc_A | 116 | Transcriptional regulator kaiso; zinc finger and B | 97.02 | |
| 3drx_A | 202 | BTB/POZ domain-containing protein KCTD5; golgi, gr | 96.85 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 96.67 | |
| 2qqm_A | 450 | Neuropilin-1; VEGF receptor, semaphorin receptor, | 96.62 | |
| 2r7e_B | 770 | Coagulation factor VIII; ceruloplasmin fold, cuppe | 96.57 | |
| 4a42_A | 149 | GH89_CBM32-4, alpha-N-acetylglucosaminidase family | 96.53 | |
| 4gwi_A | 153 | Lectinolysin, platelet aggregation factor SM-HPAF; | 96.03 | |
| 4a4a_A | 914 | Alpha-N-acetylglucosaminidase family protein; hydr | 95.93 | |
| 4ajy_C | 97 | Transcription elongation factor B polypeptide 1; E | 95.78 | |
| 1fs1_B | 141 | SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le | 95.74 | |
| 2qqk_A | 579 | Neuropilin-2; VEGF receptor, semaphorin receptor, | 95.6 | |
| 2eqx_A | 105 | Kelch repeat and BTB domain-containing protein 4; | 95.46 | |
| 2wn3_A | 254 | Discoidin-1 subunit A; type-H lectin, cell adhesio | 95.33 | |
| 3lei_A | 153 | Platelet aggregation factor SM-HPAF; lectin domain | 95.29 | |
| 2j1v_A | 151 | Fucolectin-related protein; carbohydrate-binding p | 95.2 | |
| 2qqo_A | 460 | Neuropilin-2; VEGF receptor, semaphorin receptor, | 94.96 | |
| 2p1m_A | 160 | SKP1-like protein 1A; F-BOX, leucine rich repeat, | 94.71 | |
| 1w8o_A | 601 | Bacterial sialidase; 3D-structure, glycosidase, hy | 94.48 | |
| 1jhj_A | 171 | APC10; beta sandwich, jellyroll, cell cycle; 1.60A | 94.48 | |
| 2v5d_A | 737 | O-GLCNACASE NAGJ; family 32 carbohydrate binding m | 94.24 | |
| 2v72_A | 143 | CBM32, EXO-alpha-sialidase; galactose, bacterial p | 94.03 | |
| 2j22_A | 148 | Fucolectin-related protein; carbohydrate-binding p | 93.91 | |
| 3kvt_A | 115 | Potassium channel protein SHAW; tetramerization do | 93.84 | |
| 1s1g_A | 124 | Potassium voltage-gated channel subfamily D membe; | 93.78 | |
| 2w1s_A | 192 | Hyaluronoglucosaminidase; hexosaminidase, family 3 | 93.73 | |
| 3hnm_A | 172 | Putative chitobiase; PSI-2, protein structure init | 93.73 | |
| 4gz9_A | 577 | Neuropilin-1, A5 protein; multi-domain, cell-CELL | 93.52 | |
| 1k12_A | 158 | Lectin; beta barrel, protein carbohydrate complex, | 93.3 | |
| 3v7d_A | 169 | Suppressor of kinetochore protein 1; WD 40 domain, | 92.75 | |
| 1nn7_A | 105 | Potassium channel KV4.2; teteramerization domain, | 92.7 | |
| 1t1d_A | 100 | Protein (potassium channel KV1.1); potassium chann | 92.48 | |
| 3eyp_A | 469 | Putative alpha-L-fucosidase; structural genomics, | 92.17 | |
| 3bn6_A | 158 | Lactadherin; anticoagulation, anti-coagulation, an | 91.68 | |
| 2nz0_B | 140 | Potassium voltage-gated channel subfamily D membe; | 91.57 | |
| 1tvg_A | 153 | LOC51668 protein; cell cycle, structural genomics, | 91.19 | |
| 2cho_A | 716 | Glucosaminidase, hexosaminiase; O-GLCNACASE, hydro | 87.6 | |
| 1czt_A | 160 | Protein (coagulation factor V); membrane-binding, | 87.45 | |
| 3drz_A | 107 | BTB/POZ domain-containing protein KCTD5; potassium | 85.32 | |
| 2yc2_A | 139 | IFT25, intraflagellar transport protein 25; transp | 80.82 | |
| 3ues_A | 478 | Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydr | 80.74 |
| >3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A | Back alignment and structure |
|---|
Probab=100.00 E-value=4.8e-38 Score=332.49 Aligned_cols=234 Identities=22% Similarity=0.382 Sum_probs=209.3
Q ss_pred CCCccchHHHHHHHHHHHHcCCCCccEEEEEC---CEEEEeehhHHHhcCHHHHHHhcCCccCCCCeeEEec------CC
Q psy12546 33 HSYEIEHVQFLSEMIGNLYLNDEFSDTVLIVQ---NEKISVHKVILAARSEYFRALLYGGLCESNQNEIELH------DT 103 (765)
Q Consensus 33 ~~~~~~~~~~l~~~l~~l~~~~~~sDv~~~v~---~~~~~aHr~ILaarS~yF~~lf~~~~~es~~~~I~l~------~v 103 (765)
.+....|++.+.+.|+++++++.+|||+|+|| |++|+|||.|||++|+||++||.+++.|+....|.++ ++
T Consensus 9 ~~~~~~h~~~ll~~l~~l~~~~~~~Dv~l~v~~~~~~~f~~Hr~vLaa~S~yF~~mf~~~~~e~~~~~i~l~~~~~~~~v 88 (279)
T 3i3n_A 9 DFECSSHCSELSWRQNEQRRQGLFCDITLCFGGAGGREFRAHRSVLAAATEYFTPLLSGQFSESRSGRVEMRKWSSEPGP 88 (279)
T ss_dssp EEECTTHHHHHHHHHHHHHHHTTTCCEEEECC----CEEEECHHHHHHHCTTSGGGCCC--------EEECCCCSSTTCS
T ss_pred CcCCHhHHHHHHHHHHHHHhcCCCCCeEEEEcCCCCeEEehHHHHHHHcCHHHHHHhcCCCccccCCeEEeccccccCCC
Confidence 45667899999999999999999999999998 9999999999999999999999999999999999998 78
Q ss_pred CHHHHHHHHHHHhcCCccccCcchhHHHHHhhhccCCCCcchHhHHHhhhcCcccCCccccccccccHHHHHHHHHhHhc
Q psy12546 104 NIVAFKCLLKYIYSGKLSFRNLKDDVILDILGKKQNKGTTLTQNFRALLYGGLCESNQNEIELHDTNIVAFKCLLKYIYS 183 (765)
Q Consensus 104 ~~~~f~~lL~ylYtg~l~~~~~~~~~ll~i~~~~~~~~~~~S~yF~amf~~~~~Es~~~~i~l~~v~~~~f~~lL~yiYt 183 (765)
++++| +.+|+|+||
T Consensus 89 ~~~~f------------------------------------------------------------------~~ll~~~Yt 102 (279)
T 3i3n_A 89 EPDTV------------------------------------------------------------------EAVIEYMYT 102 (279)
T ss_dssp CHHHH------------------------------------------------------------------HHHHHHHHH
T ss_pred CHHHH------------------------------------------------------------------HHHHHhhCc
Confidence 88888 666666666
Q ss_pred CceecccCChhHHHHHHHHHhhhCcHHHHHHHHHHHHhhcChhhHHHHHHHHHHcCcHHHHHHHHHHHhcccccccCccc
Q psy12546 184 GKLSFRNLKDDVILDILGLSHKYGFQDLENSISDYLRVILTVHNACSIFDCAYYYDLKQLNKIVLSFIDYNAKQIISENS 263 (765)
Q Consensus 184 g~i~l~~~~~~~vl~ll~~A~~~~l~~L~~~c~~~L~~~l~~~nv~~il~~A~~~~~~~L~~~c~~fi~~n~~~v~~~~~ 263 (765)
|++.++ .+++.+++.+|++|++++|++.|+++|...++.+||+.++.+|..|++..|.+.|.+||.+||.++..+++
T Consensus 103 g~~~i~---~~~v~~ll~~A~~l~i~~L~~~c~~~L~~~l~~~n~~~i~~~A~~~~~~~L~~~~~~~i~~~f~~v~~~~~ 179 (279)
T 3i3n_A 103 GRIRVS---TGSVHEVLELADRFLLIRLKEFCGEFLKKKLHLSNCVAIHSLAHMYTLSQLALKAADMIRRNFHKVIQDEE 179 (279)
T ss_dssp SEEEEE---TTTHHHHHHHHHHTTCHHHHHHHHHHHHHHCCTTTHHHHHHHHHHTTCHHHHHHHHHHHHHTHHHHTTSSG
T ss_pred CCcccC---HHHHHHHHHHHHHHCcHHHHHHHHHHHHHcCCcchHHHHHHHHHHcCcHHHHHHHHHHHHHHHHHHhcCcC
Confidence 666653 78899999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cccCCHHHHHHHhccCCCCCC-HHHHHHHHHHHHhhCCCcccccCCcccCCCCchhhhhccccCCCCCHHHHHHhcccCC
Q psy12546 264 FYNLSQNGLIQLIQRDSFYAP-EIDIFRAVVDWIKANSPEVEEDGESSFRAPINMDEILTYVRLPLISLDELLTTVRSSG 342 (765)
Q Consensus 264 f~~L~~~~l~~ll~~d~l~v~-E~~l~~av~~Wi~~n~~~~~~~~~~~~~~~~~~~~ll~~VR~~lls~~~L~~~v~~~~ 342 (765)
|..|+.+.+..||++|.++++ |.++|+++++|++++.+.+. +++.++|++||||+|++++|.+.+++++
T Consensus 180 f~~L~~~~l~~lL~~d~L~v~sE~~vf~av~~W~~~~~~~r~----------~~~~~ll~~VRf~l~~~~~L~~~v~~~~ 249 (279)
T 3i3n_A 180 FYTLPFHLIRDWLSDLEITVDSEEVLFETVLKWVQRNAEERE----------RYFEELFKLLRLSQMKPTYLTRHVKPER 249 (279)
T ss_dssp GGGSCHHHHHHHHTCSSCCCSCHHHHHHHHHHHHHTTHHHHT----------TTHHHHHTTSCGGGSCHHHHHHTTTTSH
T ss_pred hhcCCHHHHHHHhcCcCCCCCCHHHHHHHHHHHHHcCHHHHH----------HHHHHHHHhcCCCCCCHHHHHHHhhccc
Confidence 999999999999999999996 99999999999999976665 5899999999999999999999999998
Q ss_pred CCC
Q psy12546 343 IIS 345 (765)
Q Consensus 343 l~~ 345 (765)
++.
T Consensus 250 l~~ 252 (279)
T 3i3n_A 250 LVA 252 (279)
T ss_dssp HHH
T ss_pred hhc
Confidence 874
|
| >3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B | Back alignment and structure |
|---|
| >3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A | Back alignment and structure |
|---|
| >4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A | Back alignment and structure |
|---|
| >1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A | Back alignment and structure |
|---|
| >2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} | Back alignment and structure |
|---|
| >1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A | Back alignment and structure |
|---|
| >2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} | Back alignment and structure |
|---|
| >2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} | Back alignment and structure |
|---|
| >3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A | Back alignment and structure |
|---|
| >2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A | Back alignment and structure |
|---|
| >2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} | Back alignment and structure |
|---|
| >3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A | Back alignment and structure |
|---|
| >3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 | Back alignment and structure |
|---|
| >3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A | Back alignment and structure |
|---|
| >3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B | Back alignment and structure |
|---|
| >4a3z_A GH89_CBM32, alpha-N-acetylglucosaminidase family protein; hydrolase, family 32 carbohydrate-binding module; HET: MSE; 1.55A {Clostridium perfringens} PDB: 4a6o_A* | Back alignment and structure |
|---|
| >3cqo_A FBP32; F-lectin, fucolectin, sugar binding protein; HET: FUC; 2.32A {Morone saxatilis} | Back alignment and structure |
|---|
| >1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A | Back alignment and structure |
|---|
| >3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} | Back alignment and structure |
|---|
| >2eqx_A Kelch repeat and BTB domain-containing protein 4; BACK domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >4a41_A GH89_CBM32-5, alpha-N-acetylglucosaminidase family protein; hydrolase, family 89 glycoside hydrolase, family 32 carbohyd binding module; HET: GAL; 1.55A {Clostridium perfringens} PDB: 4a44_A* 4a45_A* 4aax_A* | Back alignment and structure |
|---|
| >3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} | Back alignment and structure |
|---|
| >4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} | Back alignment and structure |
|---|
| >1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A | Back alignment and structure |
|---|
| >2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4gwi_A Lectinolysin, platelet aggregation factor SM-HPAF; cholesterol-dependent cytolysins, lewis antigens, F-type LEC glycan binding; HET: BDZ; 1.60A {Streptococcus mitis} PDB: 4gwj_A* 3lei_A* 3leg_A* 3le0_A* 3lek_A* | Back alignment and structure |
|---|
| >3f2z_A Uncharacterized protein BF3579; the present C-terminal domain is predominantly composed of B strands., structural genomics, PSI-2; 1.30A {Bacteroides fragilis} PDB: 2kd7_A | Back alignment and structure |
|---|
| >4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} | Back alignment and structure |
|---|
| >2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3lei_A Platelet aggregation factor SM-HPAF; lectin domain of lectinolysin, fucose, blood clotting, nicke; HET: FUC; 1.90A {Streptococcus mitis} PDB: 3leg_A* 3le0_A* 3lek_A* | Back alignment and structure |
|---|
| >2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* | Back alignment and structure |
|---|
| >4a42_A GH89_CBM32-4, alpha-N-acetylglucosaminidase family protein; hydrolase, family 89 glycoside hydrolase, family 32 carbohyd binding module; HET: MSE; 1.55A {Clostridium perfringens} | Back alignment and structure |
|---|
| >2qqi_A Neuropilin-1; VEGF receptor, semaphorin receptor, angiogenesis, developmen protein, differentiation, glycoprotein, heparan sulfate, ME neurogenesis; 1.80A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 PDB: 2orz_A 2orx_A 2qqn_A 3i97_A* 1kex_A | Back alignment and structure |
|---|
| >3ggl_A Putative chitobiase; X-RAY, structure genomics, NESG, BTR324A, Q8A9F0_bactn, BT_0865, PSI-2, protein structure initiative; 3.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2j1a_A Hyaluronidase, CBM32; protein-carbohydrate interaction, glycoside hydrolase, GH84C, hydrolase; HET: GAL; 1.49A {Clostridium perfringens} PDB: 2j1e_A* 2j7m_A* | Back alignment and structure |
|---|
| >2j1v_A Fucolectin-related protein; carbohydrate-binding protein, carbohydrate binding protein; HET: NAG GAL FUC; 1.45A {Streptococcus pneumoniae} PDB: 2j1r_A* 2j1t_A* 2j1u_A* 2j1s_A* | Back alignment and structure |
|---|
| >2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2jda_A Yecbm32; hypothetical protein, carbohydrate- binding module, sugar-binding protein, pectin, plant cell WALL, galacturonic acid; 1.35A {Yersinia enterocolitica} PDB: 2jd9_A | Back alignment and structure |
|---|
| >2j22_A Fucolectin-related protein; carbohydrate-binding protein, carbohydrate binding protein; 1.8A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2qqj_A Neuropilin-2; VEGF receptor, semaphorin receptor, developmental protein, differentiation, glycoprotein, membrane, neurogenesis, transmembrane; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1k12_A Lectin; beta barrel, protein carbohydrate complex, sugar binding protein; HET: FUC; 1.90A {Anguilla anguilla} SCOP: b.18.1.15 | Back alignment and structure |
|---|
| >2qqm_A Neuropilin-1; VEGF receptor, semaphorin receptor, calcium-binding domain, angiogenesis, developmental protein, differentiation; HET: NAG FUC; 2.00A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 b.23.1.1 | Back alignment and structure |
|---|
| >2v72_A CBM32, EXO-alpha-sialidase; galactose, bacterial pathogen, carbohydrate-binding module, sugar-binding protein; HET: GAL; 2.25A {Clostridium perfringens} | Back alignment and structure |
|---|
| >2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* | Back alignment and structure |
|---|
| >4a4a_A Alpha-N-acetylglucosaminidase family protein; hydrolase, 2 hydrolase, family 89 glycoside hydrolase, mucin carbohydrate-active enzyme; HET: NDG GAL; 1.90A {Clostridium perfringens} PDB: 2vcc_A 2vc9_A* 2vcb_A* 2vca_A | Back alignment and structure |
|---|
| >3hnm_A Putative chitobiase; PSI-2, protein structure initiative, northeast structural genomics consortium, NESG, BTR319D.BT_411; 3.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* | Back alignment and structure |
|---|
| >2qqo_A Neuropilin-2; VEGF receptor, semaphorin receptor, calcium-binding domain, developmental protein, differentiation, glycoprotein, membr neurogenesis; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D | Back alignment and structure |
|---|
| >1tvg_A LOC51668 protein; cell cycle, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.60A {Homo sapiens} SCOP: b.18.1.9 PDB: 1xpw_A | Back alignment and structure |
|---|
| >2qqk_A Neuropilin-2; VEGF receptor, semaphorin receptor, phage-derived antibody, developmental protein, differentiation, glycoprotein; HET: NAG; 2.75A {Homo sapiens} PDB: 2qql_A | Back alignment and structure |
|---|
| >2v5d_A O-GLCNACASE NAGJ; family 32 carbohydrate binding module, glycosidase, GH84, GH84C, CBM32, hydrolase, coiled coil; 3.30A {Clostridium perfringens} | Back alignment and structure |
|---|
| >1w8o_A Bacterial sialidase; 3D-structure, glycosidase, hydrolase, beta- propeller; HET: LBT CIT; 1.70A {Micromonospora viridifaciens} SCOP: b.1.18.2 b.18.1.1 b.68.1.1 PDB: 1w8n_A* 1eut_A 1euu_A* 1wcq_A* 2bzd_A* 2ber_A* 1eur_A 1eus_A* | Back alignment and structure |
|---|
| >1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A | Back alignment and structure |
|---|
| >2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} | Back alignment and structure |
|---|
| >3cqo_A FBP32; F-lectin, fucolectin, sugar binding protein; HET: FUC; 2.32A {Morone saxatilis} | Back alignment and structure |
|---|
| >2yc2_A IFT25, intraflagellar transport protein 25; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_A | Back alignment and structure |
|---|
| >3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* | Back alignment and structure |
|---|
| >1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 | Back alignment and structure |
|---|
| >1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A | Back alignment and structure |
|---|
| >3eyp_A Putative alpha-L-fucosidase; structural genomics, hydrolase, lipoprotein, PSI-2, protein initiative; 1.90A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2w1s_A Hyaluronoglucosaminidase; hexosaminidase, family 32 carbohydrate binding module, toxin, secreted, virulence, hydrolase, glycosidase; HET: MSE BTB; 1.45A {Clostridium perfringens} PDB: 2w1q_A* 2w1u_A* 2wdb_A* | Back alignment and structure |
|---|
| >2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A | Back alignment and structure |
|---|
| >4gz9_A Neuropilin-1, A5 protein; multi-domain, cell-CELL signaling, plexin, semaphorin, VEGF, glycosilated, transmembrane, signaling protein; HET: NAG BMA; 2.70A {Mus musculus} PDB: 4gza_H | Back alignment and structure |
|---|
| >1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A | Back alignment and structure |
|---|
| >3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A | Back alignment and structure |
|---|
| >3bn6_A Lactadherin; anticoagulation, anti-coagulation, anticoagulant, anti- coagulant, membrane binding, phosphatidyl-serine binding; 1.67A {Bos taurus} PDB: 2pqs_A | Back alignment and structure |
|---|
| >2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* | Back alignment and structure |
|---|
| >2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} | Back alignment and structure |
|---|
| >2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} | Back alignment and structure |
|---|
| >2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1czt_A Protein (coagulation factor V); membrane-binding, discoidin family, calcium- independent, blood clotting; 1.87A {Homo sapiens} SCOP: b.18.1.2 PDB: 1czs_A 1czv_A | Back alignment and structure |
|---|
| >4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2yfu_A Carbohydrate binding family 6; sugar binding protein; 1.65A {Clostridium thermocellum} PDB: 2y8j_A* 2y9i_A* 2y9s_A 2yb7_A* 2y8m_A 2yfz_A* 2yg0_A* | Back alignment and structure |
|---|
| >2zxq_A Endo-alpha-N-acetylgalactosaminidase; broken TIM barrel, glycosidase, hydrolase; 2.00A {Bifidobacterium longum} | Back alignment and structure |
|---|
| >1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A | Back alignment and structure |
|---|
| >3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* | Back alignment and structure |
|---|
| >2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A | Back alignment and structure |
|---|
| >2cho_A Glucosaminidase, hexosaminiase; O-GLCNACASE, hydrolase, N-acetylglucosamine; 1.85A {Bacteroides thetaiotaomicron} SCOP: a.246.1.1 c.1.8.10 d.92.2.3 PDB: 2chn_A 2vvn_A* 2vvs_A* 2x0h_A* 2xm2_A* 2w4x_A* 2w66_A* 2w67_A* 2wca_A* 2xj7_A* 2xm1_A* 2j47_A* 2jiw_A* 2wzh_A* 2wzi_A* 2j4g_A* | Back alignment and structure |
|---|
| >2wuh_A Discoidin domain receptor 2; receptor-peptide complex, transferase, nucleotide-binding, tyrosine-protein kinase; 1.60A {Homo sapiens} PDB: 2z4f_A | Back alignment and structure |
|---|
| >3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1hv2_A Elongin C, ELC1; protein-peptide complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.42.1.1 | Back alignment and structure |
|---|
| >3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} | Back alignment and structure |
|---|
| >3ues_A Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydrolase inhibitor complex; HET: DFU; 1.60A {Bifidobacterium longum subsp} PDB: 3mo4_A* 3uet_A* | Back alignment and structure |
|---|
| >3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A | Back alignment and structure |
|---|
| >2fnj_C Transcription elongation factor B polypeptide 1; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.42.1.1 PDB: 1lqb_B 1lm8_C 2jz3_C 2xai_B 2c9w_C 2izv_C 3dcg_B 3zrc_B* 3zrf_B | Back alignment and structure |
|---|
| >4deq_A Neuropilin-1, vascular endothelial growth factor; coagulation factor domain, heparin binding domain, angiogene protein binding-cytokine complex; 2.65A {Homo sapiens} PDB: 1kmx_A 1vgh_A 2vgh_A | Back alignment and structure |
|---|
| >4a3z_A GH89_CBM32, alpha-N-acetylglucosaminidase family protein; hydrolase, family 32 carbohydrate-binding module; HET: MSE; 1.55A {Clostridium perfringens} PDB: 4a6o_A* | Back alignment and structure |
|---|
| >3hny_M Coagulation factor VIII; blood clotting, acute phase, blood coagulation, calcium, DIS mutation, disulfide bond, glycoprotein, hemophilia; 1.07A {Homo sapiens} SCOP: b.18.1.2 PDB: 3hnb_M 3hob_M 1d7p_M 1iqd_C 1cfg_A 1fac_A | Back alignment and structure |
|---|
| >2qqi_A Neuropilin-1; VEGF receptor, semaphorin receptor, angiogenesis, developmen protein, differentiation, glycoprotein, heparan sulfate, ME neurogenesis; 1.80A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 PDB: 2orz_A 2orx_A 2qqn_A 3i97_A* 1kex_A | Back alignment and structure |
|---|
| >2vm9_A Discoidin-2, discoidin II; DDR, lectin, aggregation, cell adhesion; 1.75A {Dictyostelium discoideum} PDB: 2vmc_A* 2vmd_A* 2vme_A* | Back alignment and structure |
|---|
| >3f2z_A Uncharacterized protein BF3579; the present C-terminal domain is predominantly composed of B strands., structural genomics, PSI-2; 1.30A {Bacteroides fragilis} PDB: 2kd7_A | Back alignment and structure |
|---|
| >2jda_A Yecbm32; hypothetical protein, carbohydrate- binding module, sugar-binding protein, pectin, plant cell WALL, galacturonic acid; 1.35A {Yersinia enterocolitica} PDB: 2jd9_A | Back alignment and structure |
|---|
| >4a41_A GH89_CBM32-5, alpha-N-acetylglucosaminidase family protein; hydrolase, family 89 glycoside hydrolase, family 32 carbohyd binding module; HET: GAL; 1.55A {Clostridium perfringens} PDB: 4a44_A* 4a45_A* 4aax_A* | Back alignment and structure |
|---|
| >2j1a_A Hyaluronidase, CBM32; protein-carbohydrate interaction, glycoside hydrolase, GH84C, hydrolase; HET: GAL; 1.49A {Clostridium perfringens} PDB: 2j1e_A* 2j7m_A* | Back alignment and structure |
|---|
| >3ggl_A Putative chitobiase; X-RAY, structure genomics, NESG, BTR324A, Q8A9F0_bactn, BT_0865, PSI-2, protein structure initiative; 3.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 | Back alignment and structure |
|---|
| >1vcb_B Protein (elongin C); tumor suppressor, cancer, ubiquitin, beta sandwich, transcription, transcriptional elongation; 2.70A {Homo sapiens} SCOP: d.42.1.1 | Back alignment and structure |
|---|
| >1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 | Back alignment and structure |
|---|
| >4ag4_A Epithelial discoidin domain-containing receptor 1; immune system-transferase complex; HET: NAG; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2qqj_A Neuropilin-2; VEGF receptor, semaphorin receptor, developmental protein, differentiation, glycoprotein, membrane, neurogenesis, transmembrane; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A | Back alignment and structure |
|---|
| >3drx_A BTB/POZ domain-containing protein KCTD5; golgi, grAsp55, potassium channel domain T1, pentameric assembly, HOST-virus interaction, nucleus; 3.11A {Homo sapiens} PDB: 3dry_A | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A | Back alignment and structure |
|---|
| >2qqm_A Neuropilin-1; VEGF receptor, semaphorin receptor, calcium-binding domain, angiogenesis, developmental protein, differentiation; HET: NAG FUC; 2.00A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 b.23.1.1 | Back alignment and structure |
|---|
| >2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* | Back alignment and structure |
|---|
| >4a42_A GH89_CBM32-4, alpha-N-acetylglucosaminidase family protein; hydrolase, family 89 glycoside hydrolase, family 32 carbohyd binding module; HET: MSE; 1.55A {Clostridium perfringens} | Back alignment and structure |
|---|
| >4gwi_A Lectinolysin, platelet aggregation factor SM-HPAF; cholesterol-dependent cytolysins, lewis antigens, F-type LEC glycan binding; HET: BDZ; 1.60A {Streptococcus mitis} PDB: 4gwj_A* 3lei_A* 3leg_A* 3le0_A* 3lek_A* | Back alignment and structure |
|---|
| >4a4a_A Alpha-N-acetylglucosaminidase family protein; hydrolase, 2 hydrolase, family 89 glycoside hydrolase, mucin carbohydrate-active enzyme; HET: NDG GAL; 1.90A {Clostridium perfringens} PDB: 2vcc_A 2vc9_A* 2vcb_A* 2vca_A | Back alignment and structure |
|---|
| >4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* | Back alignment and structure |
|---|
| >1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D | Back alignment and structure |
|---|
| >2qqk_A Neuropilin-2; VEGF receptor, semaphorin receptor, phage-derived antibody, developmental protein, differentiation, glycoprotein; HET: NAG; 2.75A {Homo sapiens} PDB: 2qql_A | Back alignment and structure |
|---|
| >2eqx_A Kelch repeat and BTB domain-containing protein 4; BACK domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wn3_A Discoidin-1 subunit A; type-H lectin, cell adhesion, discoidin domain, lectin; HET: NGA GAL 1PG; 1.59A {Dictyostelium discoideum} PDB: 2w94_A* 2wn2_A* 2w95_A* | Back alignment and structure |
|---|
| >3lei_A Platelet aggregation factor SM-HPAF; lectin domain of lectinolysin, fucose, blood clotting, nicke; HET: FUC; 1.90A {Streptococcus mitis} PDB: 3leg_A* 3le0_A* 3lek_A* | Back alignment and structure |
|---|
| >2j1v_A Fucolectin-related protein; carbohydrate-binding protein, carbohydrate binding protein; HET: NAG GAL FUC; 1.45A {Streptococcus pneumoniae} PDB: 2j1r_A* 2j1t_A* 2j1u_A* 2j1s_A* | Back alignment and structure |
|---|
| >2qqo_A Neuropilin-2; VEGF receptor, semaphorin receptor, calcium-binding domain, developmental protein, differentiation, glycoprotein, membr neurogenesis; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* | Back alignment and structure |
|---|
| >1w8o_A Bacterial sialidase; 3D-structure, glycosidase, hydrolase, beta- propeller; HET: LBT CIT; 1.70A {Micromonospora viridifaciens} SCOP: b.1.18.2 b.18.1.1 b.68.1.1 PDB: 1w8n_A* 1eut_A 1euu_A* 1wcq_A* 2bzd_A* 2ber_A* 1eur_A 1eus_A* | Back alignment and structure |
|---|
| >1jhj_A APC10; beta sandwich, jellyroll, cell cycle; 1.60A {Homo sapiens} SCOP: b.18.1.9 | Back alignment and structure |
|---|
| >2v5d_A O-GLCNACASE NAGJ; family 32 carbohydrate binding module, glycosidase, GH84, GH84C, CBM32, hydrolase, coiled coil; 3.30A {Clostridium perfringens} | Back alignment and structure |
|---|
| >2v72_A CBM32, EXO-alpha-sialidase; galactose, bacterial pathogen, carbohydrate-binding module, sugar-binding protein; HET: GAL; 2.25A {Clostridium perfringens} | Back alignment and structure |
|---|
| >2j22_A Fucolectin-related protein; carbohydrate-binding protein, carbohydrate binding protein; 1.8A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3kvt_A Potassium channel protein SHAW; tetramerization domain, molecular recogni zinc-binding; 2.00A {Aplysia californica} SCOP: d.42.1.2 | Back alignment and structure |
|---|
| >1s1g_A Potassium voltage-gated channel subfamily D membe; K+ channels, tetramerization domain, T1 domain, transport PR; 2.60A {Homo sapiens} SCOP: d.42.1.2 | Back alignment and structure |
|---|
| >2w1s_A Hyaluronoglucosaminidase; hexosaminidase, family 32 carbohydrate binding module, toxin, secreted, virulence, hydrolase, glycosidase; HET: MSE BTB; 1.45A {Clostridium perfringens} PDB: 2w1q_A* 2w1u_A* 2wdb_A* | Back alignment and structure |
|---|
| >3hnm_A Putative chitobiase; PSI-2, protein structure initiative, northeast structural genomics consortium, NESG, BTR319D.BT_411; 3.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4gz9_A Neuropilin-1, A5 protein; multi-domain, cell-CELL signaling, plexin, semaphorin, VEGF, glycosilated, transmembrane, signaling protein; HET: NAG BMA; 2.70A {Mus musculus} PDB: 4gza_H | Back alignment and structure |
|---|
| >1k12_A Lectin; beta barrel, protein carbohydrate complex, sugar binding protein; HET: FUC; 1.90A {Anguilla anguilla} SCOP: b.18.1.15 | Back alignment and structure |
|---|
| >3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* | Back alignment and structure |
|---|
| >1nn7_A Potassium channel KV4.2; teteramerization domain, voltage gated potassium channel SHAL, membrane protein; 2.10A {Rattus norvegicus} SCOP: d.42.1.2 | Back alignment and structure |
|---|
| >1t1d_A Protein (potassium channel KV1.1); potassium channels, tetramerization domain, aplysia KV1.1, proton transport, membrane protein; 1.51A {Aplysia californica} SCOP: d.42.1.2 PDB: 1eod_A 1eof_A 1eoe_A 1a68_A 1qdv_A 1exb_E* 1qdw_A 1dsx_A | Back alignment and structure |
|---|
| >3eyp_A Putative alpha-L-fucosidase; structural genomics, hydrolase, lipoprotein, PSI-2, protein initiative; 1.90A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3bn6_A Lactadherin; anticoagulation, anti-coagulation, anticoagulant, anti- coagulant, membrane binding, phosphatidyl-serine binding; 1.67A {Bos taurus} PDB: 2pqs_A | Back alignment and structure |
|---|
| >2nz0_B Potassium voltage-gated channel subfamily D membe; KV4.3, kchip1, membrane protein; 3.20A {Homo sapiens} PDB: 2i2r_A | Back alignment and structure |
|---|
| >1tvg_A LOC51668 protein; cell cycle, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.60A {Homo sapiens} SCOP: b.18.1.9 PDB: 1xpw_A | Back alignment and structure |
|---|
| >2cho_A Glucosaminidase, hexosaminiase; O-GLCNACASE, hydrolase, N-acetylglucosamine; 1.85A {Bacteroides thetaiotaomicron} SCOP: a.246.1.1 c.1.8.10 d.92.2.3 PDB: 2chn_A 2vvn_A* 2vvs_A* 2x0h_A* 2xm2_A* 2w4x_A* 2w66_A* 2w67_A* 2wca_A* 2xj7_A* 2xm1_A* 2j47_A* 2jiw_A* 2wzh_A* 2wzi_A* 2j4g_A* | Back alignment and structure |
|---|
| >1czt_A Protein (coagulation factor V); membrane-binding, discoidin family, calcium- independent, blood clotting; 1.87A {Homo sapiens} SCOP: b.18.1.2 PDB: 1czs_A 1czv_A | Back alignment and structure |
|---|
| >3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2yc2_A IFT25, intraflagellar transport protein 25; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_A | Back alignment and structure |
|---|
| >3ues_A Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydrolase inhibitor complex; HET: DFU; 1.60A {Bifidobacterium longum subsp} PDB: 3mo4_A* 3uet_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 765 | ||||
| d1r29a_ | 122 | d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB | 2e-13 | |
| d1buoa_ | 121 | d.42.1.1 (A:) Promyelocytic leukaemia zinc finger | 1e-10 | |
| d1w8oa2 | 142 | b.18.1.1 (A:506-647) Sialidase, C-terminal domain | 3e-05 |
| >d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 122 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: POZ domain superfamily: POZ domain family: BTB/POZ domain domain: B-cell lymphoma 6 (Bcl6) protein BTB domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 65.5 bits (159), Expect = 2e-13
Identities = 20/85 (23%), Positives = 36/85 (42%)
Query: 38 EHVQFLSEMIGNLYLNDEFSDTVLIVQNEKISVHKVILAARSEYFRALLYGGLCESNQNE 97
H + + L D +D V++V E+ HK +L A S F ++ L +
Sbjct: 7 RHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKRNLSVI 66
Query: 98 IELHDTNIVAFKCLLKYIYSGKLSF 122
+ N F LL ++Y+ +L+
Sbjct: 67 NLDPEINPEGFNILLDFMYTSRLNL 91
|
| >d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 121 | Back information, alignment and structure |
|---|
| >d1w8oa2 b.18.1.1 (A:506-647) Sialidase, C-terminal domain {Micromonospora viridifaciens [TaxId: 1881]} Length = 142 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 765 | |||
| d1r29a_ | 122 | B-cell lymphoma 6 (Bcl6) protein BTB domain {Human | 99.87 | |
| d1buoa_ | 121 | Promyelocytic leukaemia zinc finger (PLZF) protein | 99.87 | |
| d1w8oa2 | 142 | Sialidase, C-terminal domain {Micromonospora virid | 99.26 | |
| d1zgka1 | 288 | Kelch-like ECH-associated protein 1, KEAP1 {Human | 99.09 | |
| d1zgka1 | 288 | Kelch-like ECH-associated protein 1, KEAP1 {Human | 99.02 | |
| d1k12a_ | 158 | Fucose binding lectin {European eel (Anguilla angu | 98.98 | |
| d1tvga_ | 136 | Placental protein 25, pp25 {Human (Homo sapiens) [ | 98.96 | |
| d1k3ia2 | 162 | Galactose oxidase, N-terminal domain {Fungi (Fusar | 98.91 | |
| d1jhja_ | 161 | APC10/DOC1 subunit of the anaphase-promoting compl | 98.78 | |
| d1gqpa_ | 194 | APC10/DOC1 subunit of the anaphase-promoting compl | 98.62 | |
| d1r29a_ | 122 | B-cell lymphoma 6 (Bcl6) protein BTB domain {Human | 98.44 | |
| d1k3ia3 | 387 | Galactose oxidase, central domain {Fungi (Fusarium | 98.41 | |
| d2qqia1 | 156 | C2 domain of factor VIII {Human (Homo sapiens) [Ta | 98.08 | |
| d1buoa_ | 121 | Promyelocytic leukaemia zinc finger (PLZF) protein | 98.03 | |
| d1k3ia3 | 387 | Galactose oxidase, central domain {Fungi (Fusarium | 97.85 | |
| d1sddb3 | 162 | C2 domain of factor V {Cow (Bos taurus) [TaxId: 99 | 96.86 | |
| d2c9wc1 | 96 | Elongin C {Human (Homo sapiens) [TaxId: 9606]} | 96.69 | |
| d1w8oa2 | 142 | Sialidase, C-terminal domain {Micromonospora virid | 96.5 | |
| d1nn7a_ | 105 | Potassium channel kv4.2 {Rat (Rattus norvegicus) [ | 96.43 | |
| d1hv2a_ | 99 | Elongin C {Baker's yeast (Saccharomyces cerevisiae | 96.3 | |
| d2qqia2 | 155 | B1 domain of neuropilin-1 {Human (Homo sapiens) [T | 96.18 | |
| d1czsa_ | 160 | C2 domain of factor V {Human (Homo sapiens) [TaxId | 96.14 | |
| d3kvta_ | 103 | akv3.1 voltage-gated potassium channel {California | 95.98 | |
| d1d7pm_ | 159 | C2 domain of factor VIII {Human (Homo sapiens) [Ta | 95.95 | |
| d1t1da_ | 100 | Shaker potassium channel {California sea hare (Apl | 95.37 | |
| d1tvga_ | 136 | Placental protein 25, pp25 {Human (Homo sapiens) [ | 94.61 | |
| d1k3ia2 | 162 | Galactose oxidase, N-terminal domain {Fungi (Fusar | 94.23 | |
| d1jhja_ | 161 | APC10/DOC1 subunit of the anaphase-promoting compl | 94.05 | |
| d1fs1b1 | 55 | Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa | 90.08 | |
| d1fs1b2 | 61 | Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa | 90.02 | |
| d1gqpa_ | 194 | APC10/DOC1 subunit of the anaphase-promoting compl | 89.8 | |
| d1nexa2 | 72 | Centromere DNA-binding protein complex Cbf3 subuni | 88.68 | |
| d1k12a_ | 158 | Fucose binding lectin {European eel (Anguilla angu | 88.5 | |
| d2qqia1 | 156 | C2 domain of factor VIII {Human (Homo sapiens) [Ta | 87.78 | |
| d1nexa1 | 70 | Centromere DNA-binding protein complex Cbf3 subuni | 87.02 |
| >d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: POZ domain superfamily: POZ domain family: BTB/POZ domain domain: B-cell lymphoma 6 (Bcl6) protein BTB domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.87 E-value=5.7e-22 Score=179.94 Aligned_cols=119 Identities=18% Similarity=0.294 Sum_probs=104.3
Q ss_pred CCccchHHHHHHHHHHHHcCCCCccEEEEECCEEEEeehhHHHhcCHHHHHHhcCCccCCCCeeEEecCCCHHHHHHHHH
Q psy12546 34 SYEIEHVQFLSEMIGNLYLNDEFSDTVLIVQNEKISVHKVILAARSEYFRALLYGGLCESNQNEIELHDTNIVAFKCLLK 113 (765)
Q Consensus 34 ~~~~~~~~~l~~~l~~l~~~~~~sDv~~~v~~~~~~aHr~ILaarS~yF~~lf~~~~~es~~~~I~l~~v~~~~f~~lL~ 113 (765)
..-.+|+..+.+.|+.+++++.+|||+|.++|++|+|||+|||++|+||++||.+++.++....+.+.++++++|
T Consensus 3 ~~~~~h~~~ll~~l~~l~~~~~~~Dv~l~v~~~~~~~Hk~vLa~~S~~F~~~f~~~~~e~~~~~~~~~~v~~~~f----- 77 (122)
T d1r29a_ 3 IQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKRNLSVINLDPEINPEGF----- 77 (122)
T ss_dssp CCCTTHHHHHHHHHHHHHHTTCSCCEEEEETTEEEEECHHHHHHHCHHHHHHHTSTTTTTCSEEECCTTSCHHHH-----
T ss_pred cccchHHHHHHHHHHHHHhcCCCeEEEEEECCEEEEEehHHhhhCCHHHHHHhccchhhhcceeeeecccCHHHH-----
Confidence 345689999999999999999999999999999999999999999999999999999988887777788999999
Q ss_pred HHhcCCccccCcchhHHHHHhhhccCCCCcchHhHHHhhhcCcccCCccccccccccHHHHHHHHHhHhcCceecccCCh
Q psy12546 114 YIYSGKLSFRNLKDDVILDILGKKQNKGTTLTQNFRALLYGGLCESNQNEIELHDTNIVAFKCLLKYIYSGKLSFRNLKD 193 (765)
Q Consensus 114 ylYtg~l~~~~~~~~~ll~i~~~~~~~~~~~S~yF~amf~~~~~Es~~~~i~l~~v~~~~f~~lL~yiYtg~i~l~~~~~ 193 (765)
+.+|+|+|||++.+ +.
T Consensus 78 -------------------------------------------------------------~~ll~~~Ytg~~~i---~~ 93 (122)
T d1r29a_ 78 -------------------------------------------------------------NILLDFMYTSRLNL---RE 93 (122)
T ss_dssp -------------------------------------------------------------HHHHHHHHHSCCCC---CT
T ss_pred -------------------------------------------------------------HHHHhhhcCCeecC---ch
Confidence 55555555555544 37
Q ss_pred hHHHHHHHHHhhhCcHHHHHHHHHHHHh
Q psy12546 194 DVILDILGLSHKYGFQDLENSISDYLRV 221 (765)
Q Consensus 194 ~~vl~ll~~A~~~~l~~L~~~c~~~L~~ 221 (765)
+++.+++.+|++|++++|++.|.+||+.
T Consensus 94 ~~v~~ll~~A~~l~i~~L~~~C~~~L~~ 121 (122)
T d1r29a_ 94 GNIMAVMATAMYLQMEHVVDTCRKFIKA 121 (122)
T ss_dssp TTHHHHHHHHHHTTCHHHHHHHHHHHHT
T ss_pred hhHHHHHHHHHHHCcHHHHHHHHHHHHh
Confidence 7899999999999999999999999875
|
| >d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8oa2 b.18.1.1 (A:506-647) Sialidase, C-terminal domain {Micromonospora viridifaciens [TaxId: 1881]} | Back information, alignment and structure |
|---|
| >d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k12a_ b.18.1.15 (A:) Fucose binding lectin {European eel (Anguilla anguilla) [TaxId: 7936]} | Back information, alignment and structure |
|---|
| >d1tvga_ b.18.1.9 (A:) Placental protein 25, pp25 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jhja_ b.18.1.9 (A:) APC10/DOC1 subunit of the anaphase-promoting complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gqpa_ b.18.1.9 (A:) APC10/DOC1 subunit of the anaphase-promoting complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} | Back information, alignment and structure |
|---|
| >d2qqia1 b.18.1.2 (A:431-586) C2 domain of factor VIII {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} | Back information, alignment and structure |
|---|
| >d1sddb3 b.18.1.2 (B:1863-2024) C2 domain of factor V {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8oa2 b.18.1.1 (A:506-647) Sialidase, C-terminal domain {Micromonospora viridifaciens [TaxId: 1881]} | Back information, alignment and structure |
|---|
| >d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2qqia2 b.18.1.2 (A:273-427) B1 domain of neuropilin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1czsa_ b.18.1.2 (A:) C2 domain of factor V {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d1d7pm_ b.18.1.2 (M:) C2 domain of factor VIII {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d1tvga_ b.18.1.9 (A:) Placental protein 25, pp25 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jhja_ b.18.1.9 (A:) APC10/DOC1 subunit of the anaphase-promoting complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fs1b1 a.157.1.1 (B:86-140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fs1b2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gqpa_ b.18.1.9 (A:) APC10/DOC1 subunit of the anaphase-promoting complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nexa2 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k12a_ b.18.1.15 (A:) Fucose binding lectin {European eel (Anguilla anguilla) [TaxId: 7936]} | Back information, alignment and structure |
|---|
| >d2qqia1 b.18.1.2 (A:431-586) C2 domain of factor VIII {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nexa1 a.157.1.1 (A:116-185) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|