Psyllid ID: psy12546


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-----
MTSQGWDMSSNSHSVLPSVGMSPCTSTTGTTNHSYEIEHVQFLSEMIGNLYLNDEFSDTVLIVQNEKISVHKVILAARSEYFRALLYGGLCESNQNEIELHDTNIVAFKCLLKYIYSGKLSFRNLKDDVILDILGKKQNKGTTLTQNFRALLYGGLCESNQNEIELHDTNIVAFKCLLKYIYSGKLSFRNLKDDVILDILGLSHKYGFQDLENSISDYLRVILTVHNACSIFDCAYYYDLKQLNKIVLSFIDYNAKQIISENSFYNLSQNGLIQLIQRDSFYAPEIDIFRAVVDWIKANSPEVEEDGESSFRAPINMDEILTYVRLPLISLDELLTTVRSSGIISADKILDAIELQTNDKVQYRANSPEVEEDGESSFRAPINMDEILTYVRLPLISLDELLTTVRSSGIISADKILDAIELQTNDKVQYRGYLKPEENLATSKMGTMVMQGEMKNALLNGDVNNYDMENGYTRHTITEATSSTSCDNGILIKLGTQAIVNHIKLLLWDKDLRSYSYFIEVSIDQKKWTRVIDYTRFYCRSWQFLYFPTQVVQYIRVVGTNNTVNKVFHIVSFEIMYTAQTVQLSEEGIIIPKHNVATRELSAKVVEGVSRSLSSLIDGNTVKYDWDSGYTCHQLGSGAILVQLGQPYMLDSMRLLLWDCDDRSYSYLVDVSINLWDWEIVADHTRDLCRSWQSISFSRRPVVFVRIIGTHNTMNEVFHCVHFECPDQSIKLPSAGQPSPSCLSVVTAQFQPAETTLEEEKDEKD
ccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccEEEEEccEEEEEHHHHHHHccHHHHHHHcccccccccccEEEccccHHHHHHHHHHHHHccccccccccEEEEEEcccccEEEEcccHHHHHHcccccccccccEEEEccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHcccccccccHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHcccccccHHHHHHHcccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEEcccccccccEEEEccccEEccccEEEEEEccccccccccccccccccccccccccEEEcccEEcccccccEEEccccccccccccccccccccccccEEEEccccEEEEEEEEEEcccccccEEEEEEEEEccccEEEEEEccccccccccEEEEccEEEEEEEEEEcccccccEEEEEEEEEEEEcccccccccccccccccccccccccEEEEccccccccccccccccccccccccEEEcccccEEEEcccccccccEEEEEccccccEEEEEEEEEcccccEEEEEEccccccccccEEEEccccEEEEEEEEcccccccEEEEEEEEcccccccccccccccccccccccccccccccccHHHHcccc
ccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccEEEEEccccccHHHEEEEccHHHHHHHHHccccccccccEEcccccHHHHHHHHHHHHHcccccccEEEEEcHcHHHHHHHHHHcccHHHHHHHcccHHHHcccEEEEccccHHHHHHHHHHHHccEEEEEEEcHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccHHHHHccHHHHHHHHHcccccccHHHHHHHHHHHHHccHHHcccccHHHHHHHHHHHHHHHHcccccccHHHHHHHccccccccccHHHHHHHHHHHHHccccHHccHHccccccccccccccccEEEEEccccccHHHccEEEcccccccHHHHHHHHHHHHHccccccccccccccEccccccccccccHHHHHHcccccccccccccccEcEcccccccccccccEEEEccccEHHHHEEEEEcccccccEEEEEEEEcccccEEEEEEccccccccHHHEEccccEEEEEEEEEccccccEEEEEEEEEEEccccccccccccEEEccccEEEEccccEEEEcccccHHHHHcccccccccccccccccccccEEEEEccccHHHHHHHHHEcccccccEEEEEEEEcccccEEEEEEcccHccccHEEEEcccccEEEEEEEccccccccEEEEEEEEccccccccccccccccccccccccccccccccHHHcccccc
mtsqgwdmssnshsvlpsvgmspctsttgttnhsyeIEHVQFLSEMIGnlylndefsdtVLIVQNEKISVHKVILAARSEYFRALLYGglcesnqneielhdtNIVAFKCLLKYIYSGklsfrnlkdDVILDILgkkqnkgttlTQNFRALLYGGlcesnqneielhdtNIVAFKCLLKYIYSGklsfrnlkddVILDILGlshkygfqdlENSISDYLRVILTVHNACSIFDCAYYYDLKQLNKIVLSFIDYNAKQIISENSFYNLSQNGLIQLiqrdsfyapeiDIFRAVVDWIKanspeveedgessfrapinmdEILTYVRLPLISLDELLTTVRSSGIISADKILDAIELQtndkvqyranspeveedgessfrapinmdEILTYVRLPLISLDELLTTVRSSGIISADKILDAIELQTNdkvqyrgylkpeenlatskmGTMVMQGEMKNAllngdvnnydmengytrhtiteatsstscdngiliKLGTQAIVNHIKLLLWDKDLRSYSYFIEVSIDQKKWTRVIDYTRFYcrswqflyfptQVVQYIRVVGTNNTVNKVFHIVSFEIMYTAqtvqlseegiiipkhnvatRELSAKVVEGVSRSLsslidgntvkydwdsgytchqlgsgailvqlgqpymlDSMRLLLWdcddrsysyLVDVSINLWDWEIVADHTRDLCRswqsisfsrrpVVFVRIIGTHNTMNEVFHCvhfecpdqsiklpsagqpspsclsvvtaqfqpaettleeekdekd
mtsqgwdmssnshsvlpsvgMSPCTSTTGTTNHSYEIEHVQFLSEMIGNLYLNDEFSDTVLIVQNEKISVHKVILAARSEYFRALLYGGLCESNQNEIELHDTNIVAFKCLLKYIYSGKLSFRNLKDDVILDILgkkqnkgttltQNFRALLYGGLCESNQNEIELHDTNIVAFKCLLKYIYSGKLSFRNLKDDVILDILGLSHKYGFQDLENSISDYLRVILTVHNACSIFDCAYYYDLKQLNKIVLSFIDYNAKQIISENSFYNLSQNGLIQLIQRDSFYAPEIDIFRAVVDWIKANSpeveedgessfrapINMDEILTYVRLPLISLDELLTTVRSSGIISADKILDAIELQTNDKVQYRANspeveedgessfrapINMDEILTYVRLPLISLDELLTTVRSSGIISADkildaielqtndkvqyrgylkpeenlatsKMGTMVMQGEMKNALLNGDVNNYDMENGYTRHTITEATSSTSCDNGILIKLGTQAIVNHIKLLLWDKDLRSYSYFIevsidqkkwtrVIDYTRFYCRSWQFLYFPTQVVQYIRVVGTNNTVNKVFHIVSFEIMYTAQTVQLSEEGIIIPKHNVATRELSAKVVEGVsrslsslidgnTVKYDWDSGYTCHQLGSGAILVQLGQPYMLDSMRLLLWDCDDRSYSYLVDVSINLWDWEIVADHTRDLCRswqsisfsrrpVVFVRIIGTHNTMNEVFHCVHFECPDQSIKLPSAGQPSPSCLSVVTAQfqpaettleeekdekd
MTSQGWDMSSNSHSVLPSVGMSPCTSTTGTTNHSYEIEHVQFLSEMIGNLYLNDEFSDTVLIVQNEKISVHKVILAARSEYFRALLYGGLCESNQNEIELHDTNIVAFKCLLKYIYSGKLSFRNLKDDVILDILGKKQNKGTTLTQNFRALLYGGLCESNQNEIELHDTNIVAFKCLLKYIYSGKLSFRNLKDDVILDILGLSHKYGFQDLENSISDYLRVILTVHNACSIFDCAYYYDLKQLNKIVLSFIDYNAKQIISENSFYNLSQNGLIQLIQRDSFYAPEIDIFRAVVDWIKANSPEVEEDGESSFRAPINMDEILTYVRLPLISLDELLTTVRSSGIISADKILDAIELQTNDKVQYRANSPEVEEDGESSFRAPINMDEILTYVRLPLISLDELLTTVRSSGIISADKILDAIELQTNDKVQYRGYLKPEENLATSKMGTMVMQGEMKNALLNGDVNNYDMENGYTRHTITEATSSTSCDNGILIKLGTQAIVNHIKLLLWDKDLRSYSYFIEVSIDQKKWTRVIDYTRFYCRSWQFLYFPTQVVQYIRVVGTNNTVNKVFHIVSFEIMYTAQTVQLSEEGIIIPKHNVATRELSAKVVEGVSRSLSSLIDGNTVKYDWDSGYTCHQLGSGAILVQLGQPYMLDSMRLLLWDCDDRSYSYLVDVSINLWDWEIVADHTRDLCRSWQSISFSRRPVVFVRIIGTHNTMNEVFHCVHFECPDQSIKLPSAGQPSPSCLSVVTAQFQPAettleeekdekd
******************************TNHSYEIEHVQFLSEMIGNLYLNDEFSDTVLIVQNEKISVHKVILAARSEYFRALLYGGLCESNQNEIELHDTNIVAFKCLLKYIYSGKLSFRNLKDDVILDILGKKQNKGTTLTQNFRALLYGGLCESNQNEIELHDTNIVAFKCLLKYIYSGKLSFRNLKDDVILDILGLSHKYGFQDLENSISDYLRVILTVHNACSIFDCAYYYDLKQLNKIVLSFIDYNAKQIISENSFYNLSQNGLIQLIQRDSFYAPEIDIFRAVVDWIKA**************APINMDEILTYVRLPLISLDELLTTVRSSGIISADKILDAIELQTN**********************PINMDEILTYVRLPLISLDELLTTVRSSGIISADKILDAIELQTNDKVQYRGYLKP*****************MKNALLNGDVNNYDMENGYTRHTITEATSSTSCDNGILIKLGTQAIVNHIKLLLWDKDLRSYSYFIEVSIDQKKWTRVIDYTRFYCRSWQFLYFPTQVVQYIRVVGTNNTVNKVFHIVSFEIMYTAQTVQLSEEGIIIPKHNVATRELSAKVVEGVSRSLSSLIDGNTVKYDWDSGYTCHQLGSGAILVQLGQPYMLDSMRLLLWDCDDRSYSYLVDVSINLWDWEIVADHTRDLCRSWQSISFSRRPVVFVRIIGTHNTMNEVFHCVHFECPD**************************************
**************************************HVQFLSEMIGNLYLNDEFSDTVLIVQNEKISVHKVILAARSEYFR*********************IVAFKCLLKYIYSGKLSFRNLKDDVILDILGKKQNKGTTLTQNFRALLYGGLCESNQNEIELHDTNIVAFKCLLKYIYSGKLSFRNLKDDVILDILGLSHKYGFQDLENSISDYLRVILTVHNACSIFDCAYYYDLKQLNKIVLSFIDYNAKQIISENSFYNLSQNGLIQLIQRDSFYAPEIDIFRAVVDWIKANSPEVEEDGESSFRAPINMDEILTYVRLPLISLDELLTTVRSSGIISADKILDAIELQTNDK*********************INMDEILTYVRLPLISLDELLTTVRSSGIISADKILDAIELQTNDKVQYRGYLKPEENLATSKMGTMVMQGEMKNALLNGDVNNYDMENGYTRHTITEATSSTSCDNGILIKLGTQAIVNHIKLLLWDKDLRSYSYFIEVSIDQKKWTRVIDYTRFYCRSWQFLYFPTQVVQYIRVVGTNNTVNKVFHIVSFEIMYTAQTVQLSEEGIIIPKHNVATRELSAKVVEGVSRSLSSLIDGNTVKYDWDSGYTCHQLGSGAILVQLGQPYMLDSMRLLLWDCDDRSYSYLVDVSINLWDWEIVADHTRDLCRSWQSISFSRRPVVFVRIIGTHNTMNEVFHCVHFE*****************************************
*************SVLPSVGMSPCTSTTGTTNHSYEIEHVQFLSEMIGNLYLNDEFSDTVLIVQNEKISVHKVILAARSEYFRALLYGGLCESNQNEIELHDTNIVAFKCLLKYIYSGKLSFRNLKDDVILDILGKKQNKGTTLTQNFRALLYGGLCESNQNEIELHDTNIVAFKCLLKYIYSGKLSFRNLKDDVILDILGLSHKYGFQDLENSISDYLRVILTVHNACSIFDCAYYYDLKQLNKIVLSFIDYNAKQIISENSFYNLSQNGLIQLIQRDSFYAPEIDIFRAVVDWIKANS*********SFRAPINMDEILTYVRLPLISLDELLTTVRSSGIISADKILDAIELQTNDKVQYRA***********SFRAPINMDEILTYVRLPLISLDELLTTVRSSGIISADKILDAIELQTNDKVQYRGYLKPEENLATSKMGTMVMQGEMKNALLNGDVNNYDMENGYTRHTITEATSSTSCDNGILIKLGTQAIVNHIKLLLWDKDLRSYSYFIEVSIDQKKWTRVIDYTRFYCRSWQFLYFPTQVVQYIRVVGTNNTVNKVFHIVSFEIMYTAQTVQLSEEGIIIPKHNVATRELSAKVVEGVSRSLSSLIDGNTVKYDWDSGYTCHQLGSGAILVQLGQPYMLDSMRLLLWDCDDRSYSYLVDVSINLWDWEIVADHTRDLCRSWQSISFSRRPVVFVRIIGTHNTMNEVFHCVHFECPDQSIKL**********LSVVTAQFQPAE***********
*********************************SYEIEHVQFLSEMIGNLYLNDEFSDTVLIVQNEKISVHKVILAARSEYFRALLYGGLCESNQNEIELHDTNIVAFKCLLKYIYSGKLSFRNLKDDVILDILGKKQNKGTTLTQNFRALLYGGLCESNQNEIELHDTNIVAFKCLLKYIYSGKLSFRNLKDDVILDILGLSHKYGFQDLENSISDYLRVILTVHNACSIFDCAYYYDLKQLNKIVLSFIDYNAKQIISENSFYNLSQNGLIQLIQRDSFYAPEIDIFRAVVDWIKANSPEVEEDGESSFRAPINMDEILTYVRLPLISLDELLTTVRSSGIISADKILDAIELQTNDKVQYRANSPEVEEDGESSFRAPINMDEILTYVRLPLISLDELLTTVRSSGIISADKILDAIELQTNDKVQYRGYLKPEENLATSKMGTMVMQGEMKNALLNGDVNNYDMENGYTRHTITEATSSTSCDNGILIKLGTQAIVNHIKLLLWDKDLRSYSYFIEVSIDQKKWTRVIDYTRFYCRSWQFLYFPTQVVQYIRVVGTNNTVNKVFHIVSFEIMYTAQTVQLSEEGIIIPKHNVATRELSAKVVEGVSRSLSSLIDGNTVKYDWDSGYTCHQLGSGAILVQLGQPYMLDSMRLLLWDCDDRSYSYLVDVSINLWDWEIVADHTRDLCRSWQSISFSRRPVVFVRIIGTHNTMNEVFHCVHFECPD**************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSQGWDMSSNSHSVLPSVGMSPCTSTTGTTNHSYEIEHVQFLSEMIGNLYLNDEFSDTVLIVQNEKISVHKVILAARSEYFRALLYGGLCESNQNEIELHDTNIVAFKCLLKYIYSGKLSFRNLKDDVILDILGKKQNKGTTLTQNFRALLYGGLCESNQNEIELHDTNIVAFKCLLKYIYSGKLSFRNLKDDVILDILGLSHKYGFQDLENSISDYLRVILTVHNACSIFDCAYYYDLKQLNKIVLSFIDYNAKQIISENSFYNLSQNGLIQLIQRDSFYAPEIDIFRAVVDWIKANSPEVEEDGESSFRAPINMDEILTYVRLPLISLDELLTTVRSSGIISADKILDAIELQTNDKVQYRANSPEVEEDGESSFRAPINMDEILTYVRLPLISLDELLTTVRSSGIISADKILDAIELQTNDKVQYRGYLKPEENLATSKMGTMVMQGEMKNALLNGDVNNYDMENGYTRHTITEATSSTSCDNGILIKLGTQAIVNHIKLLLWDKDLRSYSYFIEVSIDQKKWTRVIDYTRFYCRSWQFLYFPTQVVQYIRVVGTNNTVNKVFHIVSFEIMYTAQTVQLSEEGIIIPKHNVATRELSAKVVEGVSRSLSSLIDGNTVKYDWDSGYTCHQLGSGAILVQLGQPYMLDSMRLLLWDCDDRSYSYLVDVSINLWDWEIVADHTRDLCRSWQSISFSRRPVVFVRIIGTHNTMNEVFHCVHFECPDQSIKLPSAGQPSPSCLSVVTAQFQPAETTLEEEKDEKD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query765 2.2.26 [Sep-21-2011]
A4IFG2611 BTB/POZ domain-containing yes N/A 0.684 0.857 0.467 1e-152
Q96Q07612 BTB/POZ domain-containing yes N/A 0.653 0.816 0.477 1e-152
Q5PQR3612 BTB/POZ domain-containing yes N/A 0.684 0.856 0.463 1e-151
Q8C726612 BTB/POZ domain-containing yes N/A 0.667 0.834 0.465 1e-150
Q9BX70525 BTB/POZ domain-containing no N/A 0.250 0.365 0.274 7e-15
Q9H0C5482 BTB/POZ domain-containing no N/A 0.260 0.412 0.259 5e-13
P58544488 BTB/POZ domain-containing no N/A 0.260 0.407 0.254 1e-12
P58545532 BTB/POZ domain-containing no N/A 0.257 0.370 0.242 2e-12
Q5R7B8609 Kelch-like protein 20 OS= no N/A 0.300 0.377 0.240 2e-12
Q9Y2F9522 BTB/POZ domain-containing no N/A 0.257 0.377 0.242 2e-12
>sp|A4IFG2|BTBD9_BOVIN BTB/POZ domain-containing protein 9 OS=Bos taurus GN=BTBD9 PE=2 SV=2 Back     alignment and function desciption
 Score =  540 bits (1391), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 285/609 (46%), Positives = 385/609 (63%), Gaps = 85/609 (13%)

Query: 146 QNFRALLYGGLCESN-QNEIELHDTNIVAFKCLLKYIYSGKLSFRNLKDDVILDILGLSH 204
           Q FRALLYGG+ ES  + EI L DT   AF  LLKYIY+G+ +  + K++V+LD L L+H
Sbjct: 59  QYFRALLYGGMRESQPEAEIPLEDTTAEAFTMLLKYIYTGRATLTDEKEEVLLDFLSLAH 118

Query: 205 KYGFQDLENSISDYLRVILTVHNACSIFDCAYYYDLKQLNKIVLSFIDYNAKQIISENSF 264
           KYGF +LE+S S+YL  IL + N C  FD A  Y L +L  +   F+D NA++++S   F
Sbjct: 119 KYGFPELEDSTSEYLCTILNIQNVCMTFDVASLYSLPKLTCMCCMFMDRNAQEVLSSEGF 178

Query: 265 YNLSQNGLIQLIQRDSFYAPEIDIFRAVVDWIKANSPEVEEDGESSFRAPINMDEILTYV 324
            +LS+  L+ ++ RDSF APE DIF A+++W K NS E             N  EI+  V
Sbjct: 179 LSLSKTALLNIVLRDSFAAPEKDIFLALLNWCKHNSNE-------------NHAEIMQAV 225

Query: 325 RLPLISLDELLTTVRSSGIISADKILDAIELQTNDKVQYRANSPEVEEDGESSFRAPINM 384
           RLPL+SL ELL  VR SG++S D ILDAI++++  +                      +M
Sbjct: 226 RLPLMSLTELLNVVRPSGLLSPDAILDAIKVRSESR----------------------DM 263

Query: 385 DEILTYVRLPLISLDELLTTVRSSGIISADKILDAIELQTNDKVQYRGYLKPEENLATSK 444
           D  L Y R  LI  + + T    + ++                   +G LK         
Sbjct: 264 D--LNY-RGMLIPEENIATMKYGAQVV-------------------KGELK--------- 292

Query: 445 MGTMVMQGEMKNALLNGDVNNYDMENGYTRHTITEATSSTSCDNGILIKLGTQAIVNHIK 504
             + ++ G+ +N         YD+++G++RH I +      C +GI IKLG  +I+NHI+
Sbjct: 293 --SALLDGDTQN---------YDLDHGFSRHPIDD-----DCRSGIEIKLGQPSIINHIR 336

Query: 505 LLLWDKDLRSYSYFIEVSIDQKKWTRVIDYTRFYCRSWQFLYFPTQVVQYIRVVGTNNTV 564
           +LLWD+D RSYSYFIEVS+D+  W RVID++++ CRSWQ LYFP +V +YIR+VGT+NTV
Sbjct: 337 ILLWDRDSRSYSYFIEVSMDELDWIRVIDHSQYLCRSWQKLYFPARVCRYIRIVGTHNTV 396

Query: 565 NKVFHIVSFEIMYTAQTVQLSEEGIIIPKHNVATRELSAKVVEGVSRSLSSLIDGNTVKY 624
           NK+FHIV+FE M+T +T  L E+G+I+P  NVAT    A V+EGVSRS ++L++G+T  Y
Sbjct: 397 NKIFHIVAFECMFTNKTFTL-EKGLIVPMENVATIADCASVIEGVSRSRNALLNGDTKNY 455

Query: 625 DWDSGYTCHQLGSGAILVQLGQPYMLDSMRLLLWDCDDRSYSYLVDVSINLWDWEIVADH 684
           DWDS YTCHQLGSGAI+VQL QPYM+ S+RLLLWDCDDRSYSY V+VS N   W +VAD 
Sbjct: 456 DWDSSYTCHQLGSGAIVVQLAQPYMIGSIRLLLWDCDDRSYSYYVEVSTNQQQWTMVADR 515

Query: 685 TRDLCRSWQSISFSRRPVVFVRIIGTHNTMNEVFHCVHFECPD-QSIKLPSAGQPSPSCL 743
           T+  C+SWQS++F RRP  F+RI+GTHNT NEVFHCVHFECP+ QS +  S+ +P     
Sbjct: 516 TKVSCKSWQSVTFERRPASFIRIVGTHNTANEVFHCVHFECPEQQSAQKDSSDEPGTGGA 575

Query: 744 SVVTAQFQP 752
           S    Q  P
Sbjct: 576 SAAGQQLDP 584





Bos taurus (taxid: 9913)
>sp|Q96Q07|BTBD9_HUMAN BTB/POZ domain-containing protein 9 OS=Homo sapiens GN=BTBD9 PE=2 SV=2 Back     alignment and function description
>sp|Q5PQR3|BTBD9_RAT BTB/POZ domain-containing protein 9 OS=Rattus norvegicus GN=Btbd9 PE=2 SV=1 Back     alignment and function description
>sp|Q8C726|BTBD9_MOUSE BTB/POZ domain-containing protein 9 OS=Mus musculus GN=Btbd9 PE=2 SV=1 Back     alignment and function description
>sp|Q9BX70|BTBD2_HUMAN BTB/POZ domain-containing protein 2 OS=Homo sapiens GN=BTBD2 PE=1 SV=1 Back     alignment and function description
>sp|Q9H0C5|BTBD1_HUMAN BTB/POZ domain-containing protein 1 OS=Homo sapiens GN=BTBD1 PE=1 SV=1 Back     alignment and function description
>sp|P58544|BTBD1_MOUSE BTB/POZ domain-containing protein 1 OS=Mus musculus GN=Btbd1 PE=2 SV=3 Back     alignment and function description
>sp|P58545|BTBD3_MOUSE BTB/POZ domain-containing protein 3 OS=Mus musculus GN=Btbd3 PE=2 SV=1 Back     alignment and function description
>sp|Q5R7B8|KLH20_PONAB Kelch-like protein 20 OS=Pongo abelii GN=KLHL20 PE=2 SV=3 Back     alignment and function description
>sp|Q9Y2F9|BTBD3_HUMAN BTB/POZ domain-containing protein 3 OS=Homo sapiens GN=BTBD3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query765
307215202602 BTB/POZ domain-containing protein 9 [Har 0.677 0.860 0.509 1e-170
383862423604 PREDICTED: BTB/POZ domain-containing pro 0.691 0.875 0.500 1e-167
66564756617 PREDICTED: BTB/POZ domain-containing pro 0.729 0.904 0.483 1e-165
350413268615 PREDICTED: BTB/POZ domain-containing pro 0.691 0.860 0.499 1e-165
380023366617 PREDICTED: BTB/POZ domain-containing pro 0.729 0.904 0.483 1e-164
340708503615 PREDICTED: BTB/POZ domain-containing pro 0.691 0.860 0.486 1e-156
291226013630 PREDICTED: CG1826-like [Saccoglossus kow 0.652 0.792 0.478 1e-154
357622576716 hypothetical protein KGM_13514 [Danaus p 0.745 0.796 0.428 1e-151
190360739611 BTB/POZ domain-containing protein 9 [Bos 0.684 0.857 0.467 1e-150
301782813779 PREDICTED: BTB/POZ domain-containing pro 0.684 0.672 0.465 1e-150
>gi|307215202|gb|EFN89974.1| BTB/POZ domain-containing protein 9 [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  605 bits (1559), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 309/606 (50%), Positives = 398/606 (65%), Gaps = 88/606 (14%)

Query: 128 DVILDILGKKQNKGTTL----TQNFRALLYGGLCESNQNEIELHDTNIVAFKCLLKYIYS 183
           DV L + G+K N    +    +  FRALL+GG+ ES QN IEL    + AFK LLKYIY+
Sbjct: 33  DVTLVVAGQKFNTHKLILAARSDYFRALLFGGMRESTQNVIELPSATLPAFKGLLKYIYT 92

Query: 184 GKLSFRNLKDDVILDILGLSHKYGFQDLENSISDYLRVILTVHNACSIFDCAYYYDLKQL 243
           G++S  N +D+VILD LGL+H YGF DLE +ISDYLR IL++ N C I D A+ Y L  L
Sbjct: 93  GRMSLANERDEVILDTLGLAHLYGFLDLEAAISDYLREILSIKNVCLIIDTAFLYQLDFL 152

Query: 244 NKIVLSFIDYNAKQIISENSFYNLSQNGLIQLIQRDSFYAPEIDIFRAVVDWIKANSPEV 303
            ++ L ++D +A ++I   +F  LS   L +LI RDSFYAPEIDIF AV  W+KAN PEV
Sbjct: 153 TRVCLEYMDKHAPEVIQHENFLQLSPEALNKLISRDSFYAPEIDIFLAVESWVKAN-PEV 211

Query: 304 EEDGESSFRAPINMDEILTYVRLPLISLDELLTTVRSSGIISADKILDAIELQTNDKVQY 363
                       N  E+L+ +RL LIS+ +LL  VR +G++S++ ILDAI  +T  +   
Sbjct: 212 ------------NASEVLSRLRLSLISITDLLNVVRPTGLVSSEAILDAISARTQTR--- 256

Query: 364 RANSPEVEEDGESSFRAPINMDEILTYVRLPLISLDELLTTVRSSGIISADKILDAIELQ 423
                    D E  +R  + +DE                                     
Sbjct: 257 ---------DSELEYRGRLLVDE------------------------------------- 270

Query: 424 TNDKVQYRGYLKPEENLATSKMGTMVMQGEMKNALLNGDVNNYDMENGYTRHTITEATSS 483
                          N+A    G  V+QGEM++ LLNGD  NYDME GYTRHTITE    
Sbjct: 271 ---------------NVAHPMHGAQVLQGEMRSYLLNGDTINYDMERGYTRHTITE---- 311

Query: 484 TSCDNGILIKLGTQAIVNHIKLLLWDKDLRSYSYFIEVSIDQKKWTRVIDYTRFYCRSWQ 543
            S + GILIKLGTQ I+NH+K+LLWD+D+RSYSY+IE S+DQK W ++ID++ ++CRSWQ
Sbjct: 312 -SAEQGILIKLGTQCIINHVKMLLWDRDMRSYSYYIEGSMDQKDWVKLIDHSDYFCRSWQ 370

Query: 544 FLYFPTQVVQYIRVVGTNNTVNKVFHIVSFEIMYTAQTVQLSEEGIIIPKHNVATRELSA 603
           +LYF  +VV YIR+VGTNNTVN+VFH+V+FE  YT  T +LS +G ++P  NVA  E SA
Sbjct: 371 YLYFEPRVVLYIRIVGTNNTVNRVFHVVNFEAYYTNHTEELS-DGFVVPTQNVAVAERSA 429

Query: 604 KVVEGVSRSLSSLIDGNTVKYDWDSGYTCHQLGSGAILVQLGQPYMLDSMRLLLWDCDDR 663
            V+EGVSRS ++L++G+T  YDWDSGYTCHQLGSGAILVQLGQPYM+ SMRLLLWDCD+R
Sbjct: 430 CVIEGVSRSRNNLLNGDTSNYDWDSGYTCHQLGSGAILVQLGQPYMIHSMRLLLWDCDNR 489

Query: 664 SYSYLVDVSINLWDWEIVADHTRDLCRSWQSISFS-RRPVVFVRIIGTHNTMNEVFHCVH 722
           SYSY ++V+ N WDW ++AD TR+ CRSWQ+I  +  RPVV++RI+GTHNT NEVFHCVH
Sbjct: 490 SYSYYIEVAGNTWDWSVIADKTRESCRSWQTIHINPPRPVVYIRIVGTHNTANEVFHCVH 549

Query: 723 FECPDQ 728
           FECP Q
Sbjct: 550 FECPAQ 555




Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383862423|ref|XP_003706683.1| PREDICTED: BTB/POZ domain-containing protein 9 [Megachile rotundata] Back     alignment and taxonomy information
>gi|66564756|ref|XP_395842.2| PREDICTED: BTB/POZ domain-containing protein 9 [Apis mellifera] Back     alignment and taxonomy information
>gi|350413268|ref|XP_003489942.1| PREDICTED: BTB/POZ domain-containing protein 9-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380023366|ref|XP_003695494.1| PREDICTED: BTB/POZ domain-containing protein 9 [Apis florea] Back     alignment and taxonomy information
>gi|340708503|ref|XP_003392865.1| PREDICTED: BTB/POZ domain-containing protein 9-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|291226013|ref|XP_002732994.1| PREDICTED: CG1826-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|357622576|gb|EHJ74003.1| hypothetical protein KGM_13514 [Danaus plexippus] Back     alignment and taxonomy information
>gi|190360739|ref|NP_001121970.1| BTB/POZ domain-containing protein 9 [Bos taurus] gi|218563527|sp|A4IFG2.2|BTBD9_BOVIN RecName: Full=BTB/POZ domain-containing protein 9 gi|158455144|gb|AAI34568.2| BTBD9 protein [Bos taurus] Back     alignment and taxonomy information
>gi|301782813|ref|XP_002926823.1| PREDICTED: BTB/POZ domain-containing protein 9-like [Ailuropoda melanoleuca] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query765
UNIPROTKB|A4IFG2611 BTBD9 "BTB/POZ domain-containi 0.475 0.595 0.580 9.3e-165
UNIPROTKB|Q96Q07612 BTBD9 "BTB/POZ domain-containi 0.444 0.555 0.604 8.3e-164
RGD|1306975612 Btbd9 "BTB (POZ) domain contai 0.475 0.594 0.581 1.7e-163
MGI|MGI:1916625612 Btbd9 "BTB (POZ) domain contai 0.475 0.594 0.576 1.5e-162
UNIPROTKB|Q5ZK96647 BTBD9 "Uncharacterized protein 0.445 0.527 0.594 2.9e-161
UNIPROTKB|E1C497650 BTBD9 "Uncharacterized protein 0.445 0.524 0.589 6.8e-160
ZFIN|ZDB-GENE-040704-39602 btbd9 "BTB (POZ) domain contai 0.457 0.581 0.572 4.8e-157
FB|FBgn0030228 722 BTBD9 "BTB (POZ) domain contai 0.453 0.480 0.556 5.3e-132
WB|WBGene00015463581 hpo-9 [Caenorhabditis elegans 0.305 0.402 0.429 2.1e-94
UNIPROTKB|I3LAI4228 BTBD9 "Uncharacterized protein 0.228 0.767 0.664 8.5e-65
UNIPROTKB|A4IFG2 BTBD9 "BTB/POZ domain-containing protein 9" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 1160 (413.4 bits), Expect = 9.3e-165, Sum P(2) = 9.3e-165
 Identities = 217/374 (58%), Positives = 283/374 (75%)

Query:   383 NMDEILTYVRLPLISLDELLTTVRSSGIISADKILDAIELQTNDK---VQYRGYLKPEEN 439
             N  EI+  VRLPL+SL ELL  VR SG++S D ILDAI++++  +   + YRG L PEEN
Sbjct:   217 NHAEIMQAVRLPLMSLTELLNVVRPSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEEN 276

Query:   440 LATSKMGTMVMQGEMKNALLNGDVNNYDMENGYTRHTITEATSSTSCDNGILIKLGTQAI 499
             +AT K G  V++GE+K+ALL+GD  NYD+++G++RH I +      C +GI IKLG  +I
Sbjct:   277 IATMKYGAQVVKGELKSALLDGDTQNYDLDHGFSRHPIDD-----DCRSGIEIKLGQPSI 331

Query:   500 VNHIKLLLWDKDLRSYSYFIEVSIDQKKWTRVIDYTRFYCRSWQFLYFPTQVVQYIRVVG 559
             +NHI++LLWD+D RSYSYFIEVS+D+  W RVID++++ CRSWQ LYFP +V +YIR+VG
Sbjct:   332 INHIRILLWDRDSRSYSYFIEVSMDELDWIRVIDHSQYLCRSWQKLYFPARVCRYIRIVG 391

Query:   560 TNNTVNKVFHIVSFEIMYTAQTVQLSEEGIIIPKHNVATRELSAKVVEGVSRSLSSLIDG 619
             T+NTVNK+FHIV+FE M+T +T  L E+G+I+P  NVAT    A V+EGVSRS ++L++G
Sbjct:   392 THNTVNKIFHIVAFECMFTNKTFTL-EKGLIVPMENVATIADCASVIEGVSRSRNALLNG 450

Query:   620 NTVKYDWDSGYTCHQLGSGAILVQLGQPYMLDSMRLLLWDCDDRSYSYLVDVSINLWDWE 679
             +T  YDWDS YTCHQLGSGAI+VQL QPYM+ S+RLLLWDCDDRSYSY V+VS N   W 
Sbjct:   451 DTKNYDWDSSYTCHQLGSGAIVVQLAQPYMIGSIRLLLWDCDDRSYSYYVEVSTNQQQWT 510

Query:   680 IVADHTRDLCRSWQSISFSRRPVVFVRIIGTHNTMNEVFHCVHFECPDQ-SIKLPSAGQP 738
             +VAD T+  C+SWQS++F RRP  F+RI+GTHNT NEVFHCVHFECP+Q S +  S+ +P
Sbjct:   511 MVADRTKVSCKSWQSVTFERRPASFIRIVGTHNTANEVFHCVHFECPEQQSAQKDSSDEP 570

Query:   739 SPSCLSVVTAQFQP 752
                  S    Q  P
Sbjct:   571 GTGGASAAGQQLDP 584


GO:0007155 "cell adhesion" evidence=IEA
UNIPROTKB|Q96Q07 BTBD9 "BTB/POZ domain-containing protein 9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1306975 Btbd9 "BTB (POZ) domain containing 9" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1916625 Btbd9 "BTB (POZ) domain containing 9" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZK96 BTBD9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C497 BTBD9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040704-39 btbd9 "BTB (POZ) domain containing 9" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0030228 BTBD9 "BTB (POZ) domain containing 9 ortholog" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00015463 hpo-9 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|I3LAI4 BTBD9 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q96Q07BTBD9_HUMANNo assigned EC number0.47770.65350.8169yesN/A
Q5PQR3BTBD9_RATNo assigned EC number0.46390.68490.8562yesN/A
Q8C726BTBD9_MOUSENo assigned EC number0.46510.66790.8349yesN/A
A4IFG2BTBD9_BOVINNo assigned EC number0.46790.68490.8576yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query765
pfam00651101 pfam00651, BTB, BTB/POZ domain 8e-18
pfam07707101 pfam07707, BACK, BTB And C-terminal Kelch 3e-17
smart0022597 smart00225, BTB, Broad-Complex, Tramtrack and Bric 3e-16
smart00875101 smart00875, BACK, BTB And C-terminal Kelch 1e-14
smart0022597 smart00225, BTB, Broad-Complex, Tramtrack and Bric 7e-07
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 4e-06
pfam00651101 pfam00651, BTB, BTB/POZ domain 9e-06
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 4e-04
>gnl|CDD|216043 pfam00651, BTB, BTB/POZ domain Back     alignment and domain information
 Score = 79.2 bits (196), Expect = 8e-18
 Identities = 31/85 (36%), Positives = 44/85 (51%), Gaps = 4/85 (4%)

Query: 49  NLYLNDEFSDTVLIVQNEKISVHKVILAARSEYFRALLYGGLCESNQNEIELHDTNIVAF 108
            L  N E  D  L+V +++   HK +LAA S YF+AL  G        EI L D +   F
Sbjct: 3   ELRENGELCDVTLVVGDKEFHAHKAVLAACSPYFKALFTGNKEV----EITLEDVSPEDF 58

Query: 109 KCLLKYIYSGKLSFRNLKDDVILDI 133
           + LL++IY+GKL       D +L +
Sbjct: 59  EALLEFIYTGKLEITEENVDDLLAL 83


The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain is present near the N-terminus of a fraction of zinc finger (pfam00096) proteins and in proteins that contain the pfam01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT. The POZ or BTB domain is also known as BR-C/Ttk or ZiN. Length = 101

>gnl|CDD|149006 pfam07707, BACK, BTB And C-terminal Kelch Back     alignment and domain information
>gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>gnl|CDD|197943 smart00875, BACK, BTB And C-terminal Kelch Back     alignment and domain information
>gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|216043 pfam00651, BTB, BTB/POZ domain Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 765
KOG4350|consensus620 100.0
KOG4441|consensus571 100.0
KOG4350|consensus 620 100.0
PHA02713557 hypothetical protein; Provisional 100.0
PHA03098534 kelch-like protein; Provisional 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
PHA02713557 hypothetical protein; Provisional 100.0
KOG4441|consensus571 99.96
KOG2075|consensus521 99.95
PHA03098534 kelch-like protein; Provisional 99.94
PHA02790480 Kelch-like protein; Provisional 99.92
KOG0783|consensus1267 99.88
KOG4591|consensus280 99.76
KOG4682|consensus488 99.71
PF00651111 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( 99.69
smart0022590 BTB Broad-Complex, Tramtrack and Bric a brac. Doma 99.47
PF07707103 BACK: BTB And C-terminal Kelch; InterPro: IPR01170 99.43
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 99.29
smart00875101 BACK BTB And C-terminal Kelch. The BACK domain is 99.27
KOG2838|consensus401 99.24
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 99.17
KOG0511|consensus516 99.1
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 99.08
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 99.04
PLN02153341 epithiospecifier protein 99.02
PLN02193470 nitrile-specifier protein 99.01
PLN02153341 epithiospecifier protein 98.99
KOG2075|consensus521 98.94
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 98.92
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 98.89
PF00754129 F5_F8_type_C: F5/8 type C domain; InterPro: IPR000 98.85
cd00057143 FA58C Substituted updates: Jan 31, 2002 98.78
KOG0783|consensus1267 98.73
PLN02193470 nitrile-specifier protein 98.62
smart0061247 Kelch Kelch domain. 98.02
KOG4693|consensus392 98.02
KOG4682|consensus488 98.01
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 97.79
smart00231139 FA58C Coagulation factor 5/8 C-terminal domain, di 97.7
KOG2716|consensus230 97.65
KOG0379|consensus482 97.63
PF1396450 Kelch_6: Kelch motif 97.62
PF00651111 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( 97.58
PF1396450 Kelch_6: Kelch motif 97.57
smart00607151 FTP eel-Fucolectin Tachylectin-4 Pentaxrin-1 Domai 97.45
PF1341549 Kelch_3: Galactose oxidase, central domain 97.3
KOG1230|consensus521 97.29
PF0221494 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassi 97.21
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 97.1
KOG0511|consensus516 97.05
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 97.04
smart0022590 BTB Broad-Complex, Tramtrack and Bric a brac. Doma 97.03
KOG2838|consensus401 96.97
KOG0379|consensus482 96.92
PF07707103 BACK: BTB And C-terminal Kelch; InterPro: IPR01170 96.78
KOG1987|consensus297 96.74
PF11822317 DUF3342: Domain of unknown function (DUF3342); Int 96.47
KOG1230|consensus521 96.3
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 96.05
smart00875101 BACK BTB And C-terminal Kelch. The BACK domain is 95.69
cd00057143 FA58C Substituted updates: Jan 31, 2002 95.68
PF00754129 F5_F8_type_C: F5/8 type C domain; InterPro: IPR000 95.65
KOG4693|consensus392 95.54
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 95.33
KOG1724|consensus162 95.31
smart00512104 Skp1 Found in Skp1 protein family. Family of Skp1 95.09
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 95.03
KOG3473|consensus112 94.96
PF1385442 Kelch_5: Kelch motif 94.65
PLN02772398 guanylate kinase 94.56
KOG2714|consensus465 94.43
PF0393162 Skp1_POZ: Skp1 family, tetramerisation domain; Int 94.37
KOG4276|consensus113 93.5
PF13163429 DUF3999: Protein of unknown function (DUF3999) 92.88
cd08366139 APC10 APC10 subunit of the anaphase-promoting comp 92.16
PF07738135 Sad1_UNC: Sad1 / UNC-like C-terminal ; InterPro: I 91.71
KOG1665|consensus302 90.97
KOG4152|consensus 830 90.15
COG3055381 Uncharacterized protein conserved in bacteria [Fun 87.86
smart0061247 Kelch Kelch domain. 87.82
PF1341549 Kelch_3: Galactose oxidase, central domain 87.69
COG5201158 SKP1 SCF ubiquitin ligase, SKP1 component [Posttra 87.43
PF0146678 Skp1: Skp1 family, dimerisation domain; InterPro: 86.63
smart00231139 FA58C Coagulation factor 5/8 C-terminal domain, di 83.79
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 82.85
PF06588199 Muskelin_N: Muskelin N-terminus; InterPro: IPR0105 82.07
KOG1778|consensus319 81.92
KOG2716|consensus230 81.06
>KOG4350|consensus Back     alignment and domain information
Probab=100.00  E-value=4.1e-142  Score=1085.14  Aligned_cols=549  Identities=51%  Similarity=0.920  Sum_probs=523.7

Q ss_pred             CCCccchHHHHHHHHHHHHcCCCCccEEEEECCEEEEeehhHHHhcCHHHHHHhcCCccCCCCeeEEecCCCHHHHHHHH
Q psy12546         33 HSYEIEHVQFLSEMIGNLYLNDEFSDTVLIVQNEKISVHKVILAARSEYFRALLYGGLCESNQNEIELHDTNIVAFKCLL  112 (765)
Q Consensus        33 ~~~~~~~~~~l~~~l~~l~~~~~~sDv~~~v~~~~~~aHr~ILaarS~yF~~lf~~~~~es~~~~I~l~~v~~~~f~~lL  112 (765)
                      .....+....|++++..++.+++++||+|+|++++|||||.|||+||.|||+|++|||.|+.+..|.|++...++|    
T Consensus        21 ~t~~~~i~~~fS~~~~~l~~~e~y~DVtfvve~~rfpAHRvILAaRs~yFRAlLYgGm~Es~q~~ipLq~t~~eAF----   96 (620)
T KOG4350|consen   21 RTESAAISNNFSQSFDELFTSEDYSDVTFVVEDTRFPAHRVILAARSSYFRALLYGGMQESHQQLIPLQETNSEAF----   96 (620)
T ss_pred             hhhhhhhccchhHHHHHHhhcCcccceEEEEeccccchhhhhHHHHHHHHHHHHhhhhhhhhhcccccccccHHHH----
Confidence            3455667778899999999999999999999999999999999999999999999999999988999988888888    


Q ss_pred             HHHhcCCccccCcchhHHHHHhhhccCCCCcchHhHHHhhhcCcccCCccccccccccHHHHHHHHHhHhcCceecccCC
Q psy12546        113 KYIYSGKLSFRNLKDDVILDILGKKQNKGTTLTQNFRALLYGGLCESNQNEIELHDTNIVAFKCLLKYIYSGKLSFRNLK  192 (765)
Q Consensus       113 ~ylYtg~l~~~~~~~~~ll~i~~~~~~~~~~~S~yF~amf~~~~~Es~~~~i~l~~v~~~~f~~lL~yiYtg~i~l~~~~  192 (765)
                                                                                    +.+|+|||||++.+++++
T Consensus        97 --------------------------------------------------------------~~lLrYiYtg~~~l~~~~  114 (620)
T KOG4350|consen   97 --------------------------------------------------------------RALLRYIYTGKIDLAGVE  114 (620)
T ss_pred             --------------------------------------------------------------HHHHHHHhhcceecccch
Confidence                                                                          666666666667776778


Q ss_pred             hhHHHHHHHHHhhhCcHHHHHHHHHHHHhhcChhhHHHHHHHHHHcCcHHHHHHHHHHHhcccccccCccccccCCHHHH
Q psy12546        193 DDVILDILGLSHKYGFQDLENSISDYLRVILTVHNACSIFDCAYYYDLKQLNKIVLSFIDYNAKQIISENSFYNLSQNGL  272 (765)
Q Consensus       193 ~~~vl~ll~~A~~~~l~~L~~~c~~~L~~~l~~~nv~~il~~A~~~~~~~L~~~c~~fi~~n~~~v~~~~~f~~L~~~~l  272 (765)
                      ++.++++|.+|++|++.+|+.++.+||+..|..+|+|.++.+|..|++++|...|+.|+.+|+.+++..+.|..|+.+.|
T Consensus       115 ed~lld~LslAh~Ygf~~Le~aiSeYl~~iL~~~NvCmifdaA~ly~l~~Lt~~C~mfmDrnA~~lL~~~sFn~LSk~sL  194 (620)
T KOG4350|consen  115 EDILLDYLSLAHRYGFIQLETAISEYLKEILKNENVCMIFDAAYLYQLTDLTDYCMMFMDRNADQLLEDPSFNRLSKDSL  194 (620)
T ss_pred             HHHHHHHHHHHHhcCcHHHHHHHHHHHHHHHcccceeeeeeHHHHhcchHHHHHHHHHHhcCHHhhhcCcchhhhhHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhccCCCCCCHHHHHHHHHHHHhhCCCcccccCCcccCCCCchhhhhccccCCCCCHHHHHHhcccCCCCChhHHHHH
Q psy12546        273 IQLIQRDSFYAPEIDIFRAVVDWIKANSPEVEEDGESSFRAPINMDEILTYVRLPLISLDELLTTVRSSGIISADKILDA  352 (765)
Q Consensus       273 ~~ll~~d~l~v~E~~l~~av~~Wi~~n~~~~~~~~~~~~~~~~~~~~ll~~VR~~lls~~~L~~~v~~~~l~~~~~i~~a  352 (765)
                      .+++.+|.|.++|.+||.|+.+|.++|..+             ..+.+++.||+|+|+..+|+++|++++|++++.|++|
T Consensus       195 ~e~l~RDsFfApE~~IFlAv~~W~~~Nske-------------~~k~~~~~VRLPLm~lteLLnvVRPsGllspD~iLDA  261 (620)
T KOG4350|consen  195 KELLARDSFFAPELKIFLAVRSWHQNNSKE-------------ASKVLLELVRLPLMTLTELLNVVRPSGLLSPDTILDA  261 (620)
T ss_pred             HHHHhhhcccchHHHHHHHHHHHHhcCchh-------------hHHHHHHHHhhhhccHHHHHhccCcccCcCHHHHHHH
Confidence            999999999999999999999999999532             6789999999999999999999999999999999999


Q ss_pred             HHhhcccccccccCCCcccccCCcccccccccccccceecccccCccceeeeeeccccccchhhHhHhhhccccCcCCCc
Q psy12546        353 IELQTNDKVQYRANSPEVEEDGESSFRAPINMDEILTYVRLPLISLDELLTTVRSSGIISADKILDAIELQTNDKVQYRG  432 (765)
Q Consensus       353 i~~~~~~~~~f~~~~~~~~~~~~~~~R~~~~~~~ll~~VRlpli~~~~l~~~v~~~~l~~~~~l~ea~~~~~~~~l~~~~  432 (765)
                      |..+.+.+                                                                 +.+|+|+
T Consensus       262 I~vrs~s~-----------------------------------------------------------------~~lpyRg  276 (620)
T KOG4350|consen  262 IEVRSQSP-----------------------------------------------------------------HELPYRG  276 (620)
T ss_pred             HHhhccCc-----------------------------------------------------------------ccCCccc
Confidence            98554321                                                                 5799999


Q ss_pred             cCCCCccccccCCcEEEEeeccCCccCCCCeeeecCCCCeeeecccccCCCCCCCccEEEEcCeeEEEcceeeeeecCCC
Q psy12546        433 YLKPEENLATSKMGTMVMQGEMKNALLNGDVNNYDMENGYTRHTITEATSSTSCDNGILIKLGTQAIVNHIKLLLWDKDL  512 (765)
Q Consensus       433 ~~~~~~~~a~~~~~~~viGG~~~~~~l~~~v~~YD~~~~~W~~~~~~~m~~~R~~~~vvvl~g~iYiiGG~~~~~~~~~~  512 (765)
                      ++.|+.|+++...++.++.|+.++++++|++..||...|+.+|.+.+     -+..|+.+..|+.++|+.|++++||+|+
T Consensus       277 ~l~peeNia~~~~~aq~~~ge~r~alldgd~~~ydl~~gysRh~i~D-----~~~sgi~i~LG~p~iINhIrmllWdrds  351 (620)
T KOG4350|consen  277 CLSPEENIAPHYPHAQPLSGECRDALLDGDVTTYDLSNGYSRHCIND-----ENISGIQIDLGKPFIINHIRMLLWDRDS  351 (620)
T ss_pred             ccCchhcccccccccccccchhhhhhccCCcceeecccCccccccCc-----ccceeEEEecCCchhhhhhhhhhhcccc
Confidence            99999999999999999999999999999999999999999998874     5778999999999999999999999999


Q ss_pred             ceeeEEEEEEecCCCeEEEecccccccCceEEEEeecccEEEEEEEeecCCcceeEEEEEEEEEeecccccccCCccccc
Q psy12546        513 RSYSYFIEVSIDQKKWTRVIDYTRFYCRSWQFLYFPTQVVQYIRVVGTNNTVNKVFHIVSFEIMYTAQTVQLSEEGIIIP  592 (765)
Q Consensus       513 ~~y~y~v~vs~~~~~W~~v~~~~~~~~~~~~~~~f~~~~~ryI~ivg~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~p  592 (765)
                      ++|+|+||||+|+.+|.+|+|++.|.||+||.+||++|+|||||+||++|++|..||.+.+|||+++++++++ .++++|
T Consensus       352 raysY~veVSmD~~hW~rV~DyS~Y~CRswQ~LyF~arvvR~Irlvgt~Ntvn~~fh~v~~EaMft~kt~~le-~~~ivP  430 (620)
T KOG4350|consen  352 RAYSYQVEVSMDDAHWNRVADYSEYDCRSWQRLYFTARVVRHIRLVGTNNTVNCKFHGVRIEAMFTTKTMPLE-HKVIVP  430 (620)
T ss_pred             cceEEEEEEecchhhhHHhhhhhhhccccceeeeeecceeEEEEEEeeccceeeEEEEEEEEEEecccccccc-ceeecc
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999 999999


Q ss_pred             CCcccccccceeEeecccccccccccCCcccccCCCCCcccccCCccEEEecCCceeeccEEEEeeecCCCeeeEEEEEE
Q psy12546        593 KHNVATRELSAKVVEGVSRSLSSLIDGNTVKYDWDSGYTCHQLGSGAILVQLGQPYMLDSMRLLLWDCDDRSYSYLVDVS  672 (765)
Q Consensus       593 ~~nva~~~~~~~~~~g~~~~~~~~~~gd~~~~~w~~g~~~~~~~~~~i~v~l~~~y~i~~~~~~~w~~~~~~y~y~i~vs  672 (765)
                      ..||||++++|.|++|+||+||||||||..+||||+||||||+|+|.|+|||||||+||+|||||||||+|+||||||||
T Consensus       431 ~~NvaTie~~A~V~eGVSR~RNALiNGD~~~YDWDsGYTCHQlGSG~IvvqLaQPY~igSmRlLLWdCDDR~YSyYvevS  510 (620)
T KOG4350|consen  431 HRNVATIENHARVVEGVSRCRNALINGDSSSYDWDSGYTCHQLGSGLIVVQLAQPYIIGSMRLLLWDCDDRFYSYYVEVS  510 (620)
T ss_pred             ccchhhhhhhhHhhhhhhhhhhhhccCCcccccCcCCcchhhcCCceEEEEecCceeeeeeeEEEEecCCCceeEEEEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ecCCcceeeeeccCccccceEEEEeecCCEEEEEEEeccCCcceeEEEEeeeecCCCCC
Q psy12546        673 INLWDWEIVADHTRDLCRSWQSISFSRRPVVFVRIIGTHNTMNEVFHCVHFECPDQSIK  731 (765)
Q Consensus       673 ~d~~~w~~v~~~~~~~~~~~~~~~f~~~~~~~ir~~~~~~~~~~~~~~~~~e~~~~~~~  731 (765)
                      +|++.|++|+|+++..|+|||+++|+|+||+|||||||+|++|++|||||||||+|++.
T Consensus       511 tNq~eW~mvvDRtn~~c~sWQ~~~F~p~PvvyIRiVGTrNtaNEvFHcVHlEcP~q~~~  569 (620)
T KOG4350|consen  511 TNQDEWVMVVDRTNEECHSWQELIFDPLPVVYIRIVGTRNTANEVFHCVHLECPSQVPI  569 (620)
T ss_pred             eCchheEEeeecccccccchhheeecCCceEEEEEEeccccccceeEEEEeecCccChh
Confidence            99999999999999999999999999999999999999999999999999999999854



>KOG4441|consensus Back     alignment and domain information
>KOG4350|consensus Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>KOG2075|consensus Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG4591|consensus Back     alignment and domain information
>KOG4682|consensus Back     alignment and domain information
>PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins Back     alignment and domain information
>smart00225 BTB Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>PF07707 BACK: BTB And C-terminal Kelch; InterPro: IPR011705 This domain is found associated with (IPR000210 from INTERPRO) and (IPR006652 from INTERPRO) Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>smart00875 BACK BTB And C-terminal Kelch Back     alignment and domain information
>KOG2838|consensus Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>KOG2075|consensus Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PF00754 F5_F8_type_C: F5/8 type C domain; InterPro: IPR000421 Blood coagulation factors V and VIII contain a C-terminal, twice repeated, domain of about 150 amino acids, which is called F5/8 type C, FA58C, or C1/C2- like domain Back     alignment and domain information
>cd00057 FA58C Substituted updates: Jan 31, 2002 Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>KOG4693|consensus Back     alignment and domain information
>KOG4682|consensus Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>smart00231 FA58C Coagulation factor 5/8 C-terminal domain, discoidin domain Back     alignment and domain information
>KOG2716|consensus Back     alignment and domain information
>KOG0379|consensus Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>smart00607 FTP eel-Fucolectin Tachylectin-4 Pentaxrin-1 Domain Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>KOG1230|consensus Back     alignment and domain information
>PF02214 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>smart00225 BTB Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>KOG2838|consensus Back     alignment and domain information
>KOG0379|consensus Back     alignment and domain information
>PF07707 BACK: BTB And C-terminal Kelch; InterPro: IPR011705 This domain is found associated with (IPR000210 from INTERPRO) and (IPR006652 from INTERPRO) Back     alignment and domain information
>KOG1987|consensus Back     alignment and domain information
>PF11822 DUF3342: Domain of unknown function (DUF3342); InterPro: IPR021777 This family of proteins are functionally uncharacterised Back     alignment and domain information
>KOG1230|consensus Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>smart00875 BACK BTB And C-terminal Kelch Back     alignment and domain information
>cd00057 FA58C Substituted updates: Jan 31, 2002 Back     alignment and domain information
>PF00754 F5_F8_type_C: F5/8 type C domain; InterPro: IPR000421 Blood coagulation factors V and VIII contain a C-terminal, twice repeated, domain of about 150 amino acids, which is called F5/8 type C, FA58C, or C1/C2- like domain Back     alignment and domain information
>KOG4693|consensus Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>KOG1724|consensus Back     alignment and domain information
>smart00512 Skp1 Found in Skp1 protein family Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>KOG3473|consensus Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>KOG2714|consensus Back     alignment and domain information
>PF03931 Skp1_POZ: Skp1 family, tetramerisation domain; InterPro: IPR016073 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>KOG4276|consensus Back     alignment and domain information
>PF13163 DUF3999: Protein of unknown function (DUF3999) Back     alignment and domain information
>cd08366 APC10 APC10 subunit of the anaphase-promoting complex (APC) that mediates substrate ubiquitination Back     alignment and domain information
>PF07738 Sad1_UNC: Sad1 / UNC-like C-terminal ; InterPro: IPR012919 The Caenorhabditis elegans UNC-84 protein is a nuclear envelope protein that is involved in nuclear anchoring and migration during development Back     alignment and domain information
>KOG1665|consensus Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>COG5201 SKP1 SCF ubiquitin ligase, SKP1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01466 Skp1: Skp1 family, dimerisation domain; InterPro: IPR016072 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>smart00231 FA58C Coagulation factor 5/8 C-terminal domain, discoidin domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF06588 Muskelin_N: Muskelin N-terminus; InterPro: IPR010565 This entry represents the N-terminal region of muskelin and is found in conjunction with several IPR006652 from INTERPRO repeats Back     alignment and domain information
>KOG1778|consensus Back     alignment and domain information
>KOG2716|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query765
3hqi_A312 Structures Of Spop-Substrate Complexes: Insights In 8e-10
3hqi_A312 Structures Of Spop-Substrate Complexes: Insights In 7e-07
4eoz_A145 Crystal Structure Of The Spop Btb Domain Complexed 1e-09
4eoz_A145 Crystal Structure Of The Spop Btb Domain Complexed 4e-04
3htm_A172 Structures Of Spop-Substrate Complexes: Insights In 1e-07
3hve_A256 Structures Of Spop-Substrate Complexes: Insights In 3e-05
2ppi_A144 Structure Of The Btb (Tramtrack And Bric A Brac) Do 6e-04
>pdb|3HQI|A Chain A, Structures Of Spop-Substrate Complexes: Insights Into Molecular Architectures Of Btb-Cul3 Ubiquitin Ligases: SpopmathxBTB3-Box-Pucsbc1 Length = 312 Back     alignment and structure

Iteration: 1

Score = 62.8 bits (151), Expect = 8e-10, Method: Compositional matrix adjust. Identities = 31/89 (34%), Positives = 52/89 (58%), Gaps = 1/89 (1%) Query: 43 LSEMIGNLYLNDEFSDTVLIVQNEKISVHKVILAARSEYFRALLYGGLCESNQNEIELHD 102 L++ +G L+ N F+D L V ++ HK ILAARS F A+ + ES +N +E++D Sbjct: 161 LADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEIND 220 Query: 103 TNIVAFKCLLKYIYSGKL-SFRNLKDDVI 130 FK ++ +IY+GK + + DD++ Sbjct: 221 VEPEVFKEMMCFIYTGKAPNLDKMADDLL 249
>pdb|3HQI|A Chain A, Structures Of Spop-Substrate Complexes: Insights Into Molecular Architectures Of Btb-Cul3 Ubiquitin Ligases: SpopmathxBTB3-Box-Pucsbc1 Length = 312 Back     alignment and structure
>pdb|4EOZ|A Chain A, Crystal Structure Of The Spop Btb Domain Complexed With The Cul3 N- Terminal Domain Length = 145 Back     alignment and structure
>pdb|4EOZ|A Chain A, Crystal Structure Of The Spop Btb Domain Complexed With The Cul3 N- Terminal Domain Length = 145 Back     alignment and structure
>pdb|3HTM|A Chain A, Structures Of Spop-Substrate Complexes: Insights Into Molecular Architectures Of Btb-Cul3 Ubiquitin Ligases: Spopbtb3-Box Length = 172 Back     alignment and structure
>pdb|3HVE|A Chain A, Structures Of Spop-Substrate Complexes: Insights Into Molecular Architectures Of Btb-Cul3 Ubiquitin Ligases: Gigaxoninbtb3-Box Length = 256 Back     alignment and structure
>pdb|2PPI|A Chain A, Structure Of The Btb (Tramtrack And Bric A Brac) Domain Of Human Gigaxonin Length = 144 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query765
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 3e-27
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 1e-16
3hve_A256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 5e-26
3hve_A256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 5e-18
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 6e-26
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 1e-23
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 2e-25
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 3e-17
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 1e-22
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 2e-13
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 2e-21
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 2e-09
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 2e-21
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 4e-21
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 1e-20
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 6e-08
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 1e-19
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 2e-06
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 7e-18
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 4e-06
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 1e-17
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 4e-06
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 1e-17
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 2e-06
2vpk_A116 Myoneurin; transcription regulation, transcription 2e-17
2vpk_A116 Myoneurin; transcription regulation, transcription 6e-06
3b84_A119 Zinc finger and BTB domain-containing protein 48; 6e-17
3b84_A119 Zinc finger and BTB domain-containing protein 48; 1e-05
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 6e-17
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 3e-05
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 6e-17
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 7e-06
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 7e-17
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 8e-06
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 4e-16
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 3e-04
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 3e-14
2jda_A145 Yecbm32; hypothetical protein, carbohydrate- bindi 2e-13
2jda_A145 Yecbm32; hypothetical protein, carbohydrate- bindi 8e-09
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
4a3z_A161 GH89_CBM32, alpha-N-acetylglucosaminidase family p 2e-08
4a4a_A 914 Alpha-N-acetylglucosaminidase family protein; hydr 1e-07
4a4a_A 914 Alpha-N-acetylglucosaminidase family protein; hydr 8e-04
4a41_A161 GH89_CBM32-5, alpha-N-acetylglucosaminidase family 2e-07
4a41_A161 GH89_CBM32-5, alpha-N-acetylglucosaminidase family 1e-05
4a42_A149 GH89_CBM32-4, alpha-N-acetylglucosaminidase family 7e-07
2eqx_A105 Kelch repeat and BTB domain-containing protein 4; 1e-06
2j1a_A150 Hyaluronidase, CBM32; protein-carbohydrate interac 3e-06
2j1a_A150 Hyaluronidase, CBM32; protein-carbohydrate interac 1e-05
3f2z_A159 Uncharacterized protein BF3579; the present C-term 4e-06
3f2z_A159 Uncharacterized protein BF3579; the present C-term 2e-04
3ggl_A169 Putative chitobiase; X-RAY, structure genomics, NE 1e-05
3ggl_A169 Putative chitobiase; X-RAY, structure genomics, NE 3e-05
2zxq_A1376 Endo-alpha-N-acetylgalactosaminidase; broken TIM b 1e-04
2w1s_A192 Hyaluronoglucosaminidase; hexosaminidase, family 3 1e-04
2v5d_A737 O-GLCNACASE NAGJ; family 32 carbohydrate binding m 2e-04
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} Length = 279 Back     alignment and structure
 Score =  111 bits (279), Expect = 3e-27
 Identities = 40/207 (19%), Positives = 85/207 (41%), Gaps = 20/207 (9%)

Query: 148 FRALLYGGLCESNQNEIELHDTNIV------AFKCLLKYIYSGKLSFRNLKDDVILDILG 201
           F  LL G   ES    +E+   +          + +++Y+Y+G++    +    + ++L 
Sbjct: 61  FTPLLSGQFSESRSGRVEMRKWSSEPGPEPDTVEAVIEYMYTGRI---RVSTGSVHEVLE 117

Query: 202 LSHKYGFQDLENSISDYLRVILTVHNACSIFDCAYYYDLKQLNKIVLSFIDYNAKQIISE 261
           L+ ++    L+    ++L+  L + N  +I   A+ Y L QL       I  N  ++I +
Sbjct: 118 LADRFLLIRLKEFCGEFLKKKLHLSNCVAIHSLAHMYTLSQLALKAADMIRRNFHKVIQD 177

Query: 262 NSFYNLSQNGLIQLIQRDSFYAP-EIDIFRAVVDWIKANSPEVEEDGESSFRAPINMDEI 320
             FY L  + +   +         E  +F  V+ W++ N+ E         R     +E+
Sbjct: 178 EEFYTLPFHLIRDWLSDLEITVDSEEVLFETVLKWVQRNAEE---------RERY-FEEL 227

Query: 321 LTYVRLPLISLDELLTTVRSSGIISAD 347
              +RL  +    L   V+   +++ +
Sbjct: 228 FKLLRLSQMKPTYLTRHVKPERLVANN 254


>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} Length = 279 Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Length = 256 Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Length = 256 Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Length = 172 Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Length = 172 Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Length = 145 Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Length = 145 Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Length = 109 Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Length = 109 Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Length = 120 Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Length = 120 Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Length = 127 Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Length = 127 Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Length = 144 Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Length = 144 Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Length = 138 Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Length = 138 Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} PDB: 3ohv_A Length = 125 Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} PDB: 3ohv_A Length = 125 Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Length = 124 Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Length = 124 Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Length = 116 Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Length = 116 Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Length = 119 Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Length = 119 Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Length = 116 Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Length = 116 Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Length = 135 Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Length = 135 Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Length = 121 Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Length = 121 Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Length = 119 Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Length = 119 Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Length = 129 Back     alignment and structure
>2jda_A Yecbm32; hypothetical protein, carbohydrate- binding module, sugar-binding protein, pectin, plant cell WALL, galacturonic acid; 1.35A {Yersinia enterocolitica} PDB: 2jd9_A Length = 145 Back     alignment and structure
>2jda_A Yecbm32; hypothetical protein, carbohydrate- binding module, sugar-binding protein, pectin, plant cell WALL, galacturonic acid; 1.35A {Yersinia enterocolitica} PDB: 2jd9_A Length = 145 Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} Length = 119 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4a3z_A GH89_CBM32, alpha-N-acetylglucosaminidase family protein; hydrolase, family 32 carbohydrate-binding module; HET: MSE; 1.55A {Clostridium perfringens} PDB: 4a6o_A* Length = 161 Back     alignment and structure
>4a4a_A Alpha-N-acetylglucosaminidase family protein; hydrolase, 2 hydrolase, family 89 glycoside hydrolase, mucin carbohydrate-active enzyme; HET: NDG GAL; 1.90A {Clostridium perfringens} PDB: 2vcc_A 2vc9_A* 2vcb_A* 2vca_A Length = 914 Back     alignment and structure
>4a4a_A Alpha-N-acetylglucosaminidase family protein; hydrolase, 2 hydrolase, family 89 glycoside hydrolase, mucin carbohydrate-active enzyme; HET: NDG GAL; 1.90A {Clostridium perfringens} PDB: 2vcc_A 2vc9_A* 2vcb_A* 2vca_A Length = 914 Back     alignment and structure
>4a41_A GH89_CBM32-5, alpha-N-acetylglucosaminidase family protein; hydrolase, family 89 glycoside hydrolase, family 32 carbohyd binding module; HET: GAL; 1.55A {Clostridium perfringens} PDB: 4a44_A* 4a45_A* 4aax_A* Length = 161 Back     alignment and structure
>4a41_A GH89_CBM32-5, alpha-N-acetylglucosaminidase family protein; hydrolase, family 89 glycoside hydrolase, family 32 carbohyd binding module; HET: GAL; 1.55A {Clostridium perfringens} PDB: 4a44_A* 4a45_A* 4aax_A* Length = 161 Back     alignment and structure
>4a42_A GH89_CBM32-4, alpha-N-acetylglucosaminidase family protein; hydrolase, family 89 glycoside hydrolase, family 32 carbohyd binding module; HET: MSE; 1.55A {Clostridium perfringens} Length = 149 Back     alignment and structure
>2eqx_A Kelch repeat and BTB domain-containing protein 4; BACK domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2j1a_A Hyaluronidase, CBM32; protein-carbohydrate interaction, glycoside hydrolase, GH84C, hydrolase; HET: GAL; 1.49A {Clostridium perfringens} PDB: 2j1e_A* 2j7m_A* Length = 150 Back     alignment and structure
>2j1a_A Hyaluronidase, CBM32; protein-carbohydrate interaction, glycoside hydrolase, GH84C, hydrolase; HET: GAL; 1.49A {Clostridium perfringens} PDB: 2j1e_A* 2j7m_A* Length = 150 Back     alignment and structure
>3f2z_A Uncharacterized protein BF3579; the present C-terminal domain is predominantly composed of B strands., structural genomics, PSI-2; 1.30A {Bacteroides fragilis} PDB: 2kd7_A Length = 159 Back     alignment and structure
>3f2z_A Uncharacterized protein BF3579; the present C-terminal domain is predominantly composed of B strands., structural genomics, PSI-2; 1.30A {Bacteroides fragilis} PDB: 2kd7_A Length = 159 Back     alignment and structure
>3ggl_A Putative chitobiase; X-RAY, structure genomics, NESG, BTR324A, Q8A9F0_bactn, BT_0865, PSI-2, protein structure initiative; 3.00A {Bacteroides thetaiotaomicron} Length = 169 Back     alignment and structure
>3ggl_A Putative chitobiase; X-RAY, structure genomics, NESG, BTR324A, Q8A9F0_bactn, BT_0865, PSI-2, protein structure initiative; 3.00A {Bacteroides thetaiotaomicron} Length = 169 Back     alignment and structure
>2zxq_A Endo-alpha-N-acetylgalactosaminidase; broken TIM barrel, glycosidase, hydrolase; 2.00A {Bifidobacterium longum} Length = 1376 Back     alignment and structure
>2w1s_A Hyaluronoglucosaminidase; hexosaminidase, family 32 carbohydrate binding module, toxin, secreted, virulence, hydrolase, glycosidase; HET: MSE BTB; 1.45A {Clostridium perfringens} PDB: 2w1q_A* 2w1u_A* 2wdb_A* Length = 192 Back     alignment and structure
>2v5d_A O-GLCNACASE NAGJ; family 32 carbohydrate binding module, glycosidase, GH84, GH84C, CBM32, hydrolase, coiled coil; 3.30A {Clostridium perfringens} Length = 737 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query765
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 100.0
3hve_A256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 100.0
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 99.94
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 99.92
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 99.9
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 99.88
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 99.87
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 99.87
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 99.87
3b84_A119 Zinc finger and BTB domain-containing protein 48; 99.86
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 99.85
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 99.85
2vpk_A116 Myoneurin; transcription regulation, transcription 99.85
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 99.84
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 99.84
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 99.83
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 99.83
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 99.82
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 99.79
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 99.78
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 99.59
3hve_A256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 99.58
4a3z_A161 GH89_CBM32, alpha-N-acetylglucosaminidase family p 99.53
3cqo_A293 FBP32; F-lectin, fucolectin, sugar binding protein 99.47
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 99.41
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 99.39
2eqx_A105 Kelch repeat and BTB domain-containing protein 4; 99.37
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 99.36
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 99.35
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 99.34
4a41_A161 GH89_CBM32-5, alpha-N-acetylglucosaminidase family 99.34
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 99.34
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 99.33
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 99.31
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 99.3
4gwi_A153 Lectinolysin, platelet aggregation factor SM-HPAF; 99.29
3f2z_A159 Uncharacterized protein BF3579; the present C-term 99.28
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 99.27
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 99.27
3lei_A153 Platelet aggregation factor SM-HPAF; lectin domain 99.27
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 99.26
2ast_A159 S-phase kinase-associated protein 1A; SCF-substrat 99.24
4a42_A149 GH89_CBM32-4, alpha-N-acetylglucosaminidase family 99.23
2qqi_A318 Neuropilin-1; VEGF receptor, semaphorin receptor, 99.21
3ggl_A169 Putative chitobiase; X-RAY, structure genomics, NE 99.21
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 99.19
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 99.19
2j1a_A150 Hyaluronidase, CBM32; protein-carbohydrate interac 99.17
2j1v_A151 Fucolectin-related protein; carbohydrate-binding p 99.16
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 99.14
2jda_A145 Yecbm32; hypothetical protein, carbohydrate- bindi 99.14
2j22_A148 Fucolectin-related protein; carbohydrate-binding p 99.08
2qqj_A325 Neuropilin-2; VEGF receptor, semaphorin receptor, 99.03
1k12_A158 Lectin; beta barrel, protein carbohydrate complex, 99.02
2qqm_A450 Neuropilin-1; VEGF receptor, semaphorin receptor, 98.94
2v72_A143 CBM32, EXO-alpha-sialidase; galactose, bacterial p 98.93
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 98.92
4a4a_A 914 Alpha-N-acetylglucosaminidase family protein; hydr 98.91
3hnm_A172 Putative chitobiase; PSI-2, protein structure init 98.88
4ajy_C97 Transcription elongation factor B polypeptide 1; E 98.84
2qqo_A460 Neuropilin-2; VEGF receptor, semaphorin receptor, 98.83
1fs1_B141 SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le 98.77
1tvg_A153 LOC51668 protein; cell cycle, structural genomics, 98.76
2qqk_A579 Neuropilin-2; VEGF receptor, semaphorin receptor, 98.76
2v5d_A737 O-GLCNACASE NAGJ; family 32 carbohydrate binding m 98.7
1w8o_A601 Bacterial sialidase; 3D-structure, glycosidase, hy 98.68
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 98.67
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 98.62
3cqo_A 293 FBP32; F-lectin, fucolectin, sugar binding protein 98.6
2yc2_A139 IFT25, intraflagellar transport protein 25; transp 98.59
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 98.57
2p1m_A160 SKP1-like protein 1A; F-BOX, leucine rich repeat, 98.56
1sdd_B647 Coagulation factor V; copper-binding protein, cofa 98.55
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 98.51
3eyp_A469 Putative alpha-L-fucosidase; structural genomics, 98.5
2w1s_A192 Hyaluronoglucosaminidase; hexosaminidase, family 3 98.49
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 98.49
4gz9_A577 Neuropilin-1, A5 protein; multi-domain, cell-CELL 98.48
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 98.44
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 98.36
3bn6_A158 Lactadherin; anticoagulation, anti-coagulation, an 98.35
2r7e_B770 Coagulation factor VIII; ceruloplasmin fold, cuppe 98.32
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 98.28
3b84_A119 Zinc finger and BTB domain-containing protein 48; 98.25
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 98.23
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 98.2
1czt_A160 Protein (coagulation factor V); membrane-binding, 98.13
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 98.13
2vpk_A116 Myoneurin; transcription regulation, transcription 98.12
2yfu_A155 Carbohydrate binding family 6; sugar binding prote 98.11
2zxq_A1376 Endo-alpha-N-acetylgalactosaminidase; broken TIM b 98.07
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 98.06
3v7d_A169 Suppressor of kinetochore protein 1; WD 40 domain, 98.05
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 98.03
2cho_A716 Glucosaminidase, hexosaminiase; O-GLCNACASE, hydro 98.0
2wuh_A178 Discoidin domain receptor 2; receptor-peptide comp 97.98
3drz_A107 BTB/POZ domain-containing protein KCTD5; potassium 97.97
1hv2_A99 Elongin C, ELC1; protein-peptide complex, signalin 97.95
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 97.92
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 97.88
3ues_A478 Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydr 97.82
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 97.82
2fnj_C96 Transcription elongation factor B polypeptide 1; b 97.81
4deq_A218 Neuropilin-1, vascular endothelial growth factor; 97.73
4a3z_A161 GH89_CBM32, alpha-N-acetylglucosaminidase family p 97.7
2ast_A159 S-phase kinase-associated protein 1A; SCF-substrat 97.62
3hny_M159 Coagulation factor VIII; blood clotting, acute pha 97.53
2qqi_A 318 Neuropilin-1; VEGF receptor, semaphorin receptor, 97.43
2vm9_A257 Discoidin-2, discoidin II; DDR, lectin, aggregatio 97.38
3f2z_A159 Uncharacterized protein BF3579; the present C-term 97.37
2jda_A145 Yecbm32; hypothetical protein, carbohydrate- bindi 97.36
4a41_A161 GH89_CBM32-5, alpha-N-acetylglucosaminidase family 97.33
2j1a_A150 Hyaluronidase, CBM32; protein-carbohydrate interac 97.22
3ggl_A169 Putative chitobiase; X-RAY, structure genomics, NE 97.22
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 97.21
1vcb_B112 Protein (elongin C); tumor suppressor, cancer, ubi 97.16
1sdd_B 647 Coagulation factor V; copper-binding protein, cofa 97.16
4ag4_A 351 Epithelial discoidin domain-containing receptor 1; 97.08
2qqj_A 325 Neuropilin-2; VEGF receptor, semaphorin receptor, 97.08
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 97.02
3drx_A202 BTB/POZ domain-containing protein KCTD5; golgi, gr 96.85
3gdb_A937 Endo-D, putative uncharacterized protein SPR0440; 96.67
2qqm_A 450 Neuropilin-1; VEGF receptor, semaphorin receptor, 96.62
2r7e_B 770 Coagulation factor VIII; ceruloplasmin fold, cuppe 96.57
4a42_A149 GH89_CBM32-4, alpha-N-acetylglucosaminidase family 96.53
4gwi_A153 Lectinolysin, platelet aggregation factor SM-HPAF; 96.03
4a4a_A 914 Alpha-N-acetylglucosaminidase family protein; hydr 95.93
4ajy_C97 Transcription elongation factor B polypeptide 1; E 95.78
1fs1_B141 SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le 95.74
2qqk_A 579 Neuropilin-2; VEGF receptor, semaphorin receptor, 95.6
2eqx_A105 Kelch repeat and BTB domain-containing protein 4; 95.46
2wn3_A254 Discoidin-1 subunit A; type-H lectin, cell adhesio 95.33
3lei_A153 Platelet aggregation factor SM-HPAF; lectin domain 95.29
2j1v_A151 Fucolectin-related protein; carbohydrate-binding p 95.2
2qqo_A 460 Neuropilin-2; VEGF receptor, semaphorin receptor, 94.96
2p1m_A160 SKP1-like protein 1A; F-BOX, leucine rich repeat, 94.71
1w8o_A601 Bacterial sialidase; 3D-structure, glycosidase, hy 94.48
1jhj_A171 APC10; beta sandwich, jellyroll, cell cycle; 1.60A 94.48
2v5d_A737 O-GLCNACASE NAGJ; family 32 carbohydrate binding m 94.24
2v72_A143 CBM32, EXO-alpha-sialidase; galactose, bacterial p 94.03
2j22_A148 Fucolectin-related protein; carbohydrate-binding p 93.91
3kvt_A115 Potassium channel protein SHAW; tetramerization do 93.84
1s1g_A124 Potassium voltage-gated channel subfamily D membe; 93.78
2w1s_A192 Hyaluronoglucosaminidase; hexosaminidase, family 3 93.73
3hnm_A172 Putative chitobiase; PSI-2, protein structure init 93.73
4gz9_A 577 Neuropilin-1, A5 protein; multi-domain, cell-CELL 93.52
1k12_A158 Lectin; beta barrel, protein carbohydrate complex, 93.3
3v7d_A169 Suppressor of kinetochore protein 1; WD 40 domain, 92.75
1nn7_A105 Potassium channel KV4.2; teteramerization domain, 92.7
1t1d_A100 Protein (potassium channel KV1.1); potassium chann 92.48
3eyp_A469 Putative alpha-L-fucosidase; structural genomics, 92.17
3bn6_A158 Lactadherin; anticoagulation, anti-coagulation, an 91.68
2nz0_B140 Potassium voltage-gated channel subfamily D membe; 91.57
1tvg_A153 LOC51668 protein; cell cycle, structural genomics, 91.19
2cho_A716 Glucosaminidase, hexosaminiase; O-GLCNACASE, hydro 87.6
1czt_A160 Protein (coagulation factor V); membrane-binding, 87.45
3drz_A107 BTB/POZ domain-containing protein KCTD5; potassium 85.32
2yc2_A139 IFT25, intraflagellar transport protein 25; transp 80.82
3ues_A478 Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydr 80.74
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A Back     alignment and structure
Probab=100.00  E-value=4.8e-38  Score=332.49  Aligned_cols=234  Identities=22%  Similarity=0.382  Sum_probs=209.3

Q ss_pred             CCCccchHHHHHHHHHHHHcCCCCccEEEEEC---CEEEEeehhHHHhcCHHHHHHhcCCccCCCCeeEEec------CC
Q psy12546         33 HSYEIEHVQFLSEMIGNLYLNDEFSDTVLIVQ---NEKISVHKVILAARSEYFRALLYGGLCESNQNEIELH------DT  103 (765)
Q Consensus        33 ~~~~~~~~~~l~~~l~~l~~~~~~sDv~~~v~---~~~~~aHr~ILaarS~yF~~lf~~~~~es~~~~I~l~------~v  103 (765)
                      .+....|++.+.+.|+++++++.+|||+|+||   |++|+|||.|||++|+||++||.+++.|+....|.++      ++
T Consensus         9 ~~~~~~h~~~ll~~l~~l~~~~~~~Dv~l~v~~~~~~~f~~Hr~vLaa~S~yF~~mf~~~~~e~~~~~i~l~~~~~~~~v   88 (279)
T 3i3n_A            9 DFECSSHCSELSWRQNEQRRQGLFCDITLCFGGAGGREFRAHRSVLAAATEYFTPLLSGQFSESRSGRVEMRKWSSEPGP   88 (279)
T ss_dssp             EEECTTHHHHHHHHHHHHHHHTTTCCEEEECC----CEEEECHHHHHHHCTTSGGGCCC--------EEECCCCSSTTCS
T ss_pred             CcCCHhHHHHHHHHHHHHHhcCCCCCeEEEEcCCCCeEEehHHHHHHHcCHHHHHHhcCCCccccCCeEEeccccccCCC
Confidence            45667899999999999999999999999998   9999999999999999999999999999999999998      78


Q ss_pred             CHHHHHHHHHHHhcCCccccCcchhHHHHHhhhccCCCCcchHhHHHhhhcCcccCCccccccccccHHHHHHHHHhHhc
Q psy12546        104 NIVAFKCLLKYIYSGKLSFRNLKDDVILDILGKKQNKGTTLTQNFRALLYGGLCESNQNEIELHDTNIVAFKCLLKYIYS  183 (765)
Q Consensus       104 ~~~~f~~lL~ylYtg~l~~~~~~~~~ll~i~~~~~~~~~~~S~yF~amf~~~~~Es~~~~i~l~~v~~~~f~~lL~yiYt  183 (765)
                      ++++|                                                                  +.+|+|+||
T Consensus        89 ~~~~f------------------------------------------------------------------~~ll~~~Yt  102 (279)
T 3i3n_A           89 EPDTV------------------------------------------------------------------EAVIEYMYT  102 (279)
T ss_dssp             CHHHH------------------------------------------------------------------HHHHHHHHH
T ss_pred             CHHHH------------------------------------------------------------------HHHHHhhCc
Confidence            88888                                                                  666666666


Q ss_pred             CceecccCChhHHHHHHHHHhhhCcHHHHHHHHHHHHhhcChhhHHHHHHHHHHcCcHHHHHHHHHHHhcccccccCccc
Q psy12546        184 GKLSFRNLKDDVILDILGLSHKYGFQDLENSISDYLRVILTVHNACSIFDCAYYYDLKQLNKIVLSFIDYNAKQIISENS  263 (765)
Q Consensus       184 g~i~l~~~~~~~vl~ll~~A~~~~l~~L~~~c~~~L~~~l~~~nv~~il~~A~~~~~~~L~~~c~~fi~~n~~~v~~~~~  263 (765)
                      |++.++   .+++.+++.+|++|++++|++.|+++|...++.+||+.++.+|..|++..|.+.|.+||.+||.++..+++
T Consensus       103 g~~~i~---~~~v~~ll~~A~~l~i~~L~~~c~~~L~~~l~~~n~~~i~~~A~~~~~~~L~~~~~~~i~~~f~~v~~~~~  179 (279)
T 3i3n_A          103 GRIRVS---TGSVHEVLELADRFLLIRLKEFCGEFLKKKLHLSNCVAIHSLAHMYTLSQLALKAADMIRRNFHKVIQDEE  179 (279)
T ss_dssp             SEEEEE---TTTHHHHHHHHHHTTCHHHHHHHHHHHHHHCCTTTHHHHHHHHHHTTCHHHHHHHHHHHHHTHHHHTTSSG
T ss_pred             CCcccC---HHHHHHHHHHHHHHCcHHHHHHHHHHHHHcCCcchHHHHHHHHHHcCcHHHHHHHHHHHHHHHHHHhcCcC
Confidence            666653   78899999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccCCHHHHHHHhccCCCCCC-HHHHHHHHHHHHhhCCCcccccCCcccCCCCchhhhhccccCCCCCHHHHHHhcccCC
Q psy12546        264 FYNLSQNGLIQLIQRDSFYAP-EIDIFRAVVDWIKANSPEVEEDGESSFRAPINMDEILTYVRLPLISLDELLTTVRSSG  342 (765)
Q Consensus       264 f~~L~~~~l~~ll~~d~l~v~-E~~l~~av~~Wi~~n~~~~~~~~~~~~~~~~~~~~ll~~VR~~lls~~~L~~~v~~~~  342 (765)
                      |..|+.+.+..||++|.++++ |.++|+++++|++++.+.+.          +++.++|++||||+|++++|.+.+++++
T Consensus       180 f~~L~~~~l~~lL~~d~L~v~sE~~vf~av~~W~~~~~~~r~----------~~~~~ll~~VRf~l~~~~~L~~~v~~~~  249 (279)
T 3i3n_A          180 FYTLPFHLIRDWLSDLEITVDSEEVLFETVLKWVQRNAEERE----------RYFEELFKLLRLSQMKPTYLTRHVKPER  249 (279)
T ss_dssp             GGGSCHHHHHHHHTCSSCCCSCHHHHHHHHHHHHHTTHHHHT----------TTHHHHHTTSCGGGSCHHHHHHTTTTSH
T ss_pred             hhcCCHHHHHHHhcCcCCCCCCHHHHHHHHHHHHHcCHHHHH----------HHHHHHHHhcCCCCCCHHHHHHHhhccc
Confidence            999999999999999999996 99999999999999976665          5899999999999999999999999998


Q ss_pred             CCC
Q psy12546        343 IIS  345 (765)
Q Consensus       343 l~~  345 (765)
                      ++.
T Consensus       250 l~~  252 (279)
T 3i3n_A          250 LVA  252 (279)
T ss_dssp             HHH
T ss_pred             hhc
Confidence            874



>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Back     alignment and structure
>4a3z_A GH89_CBM32, alpha-N-acetylglucosaminidase family protein; hydrolase, family 32 carbohydrate-binding module; HET: MSE; 1.55A {Clostridium perfringens} PDB: 4a6o_A* Back     alignment and structure
>3cqo_A FBP32; F-lectin, fucolectin, sugar binding protein; HET: FUC; 2.32A {Morone saxatilis} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2eqx_A Kelch repeat and BTB domain-containing protein 4; BACK domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>4a41_A GH89_CBM32-5, alpha-N-acetylglucosaminidase family protein; hydrolase, family 89 glycoside hydrolase, family 32 carbohyd binding module; HET: GAL; 1.55A {Clostridium perfringens} PDB: 4a44_A* 4a45_A* 4aax_A* Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>4gwi_A Lectinolysin, platelet aggregation factor SM-HPAF; cholesterol-dependent cytolysins, lewis antigens, F-type LEC glycan binding; HET: BDZ; 1.60A {Streptococcus mitis} PDB: 4gwj_A* 3lei_A* 3leg_A* 3le0_A* 3lek_A* Back     alignment and structure
>3f2z_A Uncharacterized protein BF3579; the present C-terminal domain is predominantly composed of B strands., structural genomics, PSI-2; 1.30A {Bacteroides fragilis} PDB: 2kd7_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3lei_A Platelet aggregation factor SM-HPAF; lectin domain of lectinolysin, fucose, blood clotting, nicke; HET: FUC; 1.90A {Streptococcus mitis} PDB: 3leg_A* 3le0_A* 3lek_A* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>4a42_A GH89_CBM32-4, alpha-N-acetylglucosaminidase family protein; hydrolase, family 89 glycoside hydrolase, family 32 carbohyd binding module; HET: MSE; 1.55A {Clostridium perfringens} Back     alignment and structure
>2qqi_A Neuropilin-1; VEGF receptor, semaphorin receptor, angiogenesis, developmen protein, differentiation, glycoprotein, heparan sulfate, ME neurogenesis; 1.80A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 PDB: 2orz_A 2orx_A 2qqn_A 3i97_A* 1kex_A Back     alignment and structure
>3ggl_A Putative chitobiase; X-RAY, structure genomics, NESG, BTR324A, Q8A9F0_bactn, BT_0865, PSI-2, protein structure initiative; 3.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2j1a_A Hyaluronidase, CBM32; protein-carbohydrate interaction, glycoside hydrolase, GH84C, hydrolase; HET: GAL; 1.49A {Clostridium perfringens} PDB: 2j1e_A* 2j7m_A* Back     alignment and structure
>2j1v_A Fucolectin-related protein; carbohydrate-binding protein, carbohydrate binding protein; HET: NAG GAL FUC; 1.45A {Streptococcus pneumoniae} PDB: 2j1r_A* 2j1t_A* 2j1u_A* 2j1s_A* Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2jda_A Yecbm32; hypothetical protein, carbohydrate- binding module, sugar-binding protein, pectin, plant cell WALL, galacturonic acid; 1.35A {Yersinia enterocolitica} PDB: 2jd9_A Back     alignment and structure
>2j22_A Fucolectin-related protein; carbohydrate-binding protein, carbohydrate binding protein; 1.8A {Streptococcus pneumoniae} Back     alignment and structure
>2qqj_A Neuropilin-2; VEGF receptor, semaphorin receptor, developmental protein, differentiation, glycoprotein, membrane, neurogenesis, transmembrane; 1.95A {Homo sapiens} Back     alignment and structure
>1k12_A Lectin; beta barrel, protein carbohydrate complex, sugar binding protein; HET: FUC; 1.90A {Anguilla anguilla} SCOP: b.18.1.15 Back     alignment and structure
>2qqm_A Neuropilin-1; VEGF receptor, semaphorin receptor, calcium-binding domain, angiogenesis, developmental protein, differentiation; HET: NAG FUC; 2.00A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 b.23.1.1 Back     alignment and structure
>2v72_A CBM32, EXO-alpha-sialidase; galactose, bacterial pathogen, carbohydrate-binding module, sugar-binding protein; HET: GAL; 2.25A {Clostridium perfringens} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>4a4a_A Alpha-N-acetylglucosaminidase family protein; hydrolase, 2 hydrolase, family 89 glycoside hydrolase, mucin carbohydrate-active enzyme; HET: NDG GAL; 1.90A {Clostridium perfringens} PDB: 2vcc_A 2vc9_A* 2vcb_A* 2vca_A Back     alignment and structure
>3hnm_A Putative chitobiase; PSI-2, protein structure initiative, northeast structural genomics consortium, NESG, BTR319D.BT_411; 3.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* Back     alignment and structure
>2qqo_A Neuropilin-2; VEGF receptor, semaphorin receptor, calcium-binding domain, developmental protein, differentiation, glycoprotein, membr neurogenesis; 2.30A {Homo sapiens} Back     alignment and structure
>1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D Back     alignment and structure
>1tvg_A LOC51668 protein; cell cycle, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.60A {Homo sapiens} SCOP: b.18.1.9 PDB: 1xpw_A Back     alignment and structure
>2qqk_A Neuropilin-2; VEGF receptor, semaphorin receptor, phage-derived antibody, developmental protein, differentiation, glycoprotein; HET: NAG; 2.75A {Homo sapiens} PDB: 2qql_A Back     alignment and structure
>2v5d_A O-GLCNACASE NAGJ; family 32 carbohydrate binding module, glycosidase, GH84, GH84C, CBM32, hydrolase, coiled coil; 3.30A {Clostridium perfringens} Back     alignment and structure
>1w8o_A Bacterial sialidase; 3D-structure, glycosidase, hydrolase, beta- propeller; HET: LBT CIT; 1.70A {Micromonospora viridifaciens} SCOP: b.1.18.2 b.18.1.1 b.68.1.1 PDB: 1w8n_A* 1eut_A 1euu_A* 1wcq_A* 2bzd_A* 2ber_A* 1eur_A 1eus_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Back     alignment and structure
>3cqo_A FBP32; F-lectin, fucolectin, sugar binding protein; HET: FUC; 2.32A {Morone saxatilis} Back     alignment and structure
>2yc2_A IFT25, intraflagellar transport protein 25; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_A Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3eyp_A Putative alpha-L-fucosidase; structural genomics, hydrolase, lipoprotein, PSI-2, protein initiative; 1.90A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2w1s_A Hyaluronoglucosaminidase; hexosaminidase, family 32 carbohydrate binding module, toxin, secreted, virulence, hydrolase, glycosidase; HET: MSE BTB; 1.45A {Clostridium perfringens} PDB: 2w1q_A* 2w1u_A* 2wdb_A* Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Back     alignment and structure
>4gz9_A Neuropilin-1, A5 protein; multi-domain, cell-CELL signaling, plexin, semaphorin, VEGF, glycosilated, transmembrane, signaling protein; HET: NAG BMA; 2.70A {Mus musculus} PDB: 4gza_H Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Back     alignment and structure
>3bn6_A Lactadherin; anticoagulation, anti-coagulation, anticoagulant, anti- coagulant, membrane binding, phosphatidyl-serine binding; 1.67A {Bos taurus} PDB: 2pqs_A Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Back     alignment and structure
>1czt_A Protein (coagulation factor V); membrane-binding, discoidin family, calcium- independent, blood clotting; 1.87A {Homo sapiens} SCOP: b.18.1.2 PDB: 1czs_A 1czv_A Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2yfu_A Carbohydrate binding family 6; sugar binding protein; 1.65A {Clostridium thermocellum} PDB: 2y8j_A* 2y9i_A* 2y9s_A 2yb7_A* 2y8m_A 2yfz_A* 2yg0_A* Back     alignment and structure
>2zxq_A Endo-alpha-N-acetylgalactosaminidase; broken TIM barrel, glycosidase, hydrolase; 2.00A {Bifidobacterium longum} Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Back     alignment and structure
>3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Back     alignment and structure
>2cho_A Glucosaminidase, hexosaminiase; O-GLCNACASE, hydrolase, N-acetylglucosamine; 1.85A {Bacteroides thetaiotaomicron} SCOP: a.246.1.1 c.1.8.10 d.92.2.3 PDB: 2chn_A 2vvn_A* 2vvs_A* 2x0h_A* 2xm2_A* 2w4x_A* 2w66_A* 2w67_A* 2wca_A* 2xj7_A* 2xm1_A* 2j47_A* 2jiw_A* 2wzh_A* 2wzi_A* 2j4g_A* Back     alignment and structure
>2wuh_A Discoidin domain receptor 2; receptor-peptide complex, transferase, nucleotide-binding, tyrosine-protein kinase; 1.60A {Homo sapiens} PDB: 2z4f_A Back     alignment and structure
>3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} Back     alignment and structure
>1hv2_A Elongin C, ELC1; protein-peptide complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.42.1.1 Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Back     alignment and structure
>3ues_A Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydrolase inhibitor complex; HET: DFU; 1.60A {Bifidobacterium longum subsp} PDB: 3mo4_A* 3uet_A* Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A Back     alignment and structure
>2fnj_C Transcription elongation factor B polypeptide 1; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.42.1.1 PDB: 1lqb_B 1lm8_C 2jz3_C 2xai_B 2c9w_C 2izv_C 3dcg_B 3zrc_B* 3zrf_B Back     alignment and structure
>4deq_A Neuropilin-1, vascular endothelial growth factor; coagulation factor domain, heparin binding domain, angiogene protein binding-cytokine complex; 2.65A {Homo sapiens} PDB: 1kmx_A 1vgh_A 2vgh_A Back     alignment and structure
>4a3z_A GH89_CBM32, alpha-N-acetylglucosaminidase family protein; hydrolase, family 32 carbohydrate-binding module; HET: MSE; 1.55A {Clostridium perfringens} PDB: 4a6o_A* Back     alignment and structure
>3hny_M Coagulation factor VIII; blood clotting, acute phase, blood coagulation, calcium, DIS mutation, disulfide bond, glycoprotein, hemophilia; 1.07A {Homo sapiens} SCOP: b.18.1.2 PDB: 3hnb_M 3hob_M 1d7p_M 1iqd_C 1cfg_A 1fac_A Back     alignment and structure
>2qqi_A Neuropilin-1; VEGF receptor, semaphorin receptor, angiogenesis, developmen protein, differentiation, glycoprotein, heparan sulfate, ME neurogenesis; 1.80A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 PDB: 2orz_A 2orx_A 2qqn_A 3i97_A* 1kex_A Back     alignment and structure
>2vm9_A Discoidin-2, discoidin II; DDR, lectin, aggregation, cell adhesion; 1.75A {Dictyostelium discoideum} PDB: 2vmc_A* 2vmd_A* 2vme_A* Back     alignment and structure
>3f2z_A Uncharacterized protein BF3579; the present C-terminal domain is predominantly composed of B strands., structural genomics, PSI-2; 1.30A {Bacteroides fragilis} PDB: 2kd7_A Back     alignment and structure
>2jda_A Yecbm32; hypothetical protein, carbohydrate- binding module, sugar-binding protein, pectin, plant cell WALL, galacturonic acid; 1.35A {Yersinia enterocolitica} PDB: 2jd9_A Back     alignment and structure
>4a41_A GH89_CBM32-5, alpha-N-acetylglucosaminidase family protein; hydrolase, family 89 glycoside hydrolase, family 32 carbohyd binding module; HET: GAL; 1.55A {Clostridium perfringens} PDB: 4a44_A* 4a45_A* 4aax_A* Back     alignment and structure
>2j1a_A Hyaluronidase, CBM32; protein-carbohydrate interaction, glycoside hydrolase, GH84C, hydrolase; HET: GAL; 1.49A {Clostridium perfringens} PDB: 2j1e_A* 2j7m_A* Back     alignment and structure
>3ggl_A Putative chitobiase; X-RAY, structure genomics, NESG, BTR324A, Q8A9F0_bactn, BT_0865, PSI-2, protein structure initiative; 3.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 Back     alignment and structure
>1vcb_B Protein (elongin C); tumor suppressor, cancer, ubiquitin, beta sandwich, transcription, transcriptional elongation; 2.70A {Homo sapiens} SCOP: d.42.1.1 Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Back     alignment and structure
>4ag4_A Epithelial discoidin domain-containing receptor 1; immune system-transferase complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>2qqj_A Neuropilin-2; VEGF receptor, semaphorin receptor, developmental protein, differentiation, glycoprotein, membrane, neurogenesis, transmembrane; 1.95A {Homo sapiens} Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Back     alignment and structure
>3drx_A BTB/POZ domain-containing protein KCTD5; golgi, grAsp55, potassium channel domain T1, pentameric assembly, HOST-virus interaction, nucleus; 3.11A {Homo sapiens} PDB: 3dry_A Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Back     alignment and structure
>2qqm_A Neuropilin-1; VEGF receptor, semaphorin receptor, calcium-binding domain, angiogenesis, developmental protein, differentiation; HET: NAG FUC; 2.00A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 b.23.1.1 Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Back     alignment and structure
>4a42_A GH89_CBM32-4, alpha-N-acetylglucosaminidase family protein; hydrolase, family 89 glycoside hydrolase, family 32 carbohyd binding module; HET: MSE; 1.55A {Clostridium perfringens} Back     alignment and structure
>4gwi_A Lectinolysin, platelet aggregation factor SM-HPAF; cholesterol-dependent cytolysins, lewis antigens, F-type LEC glycan binding; HET: BDZ; 1.60A {Streptococcus mitis} PDB: 4gwj_A* 3lei_A* 3leg_A* 3le0_A* 3lek_A* Back     alignment and structure
>4a4a_A Alpha-N-acetylglucosaminidase family protein; hydrolase, 2 hydrolase, family 89 glycoside hydrolase, mucin carbohydrate-active enzyme; HET: NDG GAL; 1.90A {Clostridium perfringens} PDB: 2vcc_A 2vc9_A* 2vcb_A* 2vca_A Back     alignment and structure
>4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* Back     alignment and structure
>1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D Back     alignment and structure
>2qqk_A Neuropilin-2; VEGF receptor, semaphorin receptor, phage-derived antibody, developmental protein, differentiation, glycoprotein; HET: NAG; 2.75A {Homo sapiens} PDB: 2qql_A Back     alignment and structure
>2eqx_A Kelch repeat and BTB domain-containing protein 4; BACK domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wn3_A Discoidin-1 subunit A; type-H lectin, cell adhesion, discoidin domain, lectin; HET: NGA GAL 1PG; 1.59A {Dictyostelium discoideum} PDB: 2w94_A* 2wn2_A* 2w95_A* Back     alignment and structure
>3lei_A Platelet aggregation factor SM-HPAF; lectin domain of lectinolysin, fucose, blood clotting, nicke; HET: FUC; 1.90A {Streptococcus mitis} PDB: 3leg_A* 3le0_A* 3lek_A* Back     alignment and structure
>2j1v_A Fucolectin-related protein; carbohydrate-binding protein, carbohydrate binding protein; HET: NAG GAL FUC; 1.45A {Streptococcus pneumoniae} PDB: 2j1r_A* 2j1t_A* 2j1u_A* 2j1s_A* Back     alignment and structure
>2qqo_A Neuropilin-2; VEGF receptor, semaphorin receptor, calcium-binding domain, developmental protein, differentiation, glycoprotein, membr neurogenesis; 2.30A {Homo sapiens} Back     alignment and structure
>2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* Back     alignment and structure
>1w8o_A Bacterial sialidase; 3D-structure, glycosidase, hydrolase, beta- propeller; HET: LBT CIT; 1.70A {Micromonospora viridifaciens} SCOP: b.1.18.2 b.18.1.1 b.68.1.1 PDB: 1w8n_A* 1eut_A 1euu_A* 1wcq_A* 2bzd_A* 2ber_A* 1eur_A 1eus_A* Back     alignment and structure
>1jhj_A APC10; beta sandwich, jellyroll, cell cycle; 1.60A {Homo sapiens} SCOP: b.18.1.9 Back     alignment and structure
>2v5d_A O-GLCNACASE NAGJ; family 32 carbohydrate binding module, glycosidase, GH84, GH84C, CBM32, hydrolase, coiled coil; 3.30A {Clostridium perfringens} Back     alignment and structure
>2v72_A CBM32, EXO-alpha-sialidase; galactose, bacterial pathogen, carbohydrate-binding module, sugar-binding protein; HET: GAL; 2.25A {Clostridium perfringens} Back     alignment and structure
>2j22_A Fucolectin-related protein; carbohydrate-binding protein, carbohydrate binding protein; 1.8A {Streptococcus pneumoniae} Back     alignment and structure
>3kvt_A Potassium channel protein SHAW; tetramerization domain, molecular recogni zinc-binding; 2.00A {Aplysia californica} SCOP: d.42.1.2 Back     alignment and structure
>1s1g_A Potassium voltage-gated channel subfamily D membe; K+ channels, tetramerization domain, T1 domain, transport PR; 2.60A {Homo sapiens} SCOP: d.42.1.2 Back     alignment and structure
>2w1s_A Hyaluronoglucosaminidase; hexosaminidase, family 32 carbohydrate binding module, toxin, secreted, virulence, hydrolase, glycosidase; HET: MSE BTB; 1.45A {Clostridium perfringens} PDB: 2w1q_A* 2w1u_A* 2wdb_A* Back     alignment and structure
>3hnm_A Putative chitobiase; PSI-2, protein structure initiative, northeast structural genomics consortium, NESG, BTR319D.BT_411; 3.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4gz9_A Neuropilin-1, A5 protein; multi-domain, cell-CELL signaling, plexin, semaphorin, VEGF, glycosilated, transmembrane, signaling protein; HET: NAG BMA; 2.70A {Mus musculus} PDB: 4gza_H Back     alignment and structure
>1k12_A Lectin; beta barrel, protein carbohydrate complex, sugar binding protein; HET: FUC; 1.90A {Anguilla anguilla} SCOP: b.18.1.15 Back     alignment and structure
>3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* Back     alignment and structure
>1nn7_A Potassium channel KV4.2; teteramerization domain, voltage gated potassium channel SHAL, membrane protein; 2.10A {Rattus norvegicus} SCOP: d.42.1.2 Back     alignment and structure
>1t1d_A Protein (potassium channel KV1.1); potassium channels, tetramerization domain, aplysia KV1.1, proton transport, membrane protein; 1.51A {Aplysia californica} SCOP: d.42.1.2 PDB: 1eod_A 1eof_A 1eoe_A 1a68_A 1qdv_A 1exb_E* 1qdw_A 1dsx_A Back     alignment and structure
>3eyp_A Putative alpha-L-fucosidase; structural genomics, hydrolase, lipoprotein, PSI-2, protein initiative; 1.90A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3bn6_A Lactadherin; anticoagulation, anti-coagulation, anticoagulant, anti- coagulant, membrane binding, phosphatidyl-serine binding; 1.67A {Bos taurus} PDB: 2pqs_A Back     alignment and structure
>2nz0_B Potassium voltage-gated channel subfamily D membe; KV4.3, kchip1, membrane protein; 3.20A {Homo sapiens} PDB: 2i2r_A Back     alignment and structure
>1tvg_A LOC51668 protein; cell cycle, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.60A {Homo sapiens} SCOP: b.18.1.9 PDB: 1xpw_A Back     alignment and structure
>2cho_A Glucosaminidase, hexosaminiase; O-GLCNACASE, hydrolase, N-acetylglucosamine; 1.85A {Bacteroides thetaiotaomicron} SCOP: a.246.1.1 c.1.8.10 d.92.2.3 PDB: 2chn_A 2vvn_A* 2vvs_A* 2x0h_A* 2xm2_A* 2w4x_A* 2w66_A* 2w67_A* 2wca_A* 2xj7_A* 2xm1_A* 2j47_A* 2jiw_A* 2wzh_A* 2wzi_A* 2j4g_A* Back     alignment and structure
>1czt_A Protein (coagulation factor V); membrane-binding, discoidin family, calcium- independent, blood clotting; 1.87A {Homo sapiens} SCOP: b.18.1.2 PDB: 1czs_A 1czv_A Back     alignment and structure
>3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} Back     alignment and structure
>2yc2_A IFT25, intraflagellar transport protein 25; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_A Back     alignment and structure
>3ues_A Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydrolase inhibitor complex; HET: DFU; 1.60A {Bifidobacterium longum subsp} PDB: 3mo4_A* 3uet_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 765
d1r29a_122 d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB 2e-13
d1buoa_121 d.42.1.1 (A:) Promyelocytic leukaemia zinc finger 1e-10
d1w8oa2142 b.18.1.1 (A:506-647) Sialidase, C-terminal domain 3e-05
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: POZ domain
superfamily: POZ domain
family: BTB/POZ domain
domain: B-cell lymphoma 6 (Bcl6) protein BTB domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 65.5 bits (159), Expect = 2e-13
 Identities = 20/85 (23%), Positives = 36/85 (42%)

Query: 38  EHVQFLSEMIGNLYLNDEFSDTVLIVQNEKISVHKVILAARSEYFRALLYGGLCESNQNE 97
            H   +   +  L   D  +D V++V  E+   HK +L A S  F ++    L  +    
Sbjct: 7   RHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKRNLSVI 66

Query: 98  IELHDTNIVAFKCLLKYIYSGKLSF 122
               + N   F  LL ++Y+ +L+ 
Sbjct: 67  NLDPEINPEGFNILLDFMYTSRLNL 91


>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 121 Back     information, alignment and structure
>d1w8oa2 b.18.1.1 (A:506-647) Sialidase, C-terminal domain {Micromonospora viridifaciens [TaxId: 1881]} Length = 142 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query765
d1r29a_122 B-cell lymphoma 6 (Bcl6) protein BTB domain {Human 99.87
d1buoa_121 Promyelocytic leukaemia zinc finger (PLZF) protein 99.87
d1w8oa2142 Sialidase, C-terminal domain {Micromonospora virid 99.26
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 99.09
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 99.02
d1k12a_158 Fucose binding lectin {European eel (Anguilla angu 98.98
d1tvga_136 Placental protein 25, pp25 {Human (Homo sapiens) [ 98.96
d1k3ia2162 Galactose oxidase, N-terminal domain {Fungi (Fusar 98.91
d1jhja_161 APC10/DOC1 subunit of the anaphase-promoting compl 98.78
d1gqpa_194 APC10/DOC1 subunit of the anaphase-promoting compl 98.62
d1r29a_122 B-cell lymphoma 6 (Bcl6) protein BTB domain {Human 98.44
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 98.41
d2qqia1156 C2 domain of factor VIII {Human (Homo sapiens) [Ta 98.08
d1buoa_121 Promyelocytic leukaemia zinc finger (PLZF) protein 98.03
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 97.85
d1sddb3162 C2 domain of factor V {Cow (Bos taurus) [TaxId: 99 96.86
d2c9wc196 Elongin C {Human (Homo sapiens) [TaxId: 9606]} 96.69
d1w8oa2142 Sialidase, C-terminal domain {Micromonospora virid 96.5
d1nn7a_105 Potassium channel kv4.2 {Rat (Rattus norvegicus) [ 96.43
d1hv2a_99 Elongin C {Baker's yeast (Saccharomyces cerevisiae 96.3
d2qqia2155 B1 domain of neuropilin-1 {Human (Homo sapiens) [T 96.18
d1czsa_160 C2 domain of factor V {Human (Homo sapiens) [TaxId 96.14
d3kvta_103 akv3.1 voltage-gated potassium channel {California 95.98
d1d7pm_159 C2 domain of factor VIII {Human (Homo sapiens) [Ta 95.95
d1t1da_100 Shaker potassium channel {California sea hare (Apl 95.37
d1tvga_136 Placental protein 25, pp25 {Human (Homo sapiens) [ 94.61
d1k3ia2162 Galactose oxidase, N-terminal domain {Fungi (Fusar 94.23
d1jhja_161 APC10/DOC1 subunit of the anaphase-promoting compl 94.05
d1fs1b155 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 90.08
d1fs1b261 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 90.02
d1gqpa_194 APC10/DOC1 subunit of the anaphase-promoting compl 89.8
d1nexa272 Centromere DNA-binding protein complex Cbf3 subuni 88.68
d1k12a_158 Fucose binding lectin {European eel (Anguilla angu 88.5
d2qqia1156 C2 domain of factor VIII {Human (Homo sapiens) [Ta 87.78
d1nexa170 Centromere DNA-binding protein complex Cbf3 subuni 87.02
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: POZ domain
superfamily: POZ domain
family: BTB/POZ domain
domain: B-cell lymphoma 6 (Bcl6) protein BTB domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.87  E-value=5.7e-22  Score=179.94  Aligned_cols=119  Identities=18%  Similarity=0.294  Sum_probs=104.3

Q ss_pred             CCccchHHHHHHHHHHHHcCCCCccEEEEECCEEEEeehhHHHhcCHHHHHHhcCCccCCCCeeEEecCCCHHHHHHHHH
Q psy12546         34 SYEIEHVQFLSEMIGNLYLNDEFSDTVLIVQNEKISVHKVILAARSEYFRALLYGGLCESNQNEIELHDTNIVAFKCLLK  113 (765)
Q Consensus        34 ~~~~~~~~~l~~~l~~l~~~~~~sDv~~~v~~~~~~aHr~ILaarS~yF~~lf~~~~~es~~~~I~l~~v~~~~f~~lL~  113 (765)
                      ..-.+|+..+.+.|+.+++++.+|||+|.++|++|+|||+|||++|+||++||.+++.++....+.+.++++++|     
T Consensus         3 ~~~~~h~~~ll~~l~~l~~~~~~~Dv~l~v~~~~~~~Hk~vLa~~S~~F~~~f~~~~~e~~~~~~~~~~v~~~~f-----   77 (122)
T d1r29a_           3 IQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKRNLSVINLDPEINPEGF-----   77 (122)
T ss_dssp             CCCTTHHHHHHHHHHHHHHTTCSCCEEEEETTEEEEECHHHHHHHCHHHHHHHTSTTTTTCSEEECCTTSCHHHH-----
T ss_pred             cccchHHHHHHHHHHHHHhcCCCeEEEEEECCEEEEEehHHhhhCCHHHHHHhccchhhhcceeeeecccCHHHH-----
Confidence            345689999999999999999999999999999999999999999999999999999988887777788999999     


Q ss_pred             HHhcCCccccCcchhHHHHHhhhccCCCCcchHhHHHhhhcCcccCCccccccccccHHHHHHHHHhHhcCceecccCCh
Q psy12546        114 YIYSGKLSFRNLKDDVILDILGKKQNKGTTLTQNFRALLYGGLCESNQNEIELHDTNIVAFKCLLKYIYSGKLSFRNLKD  193 (765)
Q Consensus       114 ylYtg~l~~~~~~~~~ll~i~~~~~~~~~~~S~yF~amf~~~~~Es~~~~i~l~~v~~~~f~~lL~yiYtg~i~l~~~~~  193 (765)
                                                                                   +.+|+|+|||++.+   +.
T Consensus        78 -------------------------------------------------------------~~ll~~~Ytg~~~i---~~   93 (122)
T d1r29a_          78 -------------------------------------------------------------NILLDFMYTSRLNL---RE   93 (122)
T ss_dssp             -------------------------------------------------------------HHHHHHHHHSCCCC---CT
T ss_pred             -------------------------------------------------------------HHHHhhhcCCeecC---ch
Confidence                                                                         55555555555544   37


Q ss_pred             hHHHHHHHHHhhhCcHHHHHHHHHHHHh
Q psy12546        194 DVILDILGLSHKYGFQDLENSISDYLRV  221 (765)
Q Consensus       194 ~~vl~ll~~A~~~~l~~L~~~c~~~L~~  221 (765)
                      +++.+++.+|++|++++|++.|.+||+.
T Consensus        94 ~~v~~ll~~A~~l~i~~L~~~C~~~L~~  121 (122)
T d1r29a_          94 GNIMAVMATAMYLQMEHVVDTCRKFIKA  121 (122)
T ss_dssp             TTHHHHHHHHHHTTCHHHHHHHHHHHHT
T ss_pred             hhHHHHHHHHHHHCcHHHHHHHHHHHHh
Confidence            7899999999999999999999999875



>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8oa2 b.18.1.1 (A:506-647) Sialidase, C-terminal domain {Micromonospora viridifaciens [TaxId: 1881]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k12a_ b.18.1.15 (A:) Fucose binding lectin {European eel (Anguilla anguilla) [TaxId: 7936]} Back     information, alignment and structure
>d1tvga_ b.18.1.9 (A:) Placental protein 25, pp25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jhja_ b.18.1.9 (A:) APC10/DOC1 subunit of the anaphase-promoting complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gqpa_ b.18.1.9 (A:) APC10/DOC1 subunit of the anaphase-promoting complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2qqia1 b.18.1.2 (A:431-586) C2 domain of factor VIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1sddb3 b.18.1.2 (B:1863-2024) C2 domain of factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8oa2 b.18.1.1 (A:506-647) Sialidase, C-terminal domain {Micromonospora viridifaciens [TaxId: 1881]} Back     information, alignment and structure
>d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qqia2 b.18.1.2 (A:273-427) B1 domain of neuropilin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1czsa_ b.18.1.2 (A:) C2 domain of factor V {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1d7pm_ b.18.1.2 (M:) C2 domain of factor VIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1tvga_ b.18.1.9 (A:) Placental protein 25, pp25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jhja_ b.18.1.9 (A:) APC10/DOC1 subunit of the anaphase-promoting complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fs1b1 a.157.1.1 (B:86-140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fs1b2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gqpa_ b.18.1.9 (A:) APC10/DOC1 subunit of the anaphase-promoting complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexa2 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k12a_ b.18.1.15 (A:) Fucose binding lectin {European eel (Anguilla anguilla) [TaxId: 7936]} Back     information, alignment and structure
>d2qqia1 b.18.1.2 (A:431-586) C2 domain of factor VIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexa1 a.157.1.1 (A:116-185) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure