Psyllid ID: psy12562

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------60
MPWLQSRQTDNSLSGVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAYMPTEGKMVSDIANAWKGLETSEKSFEEWLLSEMMRLERLEHLAQKFKHKADIHEDWTRGKEEMLQSSDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNTLEYHDSVSVNARCQRICDQWDHLGALTQQRRHALDEAEKILEKIDILHLEFAKRAAPFNNWLDGTREDLVDMFIVHTMEEIQGLIDAHSQFKATLGEADKEYNSIVNLVREVESTVQQYQIPGGLENPYTALTANDLTKKWTDVRKLVPQRDTTLQAELRKQQNNETLRRQFAEKANQVGPWIERQMDAVTSIGMGLQGSLEDQLHRLKEYEQGVYAYKPHIEELEKIHQAVQEGMIFENRYTQYTMETLRVGWEQLLTSINRNINEVENQILTRDSKGITQEQLNEFRASFNHFDKNRTGRLAPEEFKSCLVSLGYSIGKDRQGEIDFQRILAVVDPNSTGYVHFDAFLDFMTRESTDTDTAEQVIDSFRILAGDKPYILPDELRRELPPDQAEYCIQRMPPYKGPNAIPGALDYQSFSTALYGESDL
ccccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccHHHHHHHccccHHHHHHHHcccccccccccccccHHHHHHHHHccccc
cccHccccccccHHHHHHHHHHHHHHcccccccccHEccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcHHccccccHHHHHHHHHHHcccccccccccHHHHHHHHHcccccccEEcHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccHHHHHHHccHHHHHHHHHHcccccccccccccccHHHHHHHHcccccc
mpwlqsrqtdnslSGVQKKLEEYRtyrrkhkpprveqKAKLETNFNTLQTKlrlsnrpaymptegkMVSDIANAWKGLETSEKSFEEWLLSEMMRLERLEHLAQKFKHKADIHEDWTRgkeemlqssdfRQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNtleyhdsvsvnARCQRICDQWDHLGALTQQRRHALDEAEKILEKIDILHLEFAkraapfnnwldgtreDLVDMFIVHTMEEIQGLIDAHSQFKATLGEADKEYNSIVNLVREVESTVQQyqipgglenpytaltandltkkwtdvrklvpqRDTTLQAELRKQQNNETLRRQFAEKANQVGPWIERQMDAVTSIgmglqgslEDQLHRLKEYEQGVYAYKPHIEELEKIHQAVQEGMIFENRYTQYTMETLRVGWEQLLTSINRNINEVENQILTRDSKGITQEQLNEFRASFnhfdknrtgrlapeEFKSCLVSLGYsigkdrqgeidFQRILavvdpnstgyvhfdAFLDfmtrestdtdtaEQVIDSFRIlagdkpyilpdelrrelppdqaeyciqrmppykgpnaipgaldyqsfstalygesdl
mpwlqsrqtdnslsgvQKKLEeyrtyrrkhkpprveqkakletnfntlqtklrlsnrpaympteGKMVSDIANAWKGLETSEKSFEEWLLSEMMRLERLEHLAQKFKHKADIHEDWTRGKEemlqssdfRQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNTLEYHDSVSVNARCQRICDQWDHLGALTQQRRHALDEAEKILEKIDILHLEFAKRaapfnnwldgTREDLVDMFIVHTMEEIQGLIDAHSQFKATLGEADKEYNSIVNLVREVESTVQQYQipgglenpytALTANDLTKKWTDVRKLVPQRDTTLQAELRKQQNNETLRRQFAekanqvgpwIERQMDAVTSIGMGLQGSLEDQLHRLKEYEQGVYAYKPHIEELEKIHQAVQEGMIFENRYTQYTMETLRVGWEQLLTSINRNINEVENQILTRDSKGITQEQLNEFRASFnhfdknrtgrlapEEFKSCLVSLGYSIGKDRQGEIDFQRILAVVDPNSTGYVHFDAFLDFMTRESTDTDTAEQVIDSFRILAGDKPYILPDELRRELPPDQAEYCIQRMPPYKGPNAIPGALDYQSFSTALYGESDL
MPWLQSRQTDNSLSGVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAYMPTEGKMVSDIANAWKGLETSEKSFeewllsemmrlerlehlAQKFKHKADIHEDWTRGKEEMLQSSDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNTLEYHDSVSVNARCQRICDQWDHLGALTQQRRHALDEAEKILEKIDILHLEFAKRAAPFNNWLDGTREDLVDMFIVHTMEEIQGLIDAHSQFKATLGEADKEYNSIVNLVREVESTVQQYQIPGGLENPYTALTANDLTKKWTDVRKLVPQRDTTLQAELRKQQNNETLRRQFAEKANQVGPWIERQMDAVTSIGMGLQGSLEDQLHRLKEYEQGVYAYKPHIEELEKIHQAVQEGMIFENRYTQYTMETLRVGWEQLLTSINRNINEVENQILTRDSKGITQEQLNEFRASFNHFDKNRTGRLAPEEFKSCLVSLGYSIGKDRQGEIDFQRILAVVDPNSTGYVHFDAFLDFMTRESTDTDTAEQVIDSFRILAGDKPYILPDELRRELPPDQAEYCIQRMPPYKGPNAIPGALDYQSFSTALYGESDL
*******************************************************************VSDIANAWKGLETSEKSFEEWLLSEMMRLERLEHLAQKFKHKADIHEDW************************************AHQDRVEQIAAIAQELNTLEYHDSVSVNARCQRICDQWDHLGALTQQRRHALDEAEKILEKIDILHLEFAKRAAPFNNWLDGTREDLVDMFIVHTMEEIQGLIDAHSQFKATLGEADKEYNSIVNLVREVESTVQQYQIPGGLENPYTALTANDLTKKWTDVRKLV*****************************QVGPWIERQMDAVTSIGMGLQGSLEDQLHRLKEYEQGVYAYKPHIEELEKIHQAVQEGMIFENRYTQYTMETLRVGWEQLLTSINRNINEVENQILTRDSKGITQEQLNEFRASFNHFDKNRTGRLAPEEFKSCLVSLGYSIGKDRQGEIDFQRILAVVDPNSTGYVHFDAFLDFMTRESTDTDTAEQVIDSFRILAGDKPYILPDELR*******AEYCIQRMPPYK**NAIPGALDYQSF**********
MPWLQS*Q***********LEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLS********EGKMVSDIANAWKGLETSEKSFEEWLLSEMMRLERLEHLAQKFKHKADIHEDWTRGKEEML*******CKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNTLEYHDSVSVNARCQRICDQWDHLGALTQQRRHALDEAEKILEKIDILHLEFAKRAAPFNNWLDGTREDLVDMFIVHTMEEIQGLIDAHSQFKATLGEADKEYNSIVNLVREVESTVQ******GLENPYTALTANDLTKKWTDVRKLVPQRD***********NNETLRRQFAEKANQVGPWIERQMDAVT***************************KPHIEELEKIHQAVQEG*IFENRYTQYTMETLRVGWEQLLTSINRNINEVENQILTRDSKGITQEQLNEFRASFNHFDKNRTGRLAPEEFKSCLVSLGYSIGKDRQGEIDFQRILAVVDPNSTGYVHFDAFLDFMT**********QVIDSFRILAGDKPYILPDELRRELPPDQAEYCIQRMPPYKG*NAIPGALDYQSFSTALYGES**
**************GVQKKLEEYRTY**********QKAKLETNFNTLQTKLRLSNRPAYMPTEGKMVSDIANAWKGLETSEKSFEEWLLSEMMRLERLEHLAQKFKHKADIHEDWTRGKEEMLQSSDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNTLEYHDSVSVNARCQRICDQWDHLGALTQQRRHALDEAEKILEKIDILHLEFAKRAAPFNNWLDGTREDLVDMFIVHTMEEIQGLIDAHSQFKATLGEADKEYNSIVNLVREVESTVQQYQIPGGLENPYTALTANDLTKKWTDVRKLVPQRDTTLQAELRKQQNNETLRRQFAEKANQVGPWIERQMDAVTSIGMGLQGSLEDQLHRLKEYEQGVYAYKPHIEELEKIHQAVQEGMIFENRYTQYTMETLRVGWEQLLTSINRNINEVENQILTRDSKGITQEQLNEFRASFNHFDKNRTGRLAPEEFKSCLVSLGYSIGKDRQGEIDFQRILAVVDPNSTGYVHFDAFLDFMTRESTDTDTAEQVIDSFRILAGDKPYILPDELRRELPPDQAEYCIQRMPPYKGPNAIPGALDYQSFSTALYGESDL
MPWLQSRQTDNSLSGVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAYMPTEGKMVSDIANAWKGLETSEKSFEEWLLSEMMRLERLEHLAQKFKHKADIHEDWTRGKEEMLQSSDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNTLEYHDSVSVNARCQRICDQWDHLGALTQQRRHALDEAEKILEKIDILHLEFAKRAAPFNNWLDGTREDLVDMFIVHTMEEIQGLIDAHSQFKATLGEADKEYNSIVNLVREVESTVQQYQIPGGLENPYTALTANDLTKKWTDVRKLVPQRDTTLQAELRKQQNNETLRRQFAEKANQVGPWIERQMDAVTSIGMGLQGSLEDQLHRLKEYEQGVYAYKPHIEELEKIHQAVQEGMIFENRYTQYTMETLRVGWEQLLTSINRNINEVENQILTRDSKGITQEQLNEFRASFNHFDKNRTGRLAPEEFKSCLVSLGYSIGKDRQGEIDFQRILAVVDPNSTGYVHFDAFLDFMTRESTDTDTAEQVIDSFRILAGDKPYILPDELRRELPPDQAEYCIQRMPPYKGPNAIPGALDYQSFSTALYG****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPWLQSRQTDNSLSGVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAYMPTEGKMVSDIANAWKGLETSEKSFEEWLLSEMMRLERLEHLAQKFKHKADIHEDWTRGKEEMLQSSDFxxxxxxxxxxxxxxxxxxxxxxxxxxxxVEQIAAIAQELNTLEYHDSVSVNARCQRICDQWDHLGALTQQRRHALDEAEKILEKIDILHLEFAKRAAPFNNWLDGTREDLVDMFIVHTMEEIQGLIDAHSQFKATLGEADKEYNSIVNLVREVESTVQQYQIPGGLENPYTALTANDLTKKWTDVRKLVPQRDTTLQAELRKQQNNETLRRQFAEKANQVGPWIERQMDAVTSIGMGLQGSLEDQLHRLKEYEQGVYAYKPHIEELEKIHQAVQEGMIFENRYTQYTMETLxxxxxxxxxxxxxxxxxxxxxILTRDSKGITQEQLNEFRASFNHFDKNRTGRLAPEEFKSCLVSLGYSIGKDRQGEIDFQRILAVVDPNSTGYVHFDAFLDFMTRESTDTDTAEQVIDSFRILAGDKPYILPDELRRELPPDQAEYCIQRMPPYKGPNAIPGALDYQSFSTALYGESDL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query599 2.2.26 [Sep-21-2011]
P18091924 Alpha-actinin, sarcomeric yes N/A 1.0 0.648 0.913 0.0
Q7PKQ5922 Alpha-actinin, sarcomeric yes N/A 1.0 0.649 0.878 0.0
P05094893 Alpha-actinin-1 OS=Gallus yes N/A 1.0 0.670 0.651 0.0
Q3B7N2892 Alpha-actinin-1 OS=Bos ta yes N/A 1.0 0.671 0.647 0.0
Q9Z1P2892 Alpha-actinin-1 OS=Rattus yes N/A 1.0 0.671 0.646 0.0
Q2PFV7892 Alpha-actinin-1 OS=Macaca N/A N/A 1.0 0.671 0.646 0.0
P12814892 Alpha-actinin-1 OS=Homo s yes N/A 1.0 0.671 0.646 0.0
Q7TPR4892 Alpha-actinin-1 OS=Mus mu yes N/A 1.0 0.671 0.644 0.0
Q9QXQ0911 Alpha-actinin-4 OS=Rattus no N/A 1.0 0.657 0.631 0.0
Q5RCS6911 Alpha-actinin-4 OS=Pongo yes N/A 1.0 0.657 0.631 0.0
>sp|P18091|ACTN_DROME Alpha-actinin, sarcomeric OS=Drosophila melanogaster GN=Actn PE=2 SV=2 Back     alignment and function desciption
 Score = 1157 bits (2992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/599 (91%), Positives = 573/599 (95%)

Query: 1   MPWLQSRQTDNSLSGVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAY 60
           MPWL SRQ DNSL+GVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAY
Sbjct: 326 MPWLNSRQADNSLAGVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAY 385

Query: 61  MPTEGKMVSDIANAWKGLETSEKSFEEWLLSEMMRLERLEHLAQKFKHKADIHEDWTRGK 120
           +PTEGK VSDI+N+WKGLE +EK+FEEWLL+E MRLERLEHLAQKFKHKAD HEDWTRGK
Sbjct: 386 LPTEGKTVSDISNSWKGLELAEKAFEEWLLAETMRLERLEHLAQKFKHKADAHEDWTRGK 445

Query: 121 EEMLQSSDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNTLEYHDSVSVN 180
           EEMLQS DFRQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNTLEYHD VSVN
Sbjct: 446 EEMLQSQDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNTLEYHDCVSVN 505

Query: 181 ARCQRICDQWDHLGALTQQRRHALDEAEKILEKIDILHLEFAKRAAPFNNWLDGTREDLV 240
           ARCQRICDQWD LGALTQ+RR ALDEAE+ILEKIDILHLEFAKRAAPFNNWLDGTREDLV
Sbjct: 506 ARCQRICDQWDRLGALTQRRRTALDEAERILEKIDILHLEFAKRAAPFNNWLDGTREDLV 565

Query: 241 DMFIVHTMEEIQGLIDAHSQFKATLGEADKEYNSIVNLVREVESTVQQYQIPGGLENPYT 300
           DMFIVHTMEEIQGLI AH QFKATLGEADKE+N IVNLVREVES V+Q+QIPGGLENPYT
Sbjct: 566 DMFIVHTMEEIQGLIQAHDQFKATLGEADKEFNLIVNLVREVESIVKQHQIPGGLENPYT 625

Query: 301 ALTANDLTKKWTDVRKLVPQRDTTLQAELRKQQNNETLRRQFAEKANQVGPWIERQMDAV 360
            LTAND+T+KW+DVR+LVPQRD TL  ELRKQQNNE LRRQFAEKAN VGPWIERQMDAV
Sbjct: 626 TLTANDMTRKWSDVRQLVPQRDQTLANELRKQQNNEMLRRQFAEKANIVGPWIERQMDAV 685

Query: 361 TSIGMGLQGSLEDQLHRLKEYEQGVYAYKPHIEELEKIHQAVQEGMIFENRYTQYTMETL 420
           T+IGMGLQGSLEDQLHRLKEYEQ VYAYKP+IEELEKIHQAVQE MIFENRYT YTMETL
Sbjct: 686 TAIGMGLQGSLEDQLHRLKEYEQAVYAYKPNIEELEKIHQAVQESMIFENRYTNYTMETL 745

Query: 421 RVGWEQLLTSINRNINEVENQILTRDSKGITQEQLNEFRASFNHFDKNRTGRLAPEEFKS 480
           RVGWEQLLTSINRNINEVENQILTRDSKGI+QEQLNEFR+SFNHFDKNRTGRL+PEEFKS
Sbjct: 746 RVGWEQLLTSINRNINEVENQILTRDSKGISQEQLNEFRSSFNHFDKNRTGRLSPEEFKS 805

Query: 481 CLVSLGYSIGKDRQGEIDFQRILAVVDPNSTGYVHFDAFLDFMTRESTDTDTAEQVIDSF 540
           CLVSLGYSIGKDRQG++DFQRILAVVDPN+TGYVHFDAFLDFMTRESTDTDTAEQVIDSF
Sbjct: 806 CLVSLGYSIGKDRQGDLDFQRILAVVDPNNTGYVHFDAFLDFMTRESTDTDTAEQVIDSF 865

Query: 541 RILAGDKPYILPDELRRELPPDQAEYCIQRMPPYKGPNAIPGALDYQSFSTALYGESDL 599
           RILA DKPYILPDELRRELPPDQAEYCIQRMPPYKGPN +PGALDY SFSTALYGE+DL
Sbjct: 866 RILAADKPYILPDELRRELPPDQAEYCIQRMPPYKGPNGVPGALDYMSFSTALYGETDL 924
F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein.
Drosophila melanogaster (taxid: 7227)
>sp|Q7PKQ5|ACTN_ANOGA Alpha-actinin, sarcomeric OS=Anopheles gambiae GN=Actn PE=3 SV=2 Back     alignment and function description
>sp|P05094|ACTN1_CHICK Alpha-actinin-1 OS=Gallus gallus GN=ACTN1 PE=1 SV=3 Back     alignment and function description
>sp|Q3B7N2|ACTN1_BOVIN Alpha-actinin-1 OS=Bos taurus GN=ACTN1 PE=2 SV=1 Back     alignment and function description
>sp|Q9Z1P2|ACTN1_RAT Alpha-actinin-1 OS=Rattus norvegicus GN=Actn1 PE=1 SV=1 Back     alignment and function description
>sp|Q2PFV7|ACTN1_MACFA Alpha-actinin-1 OS=Macaca fascicularis GN=ACTN1 PE=2 SV=1 Back     alignment and function description
>sp|P12814|ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 Back     alignment and function description
>sp|Q7TPR4|ACTN1_MOUSE Alpha-actinin-1 OS=Mus musculus GN=Actn1 PE=1 SV=1 Back     alignment and function description
>sp|Q9QXQ0|ACTN4_RAT Alpha-actinin-4 OS=Rattus norvegicus GN=Actn4 PE=1 SV=2 Back     alignment and function description
>sp|Q5RCS6|ACTN4_PONAB Alpha-actinin-4 OS=Pongo abelii GN=ACTN4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query599
242012900 917 alpha-actinin-4, putative [Pediculus hum 1.0 0.653 0.933 0.0
270005784 923 hypothetical protein TcasGA2_TC007894 [T 1.0 0.648 0.916 0.0
91080533 897 PREDICTED: similar to alpha actinin CG43 1.0 0.667 0.916 0.0
328703083 897 PREDICTED: alpha-actinin, sarcomeric-lik 1.0 0.667 0.916 0.0
328703081 897 PREDICTED: alpha-actinin, sarcomeric-lik 1.0 0.667 0.916 0.0
328703079 914 PREDICTED: alpha-actinin, sarcomeric-lik 1.0 0.655 0.916 0.0
195397485 895 GJ16390 [Drosophila virilis] gi|19414712 1.0 0.669 0.918 0.0
350407892 937 PREDICTED: alpha-actinin, sarcomeric-lik 1.0 0.639 0.916 0.0
383847237 934 PREDICTED: alpha-actinin, sarcomeric-lik 1.0 0.641 0.914 0.0
195447732 943 GK25747 [Drosophila willistoni] gi|19416 1.0 0.635 0.914 0.0
>gi|242012900|ref|XP_002427163.1| alpha-actinin-4, putative [Pediculus humanus corporis] gi|212511446|gb|EEB14425.1| alpha-actinin-4, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score = 1181 bits (3055), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/599 (93%), Positives = 582/599 (97%)

Query: 1   MPWLQSRQTDNSLSGVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAY 60
           MPWL+SRQTDNSL+GVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAY
Sbjct: 319 MPWLESRQTDNSLAGVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAY 378

Query: 61  MPTEGKMVSDIANAWKGLETSEKSFEEWLLSEMMRLERLEHLAQKFKHKADIHEDWTRGK 120
           MPTEGKMV DIANAWKGLET+EKSFEEWLLSEMMRLERLEHLAQKFKHKADIHEDWTRGK
Sbjct: 379 MPTEGKMVKDIANAWKGLETAEKSFEEWLLSEMMRLERLEHLAQKFKHKADIHEDWTRGK 438

Query: 121 EEMLQSSDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNTLEYHDSVSVN 180
           EEMLQS DFRQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELN+L+YHDS SVN
Sbjct: 439 EEMLQSQDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNSLDYHDSASVN 498

Query: 181 ARCQRICDQWDHLGALTQQRRHALDEAEKILEKIDILHLEFAKRAAPFNNWLDGTREDLV 240
           ARCQRICDQWD LG+LTQ+R  ALDEAE+ILEKIDILHLEFAKRAAPFNNWLDGTREDLV
Sbjct: 499 ARCQRICDQWDRLGSLTQRRCQALDEAERILEKIDILHLEFAKRAAPFNNWLDGTREDLV 558

Query: 241 DMFIVHTMEEIQGLIDAHSQFKATLGEADKEYNSIVNLVREVESTVQQYQIPGGLENPYT 300
           DMFIVHTMEEIQGLIDAH+QFKATLGEADKEYNSIV LVREVE+ V+QYQIPGGLENPYT
Sbjct: 559 DMFIVHTMEEIQGLIDAHNQFKATLGEADKEYNSIVGLVREVETIVKQYQIPGGLENPYT 618

Query: 301 ALTANDLTKKWTDVRKLVPQRDTTLQAELRKQQNNETLRRQFAEKANQVGPWIERQMDAV 360
           ALTANDL KKW++V++LVPQRD TLQAE RKQQNNE +RRQFAEKANQVGPWIERQMDAV
Sbjct: 619 ALTANDLVKKWSEVKQLVPQRDQTLQAEFRKQQNNEMVRRQFAEKANQVGPWIERQMDAV 678

Query: 361 TSIGMGLQGSLEDQLHRLKEYEQGVYAYKPHIEELEKIHQAVQEGMIFENRYTQYTMETL 420
           T+IGMGLQGSLEDQLHRLKEYEQGVYAYKPHIEELEKIHQAVQEGMIFENRYTQYTMETL
Sbjct: 679 TAIGMGLQGSLEDQLHRLKEYEQGVYAYKPHIEELEKIHQAVQEGMIFENRYTQYTMETL 738

Query: 421 RVGWEQLLTSINRNINEVENQILTRDSKGITQEQLNEFRASFNHFDKNRTGRLAPEEFKS 480
           RVGWEQLLTSINRNINEVENQILTRDSKGITQ+QLNEFR+SFNHFDKNRTGRLAPEE KS
Sbjct: 739 RVGWEQLLTSINRNINEVENQILTRDSKGITQDQLNEFRSSFNHFDKNRTGRLAPEELKS 798

Query: 481 CLVSLGYSIGKDRQGEIDFQRILAVVDPNSTGYVHFDAFLDFMTRESTDTDTAEQVIDSF 540
           CLVSLGYSIGKDRQGEIDF RILAVVDPN++GYV FDAFLDFMTRESTDTDTAEQVIDSF
Sbjct: 799 CLVSLGYSIGKDRQGEIDFHRILAVVDPNNSGYVTFDAFLDFMTRESTDTDTAEQVIDSF 858

Query: 541 RILAGDKPYILPDELRRELPPDQAEYCIQRMPPYKGPNAIPGALDYQSFSTALYGESDL 599
           RILAGDKPYILPDELRRELPPDQAEYCI+RMPPYKGPN +PGALDY SFSTALYGESDL
Sbjct: 859 RILAGDKPYILPDELRRELPPDQAEYCIKRMPPYKGPNGVPGALDYMSFSTALYGESDL 917

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|270005784|gb|EFA02232.1| hypothetical protein TcasGA2_TC007894 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91080533|ref|XP_972324.1| PREDICTED: similar to alpha actinin CG4376-PB [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328703083|ref|XP_001950758.2| PREDICTED: alpha-actinin, sarcomeric-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328703081|ref|XP_001950733.2| PREDICTED: alpha-actinin, sarcomeric-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328703079|ref|XP_001950805.2| PREDICTED: alpha-actinin, sarcomeric-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|195397485|ref|XP_002057359.1| GJ16390 [Drosophila virilis] gi|194147126|gb|EDW62845.1| GJ16390 [Drosophila virilis] Back     alignment and taxonomy information
>gi|350407892|ref|XP_003488231.1| PREDICTED: alpha-actinin, sarcomeric-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383847237|ref|XP_003699261.1| PREDICTED: alpha-actinin, sarcomeric-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|195447732|ref|XP_002071345.1| GK25747 [Drosophila willistoni] gi|194167430|gb|EDW82331.1| GK25747 [Drosophila willistoni] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query599
FB|FBgn0000667924 Actn "alpha actinin" [Drosophi 1.0 0.648 0.888 4.9e-291
UNIPROTKB|E2QY08914 ACTN1 "Uncharacterized protein 0.824 0.540 0.605 4.5e-211
UNIPROTKB|P05094893 ACTN1 "Alpha-actinin-1" [Gallu 1.0 0.670 0.629 5.7e-210
ZFIN|ZDB-GENE-081113-4902 actn1 "actinin, alpha 1" [Dani 1.0 0.664 0.631 7.2e-210
UNIPROTKB|E2QY07892 ACTN1 "Uncharacterized protein 1.0 0.671 0.627 1.1e-208
UNIPROTKB|Q3B7N2892 ACTN1 "Alpha-actinin-1" [Bos t 1.0 0.671 0.626 2.2e-208
RGD|70907892 Actn1 "actinin, alpha 1" [Ratt 1.0 0.671 0.624 7.5e-208
UNIPROTKB|F1M1N4867 Actn1 "Alpha-actinin-1" [Rattu 1.0 0.690 0.624 7.5e-208
UNIPROTKB|Q9Z1P2892 Actn1 "Alpha-actinin-1" [Rattu 1.0 0.671 0.624 7.5e-208
UNIPROTKB|P12814892 ACTN1 "Alpha-actinin-1" [Homo 1.0 0.671 0.624 2e-207
FB|FBgn0000667 Actn "alpha actinin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 2795 (988.9 bits), Expect = 4.9e-291, P = 4.9e-291
 Identities = 532/599 (88%), Positives = 557/599 (92%)

Query:     1 MPWLQSRQTDNSLSGVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAY 60
             MPWL SRQ DNSL+GVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAY
Sbjct:   326 MPWLNSRQADNSLAGVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAY 385

Query:    61 MPTEGKMVSDIANAWKGLETSEKSFXXXXXXXXXXXXXXXXXAQKFKHKADIHEDWTRGK 120
             +PTEGK VSDI+N+WKGLE +EK+F                 AQKFKHKAD HEDWTRGK
Sbjct:   386 LPTEGKTVSDISNSWKGLELAEKAFEEWLLAETMRLERLEHLAQKFKHKADAHEDWTRGK 445

Query:   121 EEMLQSSDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNTLEYHDSVSVN 180
             EEMLQS DFRQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNTLEYHD VSVN
Sbjct:   446 EEMLQSQDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNTLEYHDCVSVN 505

Query:   181 ARCQRICDQWDHLGALTQQRRHALDEAEKILEKIDILHLEFAKRAAPFNNWLDGTREDLV 240
             ARCQRICDQWD LGALTQ+RR ALDEAE+ILEKIDILHLEFAKRAAPFNNWLDGTREDLV
Sbjct:   506 ARCQRICDQWDRLGALTQRRRTALDEAERILEKIDILHLEFAKRAAPFNNWLDGTREDLV 565

Query:   241 DMFIVHTMEEIQGLIDAHSQFKATLGEADKEYNSIVNLVREVESTVQQYQIPGGLENPYT 300
             DMFIVHTMEEIQGLI AH QFKATLGEADKE+N IVNLVREVES V+Q+QIPGGLENPYT
Sbjct:   566 DMFIVHTMEEIQGLIQAHDQFKATLGEADKEFNLIVNLVREVESIVKQHQIPGGLENPYT 625

Query:   301 ALTANDLTKKWTDVRKLVPQRDTTLQAELRKQQNNETLRRQFAEKANQVGPWIERQMDAV 360
              LTAND+T+KW+DVR+LVPQRD TL  ELRKQQNNE LRRQFAEKAN VGPWIERQMDAV
Sbjct:   626 TLTANDMTRKWSDVRQLVPQRDQTLANELRKQQNNEMLRRQFAEKANIVGPWIERQMDAV 685

Query:   361 TSIGMGLQGSLEDQLHRLKEYEQGVYAYKPHIEELEKIHQAVQEGMIFENRYTQYTMETL 420
             T+IGMGLQGSLEDQLHRLKEYEQ VYAYKP+IEELEKIHQAVQE MIFENRYT YTMETL
Sbjct:   686 TAIGMGLQGSLEDQLHRLKEYEQAVYAYKPNIEELEKIHQAVQESMIFENRYTNYTMETL 745

Query:   421 RVGWEQLLTSINRNINEVENQILTRDSKGITQEQLNEFRASFNHFDKNRTGRLAPEEFKS 480
             RVGWEQLLTSINRNINEVENQILTRDSKGI+QEQLNEFR+SFNHFDKNRTGRL+PEEFKS
Sbjct:   746 RVGWEQLLTSINRNINEVENQILTRDSKGISQEQLNEFRSSFNHFDKNRTGRLSPEEFKS 805

Query:   481 CLVSLGYSIGKDRQGEIDFQRILAVVDPNSTGYVHFDAFLDFMTRESTDTDTAEQVIDSF 540
             CLVSLGYSIGKDRQG++DFQRILAVVDPN+TGYVHFDAFLDFMTRESTDTDTAEQVIDSF
Sbjct:   806 CLVSLGYSIGKDRQGDLDFQRILAVVDPNNTGYVHFDAFLDFMTRESTDTDTAEQVIDSF 865

Query:   541 RILAGDKPYILPDELRRELPPDQAEYCIQRMPPYKGPNAIPGALDYQSFSTALYGESDL 599
             RILA DKPYILPDELRRELPPDQAEYCIQRMPPYKGPN +PGALDY SFSTALYGE+DL
Sbjct:   866 RILAADKPYILPDELRRELPPDQAEYCIQRMPPYKGPNGVPGALDYMSFSTALYGETDL 924
GO:0007629 "flight behavior" evidence=IMP
GO:0051017 "actin filament bundle assembly" evidence=ISS;NAS
GO:0051015 "actin filament binding" evidence=ISS
GO:0005509 "calcium ion binding" evidence=ISS
GO:0003779 "actin binding" evidence=ISS
GO:0005925 "focal adhesion" evidence=ISS
GO:0007016 "cytoskeletal anchoring at plasma membrane" evidence=ISS
GO:0051764 "actin crosslink formation" evidence=IEA
GO:0031532 "actin cytoskeleton reorganization" evidence=IMP
GO:0030018 "Z disc" evidence=IDA
GO:0045214 "sarcomere organization" evidence=IMP
UNIPROTKB|E2QY08 ACTN1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P05094 ACTN1 "Alpha-actinin-1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-081113-4 actn1 "actinin, alpha 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2QY07 ACTN1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q3B7N2 ACTN1 "Alpha-actinin-1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|70907 Actn1 "actinin, alpha 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1M1N4 Actn1 "Alpha-actinin-1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Z1P2 Actn1 "Alpha-actinin-1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P12814 ACTN1 "Alpha-actinin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7PKQ5ACTN_ANOGANo assigned EC number0.87811.00.6496yesN/A
Q5RCS6ACTN4_PONABNo assigned EC number0.63101.00.6575yesN/A
P12814ACTN1_HUMANNo assigned EC number0.64601.00.6715yesN/A
Q7TPR4ACTN1_MOUSENo assigned EC number0.64441.00.6715yesN/A
Q9Z1P2ACTN1_RATNo assigned EC number0.64601.00.6715yesN/A
Q3B7N2ACTN1_BOVINNo assigned EC number0.64771.00.6715yesN/A
P18091ACTN_DROMENo assigned EC number0.91311.00.6482yesN/A
P05094ACTN1_CHICKNo assigned EC number0.65101.00.6707yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query599
pfam0872669 pfam08726, efhand_Ca_insen, Ca2+ insensitive EF ha 2e-31
cd00176213 cd00176, SPEC, Spectrin repeats, found in several 6e-30
pfam00435105 pfam00435, Spectrin, Spectrin repeat 5e-22
smart00150101 smart00150, SPEC, Spectrin repeats 2e-17
cd00176213 cd00176, SPEC, Spectrin repeats, found in several 3e-14
cd00176213 cd00176, SPEC, Spectrin repeats, found in several 3e-12
PTZ00184149 PTZ00184, PTZ00184, calmodulin; Provisional 8e-12
PTZ00183158 PTZ00183, PTZ00183, centrin; Provisional 5e-11
COG5126160 COG5126, FRQ1, Ca2+-binding protein (EF-Hand super 5e-11
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 3e-10
pfam00435105 pfam00435, Spectrin, Spectrin repeat 4e-08
pfam00435105 pfam00435, Spectrin, Spectrin repeat 2e-07
COG5069612 COG5069, SAC6, Ca2+-binding actin-bundling protein 2e-06
smart00150101 smart00150, SPEC, Spectrin repeats 2e-04
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 3e-04
pfam1383353 pfam13833, EF_hand_6, EF-hand domain pair 0.001
pfam1340530 pfam13405, EF_hand_4, EF-hand domain 0.001
>gnl|CDD|219990 pfam08726, efhand_Ca_insen, Ca2+ insensitive EF hand Back     alignment and domain information 
 Score =  115 bits (291), Expect = 2e-31
 Identities = 44/69 (63%), Positives = 51/69 (73%), Gaps = 2/69 (2%)

Query: 529 DTDTAEQVIDSFRILAGDKPYILPDELRRELPPDQAEYCIQRMPPYKGP--NAIPGALDY 586
           DTDTAEQV  SFR LA  KPY+  ++LRR L P+QAEYCI RMPPY GP   ++PGA DY
Sbjct: 1   DTDTAEQVEQSFRALAEGKPYVTEEDLRRALTPEQAEYCIARMPPYSGPDGRSVPGAYDY 60

Query: 587 QSFSTALYG 595
            SF  AL+G
Sbjct: 61  ISFMEALFG 69

EF hands are helix-loop-helix binding motifs involved in the regulation of many cellular processes. EF hands usually bind to Ca2+ ions which causes a major conformational change that allows the protein to interact with its designated targets. This domain corresponds to an EF hand which has partially or entirely lost its calcium-binding properties. The calcium insensitive EF hand is still able to mediate protein-protein recognition. Length = 69
>gnl|CDD|238103 cd00176, SPEC, Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|215918 pfam00435, Spectrin, Spectrin repeat Back     alignment and domain information
>gnl|CDD|197544 smart00150, SPEC, Spectrin repeats Back     alignment and domain information
>gnl|CDD|238103 cd00176, SPEC, Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238103 cd00176, SPEC, Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|185504 PTZ00184, PTZ00184, calmodulin; Provisional Back     alignment and domain information
>gnl|CDD|185503 PTZ00183, PTZ00183, centrin; Provisional Back     alignment and domain information
>gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|215918 pfam00435, Spectrin, Spectrin repeat Back     alignment and domain information
>gnl|CDD|215918 pfam00435, Spectrin, Spectrin repeat Back     alignment and domain information
>gnl|CDD|227401 COG5069, SAC6, Ca2+-binding actin-bundling protein fimbrin/plastin (EF-Hand superfamily) [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|197544 smart00150, SPEC, Spectrin repeats Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|222407 pfam13833, EF_hand_6, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|205583 pfam13405, EF_hand_4, EF-hand domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 599
KOG0517|consensus 2473 100.0
KOG0040|consensus2399 100.0
KOG0517|consensus 2473 100.0
KOG0040|consensus 2399 100.0
KOG0035|consensus890 99.97
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.88
cd00176213 SPEC Spectrin repeats, found in several proteins i 99.84
KOG0027|consensus151 99.83
KOG0028|consensus172 99.76
PTZ00183158 centrin; Provisional 99.72
cd00176213 SPEC Spectrin repeats, found in several proteins i 99.71
KOG4286|consensus 966 99.69
PTZ00184149 calmodulin; Provisional 99.68
KOG0030|consensus152 99.68
KOG0031|consensus171 99.67
KOG0034|consensus187 99.65
KOG4286|consensus 966 99.64
KOG0044|consensus193 99.49
KOG0037|consensus221 99.46
smart00150101 SPEC Spectrin repeats. 99.44
PF00435105 Spectrin: Spectrin repeat; InterPro: IPR002017 Spe 99.39
KOG0036|consensus 463 99.2
KOG4223|consensus325 99.13
KOG0038|consensus189 99.1
PLN02964 644 phosphatidylserine decarboxylase 99.08
smart00150101 SPEC Spectrin repeats. 99.07
KOG0037|consensus221 99.06
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 99.0
PF00435105 Spectrin: Spectrin repeat; InterPro: IPR002017 Spe 98.97
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.94
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.93
KOG0027|consensus151 98.86
KOG4223|consensus325 98.85
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.81
KOG0044|consensus193 98.77
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 98.76
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.72
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.7
KOG0377|consensus631 98.69
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.68
cd0021388 S-100 S-100: S-100 domain, which represents the la 98.68
PTZ00183158 centrin; Provisional 98.67
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.66
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 98.62
PTZ00184149 calmodulin; Provisional 98.6
PF1465866 EF-hand_9: EF-hand domain 98.59
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.56
cd0005267 EH Eps15 homology domain; found in proteins implic 98.56
PF0872669 EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPr 98.53
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 98.51
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 98.46
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.45
KOG0028|consensus172 98.43
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 98.38
KOG4251|consensus362 98.37
KOG0035|consensus 890 98.35
KOG0034|consensus187 98.33
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 98.25
cd0503088 calgranulins Calgranulins: S-100 domain found in p 98.23
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.21
KOG0041|consensus244 98.21
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.2
KOG0036|consensus 463 98.05
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.04
KOG2562|consensus493 98.04
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.03
KOG0031|consensus171 97.98
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 97.97
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 97.9
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 97.89
cd0005267 EH Eps15 homology domain; found in proteins implic 97.85
KOG2643|consensus489 97.83
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 97.81
KOG2643|consensus 489 97.74
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 97.74
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 97.71
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 97.71
KOG0030|consensus152 97.67
PLN02964 644 phosphatidylserine decarboxylase 97.65
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 97.59
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 97.59
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 97.55
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 97.53
KOG4666|consensus412 97.5
cd0021388 S-100 S-100: S-100 domain, which represents the la 97.49
PRK12309391 transaldolase/EF-hand domain-containing protein; P 97.47
cd0503088 calgranulins Calgranulins: S-100 domain found in p 97.46
PF1465866 EF-hand_9: EF-hand domain 97.44
KOG0038|consensus189 97.35
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 97.33
PF121281201 DUF3584: Protein of unknown function (DUF3584); In 97.33
KOG0169|consensus 746 97.2
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 97.03
KOG0041|consensus244 96.98
KOG0377|consensus631 96.96
KOG4065|consensus144 96.89
KOG2562|consensus 493 96.89
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 96.87
KOG0046|consensus 627 96.84
KOG4240|consensus 1025 96.74
KOG0751|consensus 694 96.71
PRK12309391 transaldolase/EF-hand domain-containing protein; P 96.69
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 96.66
KOG0751|consensus 694 96.53
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 96.42
KOG4251|consensus362 96.2
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 95.64
KOG0994|consensus1758 95.26
PF05042174 Caleosin: Caleosin related protein; InterPro: IPR0 95.23
KOG1029|consensus 1118 95.05
KOG4666|consensus412 94.88
KOG0994|consensus1758 94.83
KOG4065|consensus144 94.71
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 94.55
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 94.54
COG5069612 SAC6 Ca2+-binding actin-bundling protein fimbrin/p 93.83
KOG0046|consensus 627 93.45
KOG4240|consensus 1025 93.38
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 93.34
KOG1707|consensus 625 92.47
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 92.4
KOG0161|consensus 1930 92.23
PLN02952 599 phosphoinositide phospholipase C 92.05
KOG1265|consensus 1189 91.81
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 91.51
KOG1955|consensus 737 89.38
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 88.99
PRK04863 1486 mukB cell division protein MukB; Provisional 88.67
PF08580 683 KAR9: Yeast cortical protein KAR9; InterPro: IPR01 88.5
KOG3555|consensus434 88.28
KOG4347|consensus671 87.48
KOG1029|consensus 1118 86.87
KOG0161|consensus 1930 85.73
KOG0042|consensus680 85.35
KOG3555|consensus434 82.58
PF06008264 Laminin_I: Laminin Domain I; InterPro: IPR009254 L 81.76
PF0906990 EF-hand_3: EF-hand; InterPro: IPR015154 Like other 81.48
>KOG0517|consensus Back     alignment and domain information 
Probab=100.00  E-value=6.6e-51  Score=437.13  Aligned_cols=449  Identities=27%  Similarity=0.441  Sum_probs=413.4

Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHhhhhccCCchHHHHHHHHHHHHHhHHhHHhcCCCCCCCCCCCchhHHHHHHHHHHHhH
Q psy12562          3 WLQSRQTDNSLSGVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAYMPTEGKMVSDIANAWKGLETSE   82 (599)
Q Consensus         3 ~l~~~~~~~~~~~v~~~l~~~~~~~~~~~~~~~~~~~~le~~l~~~~~~l~~~~~~~~~~~~~~~~~~l~~~w~~L~~~~   82 (599)
                      .|++|+||+|+.||+++|.+|+.|++.+|||++++++.||..+++++++++++|+++|.|+.|+.+.+|++.|..|+.+.
T Consensus       317 ~L~~R~f~NSL~GvqqqL~aF~~yRT~EKPPKf~EKG~lEvLlFtiQsklrA~Nqk~y~P~eG~li~DInkAW~~LE~AE  396 (2473)
T KOG0517|consen  317 TLESRKFPNSLEGVQQQLAAFNTYRTVEKPPKFQEKGNLEVLLFTIQSKLRANNQKPYTPREGKLISDINKAWERLEKAE  396 (2473)
T ss_pred             HHhhccCccchHHHHHHHHHHHhhhcccCCCccccccchHHHHHHHHHHHHHcCCCCCCCCccchHHHHHHHHHHHHHHH
Confidence            58899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhHHHhcccCCCCCCCHHHHHHHHHHHHHHHHhHHhhHHHHHHHH
Q psy12562         83 KSFEEWLLSEMMRLERLEHLAQKFKHKADIHEDWTRGKEEMLQSSDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQIA  162 (599)
Q Consensus        83 ~~r~~~L~~~~~rl~~l~~l~~~f~~~~~~~~~Wl~~~e~~l~~~~~~~~~l~~v~~~l~~h~~~~~el~~~~~~v~~l~  162 (599)
                      .+|+.+|+..+.|+++|++|+.+|.+++..-++||.+.+..++.+.+| .|+..|++.++||++++++|.+++.+|+.|.
T Consensus       397 heRe~ALr~ELiRQEKLEqLA~RFdrKAamREtwL~enqrlvsqdnfg-~~LaaVEAa~KKheAIetDI~AyeeRvqal~  475 (2473)
T KOG0517|consen  397 HERELALRAELIRQEKLEQLARRFDRKAAMRETWLKENQRLVSQDNFG-YDLAAVEAALKKHEAIETDILAYEERVQALV  475 (2473)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccccC-ccHHHHHHHHHHhhhhhhhHHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999997 6999999999999999999999999999999


Q ss_pred             HHHHHHhhccCCCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----H-----------------
Q psy12562        163 AIAQELNTLEYHDSVSVNARCQRICDQWDHLGALTQQRRHALDEAEKILEKIDILHL-----E-----------------  220 (599)
Q Consensus       163 ~~~~~L~~~~~~~~~~i~~~~~~l~~rw~~L~~~~~~R~~~L~~~~~~~q~~~~~~~-----~-----------------  220 (599)
                      ++++.|...+|++...|..+-+.|-.+|..|..++..|+.+|...+..+.-+..+..     +                 
T Consensus       476 ava~eL~~E~YHd~~rV~~r~~~V~~~W~~Ll~lL~arR~rL~~~~~Lqklfqem~~~~d~meElk~~l~S~d~GkHL~g  555 (2473)
T KOG0517|consen  476 AVADELEAENYHDIKRVAARKDNVLRLWTYLLELLEARRQRLEQMLALQKLFQEMLYTSDWMEELKQQLLSRDVGKHLLG  555 (2473)
T ss_pred             HHHHHHHHhccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHhh
Confidence            999999999999999999999999999999999999999999998877664433210     0                 


Q ss_pred             -------------------------------------------------------------------------------H
Q psy12562        221 -------------------------------------------------------------------------------F  221 (599)
Q Consensus       221 -------------------------------------------------------------------------------f  221 (599)
                                                                                                     |
T Consensus       556 VedLLQkH~LlEadIn~~gerv~~~~a~a~~f~~~~~~~~cdp~vi~~R~~~le~~y~eL~~laa~RRarLE~sr~l~~F  635 (2473)
T KOG0517|consen  556 VEDLLQKHDLLEADINAQGERVKALNAQALRFDSPKEYKPCDPQVIQERVAHLEQCYQELVELAAARRARLEESRRLWQF  635 (2473)
T ss_pred             HHHHHHhhhhHHhHHHHHHHHHHHHHHHHhhcCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence                                                                                           9


Q ss_pred             HHhhhhhhhhhhhhHHHhhHHHHhhcHHHHHHHHHHhHHHHhhHHHHHHHHhHHHHHHHHHHHHHHhhcCCCCCCCCCCC
Q psy12562        222 AKRAAPFNNWLDGTREDLVDMFIVHTMEEIQGLIDAHSQFKATLGEADKEYNSIVNLVREVESTVQQYQIPGGLENPYTA  301 (599)
Q Consensus       222 ~~~~~~l~~Wl~~~~~~l~~~~~~~~~~~v~~ll~~h~~l~~el~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~  301 (599)
                      ..++.+.++||.+++..+++.++|.|+.+|-.++.+|++|+.+|..+.+....+..-|..   ++...++    ..+.|.
T Consensus       636 ~~d~~EeEaWlkEkeqi~~sa~~g~DLs~v~~ll~kHKalE~E~~~~~a~~~~~~~~G~~---Lvae~~p----g~~~i~  708 (2473)
T KOG0517|consen  636 LWDVEEEEAWLKEKEQILSSADTGRDLSSVLRLLQKHKALEDEMRGRDAHLKQMIREGEE---LVAEGHP----GSDQIQ  708 (2473)
T ss_pred             HHHHHHHHHHHHHHHHHhhcccccccHHHHHHHHHHHHHHHHHHhcchhHHHHHHHHHHH---HHhcCCC----CCCcHH
Confidence            999999999999999999999999999999999999999999999999887777777776   5554432    566788


Q ss_pred             CChHHHHHHHHHHHHhhHhHhHHHHHHHHhhcchHHHHHHHHHHhchhhhhHHHHHHHHhhhhccCC-CCHHHHHHHHHH
Q psy12562        302 LTANDLTKKWTDVRKLVPQRDTTLQAELRKQQNNETLRRQFAEKANQVGPWIERQMDAVTSIGMGLQ-GSLEDQLHRLKE  380 (599)
Q Consensus       302 ~~~~~l~~~w~~L~~~~~~R~~~L~~~l~~~~~~~~l~~~f~~~~~~~~~Wl~e~~~~l~~~~~~~~-~~~e~~~~~~~~  380 (599)
                      .++..+..+|+.|..++..|+++|++|..        +++|+.+++++.+||.++...+++.++|.+ ++++.++++|.+
T Consensus       709 ~R~~~i~~~W~~L~~l~~~r~~rL~~A~~--------~~QffaDAdd~~sWl~d~~rlvss~d~G~DE~saq~LlkrH~~  780 (2473)
T KOG0517|consen  709 ERAAEIREQWQRLEALVAGRGRRLQEARE--------LYQFFADADDAESWLRDALRLVSSEDVGHDEASAQALLKRHRD  780 (2473)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH--------HHHHhccHHHHHHHHHHHHHhccchhcCCchHHHHHHHHHHHH
Confidence            99999999999999999999999999998        777999999999999999999999999985 999999999999


Q ss_pred             HHhhhhccccchHHHHHHHHHHhhcccccCCCccc---cHHHHHHHHHHHHHHHHHHHHHHHHHHHh-------------
Q psy12562        381 YEQGVYAYKPHIEELEKIHQAVQEGMIFENRYTQY---TMETLRVGWEQLLTSINRNINEVENQILT-------------  444 (599)
Q Consensus       381 ~~~ei~~~~~~~~~l~~~~~~l~~~~~~~~~~~~~---~~~~l~~~w~~l~~~~~~r~~~Le~~~~~-------------  444 (599)
                      +..||.++.+.+..|.+.+..|... ..+.|.+..   +++.+...|..+..+..-|...|+.++..             
T Consensus       781 l~~El~a~~~~i~~L~eQa~~l~~~-~~e~p~V~~~~~R~~~i~q~Y~El~~lA~lRrq~L~dalaLy~~~se~d~~ElW  859 (2473)
T KOG0517|consen  781 LEEELRAYRGDIDRLEEQASALPQE-SPEGPEVRQPLQRQDTISQDYEELQELAQLRRQRLEDALALYGFYSECDACELW  859 (2473)
T ss_pred             HHHHHHHhhhHHHHHHHHHHhhccc-cCCCcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccHHHHH
Confidence            9999999999999999999999874 567788887   99999999999999999999999975422             


Q ss_pred             --------hhc-cCCCHHHHHHHHHHHHhhcCC
Q psy12562        445 --------RDS-KGITQEQLNEFRASFNHFDKN  468 (599)
Q Consensus       445 --------~~~-~~~~~~~~~~~~~~F~~~d~~  468 (599)
                              ..+ .+-+.+.++.++.-|..|+++
T Consensus       860 i~Eke~~L~~m~~~~~~E~vev~q~rFe~l~~e  892 (2473)
T KOG0517|consen  860 IKEKEKWLATMSPPDSLEDVEVMQHRFEKLEQE  892 (2473)
T ss_pred             HHHHHHHHhccCCCCChhHHHHHHHHHHHHHHH
Confidence                    111 145678888899999999876

>KOG0040|consensus Back     alignment and domain information
>KOG0517|consensus Back     alignment and domain information
>KOG0040|consensus Back     alignment and domain information
>KOG0035|consensus Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>cd00176 SPEC Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>cd00176 SPEC Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here Back     alignment and domain information
>KOG4286|consensus Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0030|consensus Back     alignment and domain information
>KOG0031|consensus Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>KOG4286|consensus Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>KOG0037|consensus Back     alignment and domain information
>smart00150 SPEC Spectrin repeats Back     alignment and domain information
>PF00435 Spectrin: Spectrin repeat; InterPro: IPR002017 Spectrin repeats [] are found in several proteins involved in cytoskeletal structure Back     alignment and domain information
>KOG0036|consensus Back     alignment and domain information
>KOG4223|consensus Back     alignment and domain information
>KOG0038|consensus Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>smart00150 SPEC Spectrin repeats Back     alignment and domain information
>KOG0037|consensus Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>PF00435 Spectrin: Spectrin repeat; InterPro: IPR002017 Spectrin repeats [] are found in several proteins involved in cytoskeletal structure Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>KOG4223|consensus Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>PF08726 EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPro: IPR014837 EF hands are helix-loop-helix binding motifs involved in the regulation of many cellular processes Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>KOG4251|consensus Back     alignment and domain information
>KOG0035|consensus Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>KOG0041|consensus Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>KOG0036|consensus Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>KOG2562|consensus Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>KOG0031|consensus Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>KOG2643|consensus Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>KOG2643|consensus Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>KOG0030|consensus Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>KOG4666|consensus Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>KOG0038|consensus Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>KOG0169|consensus Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG0041|consensus Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>KOG4065|consensus Back     alignment and domain information
>KOG2562|consensus Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>KOG4240|consensus Back     alignment and domain information
>KOG0751|consensus Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG0751|consensus Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>KOG4251|consensus Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG4666|consensus Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>KOG4065|consensus Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>COG5069 SAC6 Ca2+-binding actin-bundling protein fimbrin/plastin (EF-Hand superfamily) [Cytoskeleton] Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>KOG4240|consensus Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>KOG0161|consensus Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>KOG1265|consensus Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>KOG1955|consensus Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PF08580 KAR9: Yeast cortical protein KAR9; InterPro: IPR013889 The KAR9 protein in Saccharomyces cerevisiae (Baker's yeast) is a cytoskeletal protein required for karyogamy, correct positioning of the mitotic spindle and for orientation of cytoplasmic microtubules [] Back     alignment and domain information
>KOG3555|consensus Back     alignment and domain information
>KOG4347|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG0161|consensus Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>KOG3555|consensus Back     alignment and domain information
>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells Back     alignment and domain information
>PF09069 EF-hand_3: EF-hand; InterPro: IPR015154 Like other EF hand domains, this domain forms a helix-loop-helix motif, though since it does not contain the canonical pattern of calcium binding residues found in many EF hand domains, it does not bind calcium ions Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query599
1sjj_A863 Cryo-Em Structure Of Chicken Gizzard Smooth Muscle 0.0
1hci_A476 Crystal Structure Of The Rod Domain Of Alpha-Actini 1e-156
1quu_A250 Crystal Structure Of Two Central Spectrin-Like Repe 1e-82
1wlx_A129 Solution Structure Of The Third Spectrin Repeat Of 3e-32
1h8b_A75 Ef-Hands 3,4 From Alpha-Actinin Z-Repeat 7 From Tit 7e-30
3ek8_A449 Calcium-Saturated Gcamp2 T116vG87R MUTANT MONOMER L 2e-10
3sg6_A450 Crystal Structure Of Dimeric Gcamp2-Lia(Linker 1) L 3e-10
3evu_A449 Crystal Structure Of Calcium Bound Dimeric Gcamp2, 3e-10
4djc_A152 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCA 3e-10
1dmo_A148 Calmodulin, Nmr, 30 Structures Length = 148 3e-10
3ewt_A154 Crystal Structure Of Calmodulin Complexed With A Pe 3e-10
1cm1_A148 Motions Of Calmodulin-Single-Conformer Refinement L 3e-10
3o78_A415 The Structure Of Ca2+ Sensor (Case-12) Length = 415 3e-10
2f2o_A179 Structure Of Calmodulin Bound To A Calcineurin Pept 3e-10
3evr_A411 Crystal Structure Of Calcium Bound Monomeric Gcamp2 3e-10
1xfu_O149 Crystal Structure Of Anthrax Edema Factor (ef) Trun 3e-10
1iq5_A149 CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE 3e-10
2ygg_B150 Complex Of Cambr And Cam Length = 150 3e-10
2wel_D150 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 3e-10
2be6_A150 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaC 3e-10
2vay_A146 Calmodulin Complexed With Cav1.1 Iq Peptide Length 3e-10
4gow_D144 Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX 4e-10
3sg7_A448 Crystal Structure Of Gcamp3-Kf(Linker 1) Length = 4 4e-10
2ix7_A145 Structure Of Apo-Calmodulin Bound To Unconventional 4e-10
2ycu_A995 Crystal Structure Of Human Non Muscle Myosin 2c In 4e-10
1cdm_A144 Modulation Of Calmodulin Plasticity In Molecular Re 4e-10
1prw_A149 Crystal Structure Of Bovine Brain Ca++ Calmodulin I 4e-10
1up5_B148 Chicken Calmodulin Length = 148 4e-10
1cdl_A147 Target Enzyme Recognition By Calmodulin: 2.4 Angstr 4e-10
2k0j_A148 Solution Structure Of Cam Complexed To Drp1p Length 4e-10
1g8x_A1010 Structure Of A Genetically Engineered Molecular Mot 5e-10
1k93_D144 Crystal Structure Of The Adenylyl Cyclase Domain Of 6e-10
3o77_A415 The Structure Of Ca2+ Sensor (Case-16) Length = 415 6e-10
1y0v_H146 Crystal Structure Of Anthrax Edema Factor (Ef) In C 6e-10
3u0k_A440 Crystal Structure Of The Genetically Encoded Calciu 6e-10
3ekh_A449 Calcium-Saturated Gcamp2 T116vK378W MUTANT MONOMER 8e-10
2lmt_A148 Nmr Structure Of Androcam Length = 148 1e-09
2bkh_B149 Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc 1e-09
1ooj_A149 Structural Genomics Of Caenorhabditis Elegans : Cal 1e-09
2vb6_B149 Myosin Vi (Md-Insert2-Cam, Delta Insert1) Post-Rigo 1e-09
2lv6_A148 The Complex Between Ca-calmodulin And Skeletal Musc 1e-09
1rfj_A149 Crystal Structure Of Potato Calmodulin Pcm6 Length 1e-09
1qtx_A148 The 1.65 Angstrom Structure Of Calmodulin Rs20 Pept 1e-09
2bbm_A148 Solution Structure Of A Calmodulin-Target Peptide C 1e-09
1qs7_A145 The 1.8 Angstrom Structure Of Calmodulin Rs20 Pepti 1e-09
1vrk_A148 The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 1e-09
3qrx_A169 Chlamydomonas Reinhardtii Centrin Bound To Melittin 1e-09
4aqr_A149 Crystal Structure Of A Calmodulin In Complex With T 2e-09
3sg2_A449 Crystal Structure Of Gcamp2-T116v,D381y Length = 44 3e-09
3ekj_A449 Calcium-Free Gcamp2 (Calcium Binding Deficient Muta 4e-09
3sg3_A449 Crystal Structure Of Gcamp3-D380y Length = 449 5e-09
3kf9_A149 Crystal Structure Of The SdcenSKMLCK COMPLEX Length 6e-09
2l1w_A149 The Solution Structure Of Soybean Calmodulin Isofor 6e-09
3sg4_A448 Crystal Structure Of Gcamp3-D380y, Lp(Linker 2) Len 8e-09
3sg5_A448 Crystal Structure Of Dimeric Gcamp3-D380y, Qp(Linke 9e-09
1deg_A142 The Linker Of Des-Glu84 Calmodulin Is Bent As Seen 1e-08
1ggz_A148 Crystal Structure Of The Calmodulin-Like Protein (H 1e-08
2obh_A143 Centrin-Xpc Peptide Length = 143 1e-08
3ifk_A90 Crystal Structure Of Calcium-Saturated Calmodulin N 2e-08
1xfx_O149 Crystal Structure Of Anthrax Edema Factor (Ef) In C 2e-08
1niw_A148 Crystal Structure Of Endothelial Nitric Oxide Synth 3e-08
1y6w_A148 Trapped Intermediate Of Calmodulin Length = 148 4e-08
1clm_A148 Structure Of Paramecium Tetraurelia Calmodulin At 1 6e-08
1exr_A148 The 1.0 Angstrom Crystal Structure Of Ca+2 Bound Ca 6e-08
1ahr_A146 Calmodulin Mutant With A Two Residue Deletion In Th 4e-07
1lkj_A146 Nmr Structure Of Apo Calmodulin From Yeast Saccharo 4e-07
2lhh_A128 Solution Structure Of Ca2+-Bound Ycam Length = 128 7e-07
2lhi_A176 Solution Structure Of Ca2+CNA1 PEPTIDE-Bound Ycam L 9e-07
4ds7_A147 Crystal Structure Of Yeast Calmodulin Bound To The 1e-06
2llo_A80 Solution Nmr-Derived Structure Of Calmodulin N-Lobe 3e-06
1aj4_A161 Structure Of Calcium-Saturated Cardiac Troponin C, 6e-06
3ctn_A76 Structure Of Calcium-Saturated Cardiac Troponin C, 9e-06
2ro8_A79 Solution Structure Of Calcium Bound Soybean Calmodu 1e-05
3uct_A79 Structure Of Mn2+-Bound N-Terminal Domain Of Calmod 1e-05
2joj_A77 Nmr Solution Structure Of N-Terminal Domain Of Eupl 1e-05
1sw8_A79 Solution Structure Of The N-Terminal Domain Of Huma 2e-05
1dtl_A161 Crystal Structure Of Calcium-Saturated (3ca2+) Card 2e-05
1u4q_A322 Crystal Structure Of Repeats 15, 16 And 17 Of Chick 2e-05
1u4q_A322 Crystal Structure Of Repeats 15, 16 And 17 Of Chick 3e-04
1cun_A213 Crystal Structure Of Repeats 16 And 17 Of Chicken B 2e-05
2lan_A167 Nmr Structure Of Ca2+-Bound Cabp1 N-Domain With Rdc 6e-05
1zmz_A98 Solution Structure Of The N-Terminal Domain (M1-S98 6e-05
2lqc_A77 Nmr Solution Structure Of A Ca2+-Calmodulin With A 7e-05
1f70_A76 Refined Solution Structure Of Calmodulin N-Terminal 8e-05
3b32_A75 Crystal Structure Of Calcium-Saturated Calmodulin N 8e-05
1ak8_A76 Nmr Solution Structure Of Cerium-Loaded Calmodulin 8e-05
1ydi_B24 Human Vinculin Head Domain (Vh1, 1-258) In Complex 9e-05
1j7o_A76 Solution Structure Of Calcium-calmodulin N-terminal 9e-05
1la0_A161 Solution Structure Of Calcium Saturated Cardiac Tro 9e-05
1a2x_A159 Complex Of Troponin C With A 47 Residue (1-47) Frag 1e-04
1fi5_A81 Nmr Structure Of The C Terminal Domain Of Cardiac T 1e-04
2i08_A78 Solvation Effect In Conformational Changes Of Ef-Ha 2e-04
2ami_A96 Solution Structure Of The Calcium-Loaded N-Terminal 2e-04
2ggm_A172 Human Centrin 2 Xeroderma Pigmentosum Group C Prote 2e-04
1tcf_A159 Crystal Structure Of Calcium-Saturated Rabbit Skele 2e-04
1f54_A77 Solution Structure Of The Apo N-Terminal Domain Of 2e-04
2jt0_A161 Solution Structure Of F104w Cardiac Troponin C Leng 3e-04
2jt3_A161 Solution Structure Of F153w Cardiac Troponin C Leng 3e-04
1ozs_A73 C-Domain Of Human Cardiac Troponin C In Complex Wit 3e-04
4tnc_A162 Refined Structure Of Chicken Skeletal Muscle Tropon 3e-04
2roa_A79 Solution Structure Of Calcium Bound Soybean Calmodu 4e-04
2jtz_A161 Solution Structure And Chemical Shift Assignments O 4e-04
2jt8_A161 Solution Structure Of The F153-To-5-Flurotryptophan 4e-04
2jt8_A161 Solution Structure Of The F153-To-5-Flurotryptophan 7e-04
1u5p_A216 Crystal Structure Of Repeats 15 And 16 Of Chicken B 7e-04
5tnc_A162 Refined Crystal Structure Of Troponin C From Turkey 7e-04
>pdb|1SJJ|A Chain A, Cryo-Em Structure Of Chicken Gizzard Smooth Muscle Alpha- Actinin Length = 863 Back     alignment and structure 
Iteration: 1

 Score =  788 bits (2034), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/599 (61%), Positives = 464/599 (77%), Gaps = 5/599 (0%)
Query: 1   MPWLQSRQTDNSLSGVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAY 60
           +PWL++R  +N++  +Q+KLE++R YRR HKPP+V++K +LE NFNTLQTKLRLSNRPA+
Sbjct: 270 IPWLENRAPENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAF 329
Query: 61  MPTEGKMVSDIANAWKGLETSEKSFXXXXXXXXXXXXXXXXXAQKFKHKADIHEDWTRGK 120
           MP+EGKMVSDI NAW GLE +EK +                 A+KF+ KA IHE WT GK
Sbjct: 330 MPSEGKMVSDINNAWGGLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHESWTDGK 389
Query: 121 EEMLQSSDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNTLEYHDSVSVN 180
           E MLQ  D+    L+E+KAL KKHEAFESDLAAHQDRVEQIAAIAQELN L+Y+DS SVN
Sbjct: 390 EAMLQQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVN 449
Query: 181 ARCQRICDQWDHLGALTQQRRHALDEAEKILEKIDILHLEFAKRAAPFNNWLDGTREDLV 240
           ARCQ+ICDQWD+LGALTQ+RR AL+  EK+LE ID L+LE+AKRAAPFNNW++G  EDL 
Sbjct: 450 ARCQKICDQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQ 509
Query: 241 DMFIVHTMEEIQGLIDAHSQFKATLGEADKEYNSIVNLVREVESTVQQYQIPGGLENPYT 300
           D FIVHT+EEIQGL  AH QFKATL +ADKE  +I+ +  EV   VQ Y +     NPYT
Sbjct: 510 DTFIVHTIEEIQGLTTAHEQFKATLPDADKERQAILGIHNEVSKIVQTYHVNMAGTNPYT 569
Query: 301 ALTANDLTKKWTDVRKLVPQRDTTLQAELRKQQNNETLRRQFAEKANQVGPWIERQMDAV 360
            +T  ++  KW  VR+LVP+RD  L  E  +QQ NE LR+QF  +AN +GPWI+ +M+ +
Sbjct: 570 TITPQEINGKWEHVRQLVPRRDQALMEEHARQQQNERLRKQFGAQANVIGPWIQTKMEEI 629
Query: 361 TSIGMGLQGSLEDQLHRLKEYEQGVYAYKPHIEELEKIHQAVQEGMIFENRYTQYTMETL 420
             I + + G+LEDQL+ L++YE+ +  YKP I++LE  HQ +QE +IF+N++T YTME +
Sbjct: 630 GRISIEMHGTLEDQLNHLRQYEKSIVNYKPKIDQLEGDHQQIQEALIFDNKHTNYTMEHI 689
Query: 421 RVGWEQLLTSINRNINEVENQILTRDSKGITQEQLNEFRASFNHFDKNRTGRLAPEEFKS 480
           RVGWEQLLT+I R INEVENQILTRD+KGI+QEQ+NEFRASFNHFD+ +TG +  E+F++
Sbjct: 690 RVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRKKTGMMDCEDFRA 749
Query: 481 CLVSLGYSIGKDRQGEIDFQRILAVVDPNSTGYVHFDAFLDFMTRESTDTDTAEQVIDSF 540
           CL+S+GY++     GE +F RI+++VDPN  G V F AF+DFM+RE+ DTDTA+QV+ SF
Sbjct: 750 CLISMGYNM-----GEAEFARIMSIVDPNRMGVVTFQAFIDFMSRETADTDTADQVMASF 804
Query: 541 RILAGDKPYILPDELRRELPPDQAEYCIQRMPPYKGPNAIPGALDYQSFSTALYGESDL 599
           +ILAGDK YI  DELRRELPPDQAEYCI RM PY G +A+PGALDY SFSTALYGESDL
Sbjct: 805 KILAGDKNYITVDELRRELPPDQAEYCIARMAPYNGRDAVPGALDYMSFSTALYGESDL 863
>pdb|1HCI|A Chain A, Crystal Structure Of The Rod Domain Of Alpha-Actinin Length = 476 Back     alignment and structure
>pdb|1QUU|A Chain A, Crystal Structure Of Two Central Spectrin-Like Repeats From Alpha-Actinin Length = 250 Back     alignment and structure
>pdb|1WLX|A Chain A, Solution Structure Of The Third Spectrin Repeat Of Alpha- Actinin-4 Length = 129 Back     alignment and structure
>pdb|3EK8|A Chain A, Calcium-Saturated Gcamp2 T116vG87R MUTANT MONOMER Length = 449 Back     alignment and structure
>pdb|3SG6|A Chain A, Crystal Structure Of Dimeric Gcamp2-Lia(Linker 1) Length = 450 Back     alignment and structure
>pdb|3EVU|A Chain A, Crystal Structure Of Calcium Bound Dimeric Gcamp2, (#1) Length = 449 Back     alignment and structure
>pdb|4DJC|A Chain A, 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCAM COMPLEX Length = 152 Back     alignment and structure
>pdb|1DMO|A Chain A, Calmodulin, Nmr, 30 Structures Length = 148 Back     alignment and structure
>pdb|3EWT|A Chain A, Crystal Structure Of Calmodulin Complexed With A Peptide Length = 154 Back     alignment and structure
>pdb|1CM1|A Chain A, Motions Of Calmodulin-Single-Conformer Refinement Length = 148 Back     alignment and structure
>pdb|3O78|A Chain A, The Structure Of Ca2+ Sensor (Case-12) Length = 415 Back     alignment and structure
>pdb|2F2O|A Chain A, Structure Of Calmodulin Bound To A Calcineurin Peptide: A New Way Of Making An Old Binding Mode Length = 179 Back     alignment and structure
>pdb|3EVR|A Chain A, Crystal Structure Of Calcium Bound Monomeric Gcamp2 Length = 411 Back     alignment and structure
>pdb|1XFU|O Chain O, Crystal Structure Of Anthrax Edema Factor (ef) Truncation Mutant, Ef-delta 64 In Complex With Calmodulin Length = 149 Back     alignment and structure
>pdb|1IQ5|A Chain A, CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE KINASE Fragment Length = 149 Back     alignment and structure
>pdb|2YGG|B Chain B, Complex Of Cambr And Cam Length = 150 Back     alignment and structure
>pdb|2WEL|D Chain D, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 150 Back     alignment and structure
>pdb|2BE6|A Chain A, 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaCAM COMPLEX Length = 150 Back     alignment and structure
>pdb|2VAY|A Chain A, Calmodulin Complexed With Cav1.1 Iq Peptide Length = 146 Back     alignment and structure
>pdb|4GOW|D Chain D, Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX COMPLEX Length = 144 Back     alignment and structure
>pdb|3SG7|A Chain A, Crystal Structure Of Gcamp3-Kf(Linker 1) Length = 448 Back     alignment and structure
>pdb|2IX7|A Chain A, Structure Of Apo-Calmodulin Bound To Unconventional Myosin V Length = 145 Back     alignment and structure
>pdb|2YCU|A Chain A, Crystal Structure Of Human Non Muscle Myosin 2c In Pre-power Stroke State Length = 995 Back     alignment and structure
>pdb|1CDM|A Chain A, Modulation Of Calmodulin Plasticity In Molecular Recognition On The Basis Of X-Ray Structures Length = 144 Back     alignment and structure
>pdb|1PRW|A Chain A, Crystal Structure Of Bovine Brain Ca++ Calmodulin In A Compact Form Length = 149 Back     alignment and structure
>pdb|1UP5|B Chain B, Chicken Calmodulin Length = 148 Back     alignment and structure
>pdb|1CDL|A Chain A, Target Enzyme Recognition By Calmodulin: 2.4 Angstroms Structure Of A Calmodulin-Peptide Complex Length = 147 Back     alignment and structure
>pdb|2K0J|A Chain A, Solution Structure Of Cam Complexed To Drp1p Length = 148 Back     alignment and structure
>pdb|1G8X|A Chain A, Structure Of A Genetically Engineered Molecular Motor Length = 1010 Back     alignment and structure
>pdb|1K93|D Chain D, Crystal Structure Of The Adenylyl Cyclase Domain Of Anthrax Edema Factor (Ef) In Complex With Calmodulin Length = 144 Back     alignment and structure
>pdb|3O77|A Chain A, The Structure Of Ca2+ Sensor (Case-16) Length = 415 Back     alignment and structure
>pdb|1Y0V|H Chain H, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And Pyrophosphate Length = 146 Back     alignment and structure
>pdb|3U0K|A Chain A, Crystal Structure Of The Genetically Encoded Calcium Indicator Rcamp Length = 440 Back     alignment and structure
>pdb|3EKH|A Chain A, Calcium-Saturated Gcamp2 T116vK378W MUTANT MONOMER Length = 449 Back     alignment and structure
>pdb|2LMT|A Chain A, Nmr Structure Of Androcam Length = 148 Back     alignment and structure
>pdb|2BKH|B Chain B, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 149 Back     alignment and structure
>pdb|1OOJ|A Chain A, Structural Genomics Of Caenorhabditis Elegans : Calmodulin Length = 149 Back     alignment and structure
>pdb|2VB6|B Chain B, Myosin Vi (Md-Insert2-Cam, Delta Insert1) Post-Rigor State ( Crystal Form 2) Length = 149 Back     alignment and structure
>pdb|2LV6|A Chain A, The Complex Between Ca-calmodulin And Skeletal Muscle Myosin Light Chain Kinase From Combination Of Nmr And Aqueous And Contrast-matched Saxs Data Length = 148 Back     alignment and structure
>pdb|1RFJ|A Chain A, Crystal Structure Of Potato Calmodulin Pcm6 Length = 149 Back     alignment and structure
>pdb|1QTX|A Chain A, The 1.65 Angstrom Structure Of Calmodulin Rs20 Peptide Complex Length = 148 Back     alignment and structure
>pdb|2BBM|A Chain A, Solution Structure Of A Calmodulin-Target Peptide Complex By Multidimensional Nmr Length = 148 Back     alignment and structure
>pdb|1QS7|A Chain A, The 1.8 Angstrom Structure Of Calmodulin Rs20 Peptide Complex Length = 145 Back     alignment and structure
>pdb|1VRK|A Chain A, The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 Peptide Complex Length = 148 Back     alignment and structure
>pdb|3QRX|A Chain A, Chlamydomonas Reinhardtii Centrin Bound To Melittin Length = 169 Back     alignment and structure
>pdb|4AQR|A Chain A, Crystal Structure Of A Calmodulin In Complex With The Regulatory Domain Of A Plasma-Membrane Ca2+-Atpase Length = 149 Back     alignment and structure
>pdb|3SG2|A Chain A, Crystal Structure Of Gcamp2-T116v,D381y Length = 449 Back     alignment and structure
>pdb|3EKJ|A Chain A, Calcium-Free Gcamp2 (Calcium Binding Deficient Mutant) Length = 449 Back     alignment and structure
>pdb|3SG3|A Chain A, Crystal Structure Of Gcamp3-D380y Length = 449 Back     alignment and structure
>pdb|3KF9|A Chain A, Crystal Structure Of The SdcenSKMLCK COMPLEX Length = 149 Back     alignment and structure
>pdb|2L1W|A Chain A, The Solution Structure Of Soybean Calmodulin Isoform 4 Complexed With The Vacuolar Calcium Atpase Bca1 Peptide Length = 149 Back     alignment and structure
>pdb|3SG4|A Chain A, Crystal Structure Of Gcamp3-D380y, Lp(Linker 2) Length = 448 Back     alignment and structure
>pdb|3SG5|A Chain A, Crystal Structure Of Dimeric Gcamp3-D380y, Qp(Linker 1), Lp(Linker 2) Length = 448 Back     alignment and structure
>pdb|1DEG|A Chain A, The Linker Of Des-Glu84 Calmodulin Is Bent As Seen In The Crystal Structure Length = 142 Back     alignment and structure
>pdb|1GGZ|A Chain A, Crystal Structure Of The Calmodulin-Like Protein (Hclp) From Human Epithelial Cells Length = 148 Back     alignment and structure
>pdb|2OBH|A Chain A, Centrin-Xpc Peptide Length = 143 Back     alignment and structure
>pdb|3IFK|A Chain A, Crystal Structure Of Calcium-Saturated Calmodulin N-Terminal Domain Fragment, Residues 1-90 Length = 90 Back     alignment and structure
>pdb|1XFX|O Chain O, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin In The Presence Of 10 Millimolar Exogenously Added Calcium Chloride Length = 149 Back     alignment and structure
>pdb|1NIW|A Chain A, Crystal Structure Of Endothelial Nitric Oxide Synthase Peptide Bound To Calmodulin Length = 148 Back     alignment and structure
>pdb|1Y6W|A Chain A, Trapped Intermediate Of Calmodulin Length = 148 Back     alignment and structure
>pdb|1CLM|A Chain A, Structure Of Paramecium Tetraurelia Calmodulin At 1.8 Angstroms Resolution Length = 148 Back     alignment and structure
>pdb|1EXR|A Chain A, The 1.0 Angstrom Crystal Structure Of Ca+2 Bound Calmodulin Length = 148 Back     alignment and structure
>pdb|1AHR|A Chain A, Calmodulin Mutant With A Two Residue Deletion In The Central Helix Length = 146 Back     alignment and structure
>pdb|1LKJ|A Chain A, Nmr Structure Of Apo Calmodulin From Yeast Saccharomyces Cerevisiae Length = 146 Back     alignment and structure
>pdb|2LHH|A Chain A, Solution Structure Of Ca2+-Bound Ycam Length = 128 Back     alignment and structure
>pdb|2LHI|A Chain A, Solution Structure Of Ca2+CNA1 PEPTIDE-Bound Ycam Length = 176 Back     alignment and structure
>pdb|4DS7|A Chain A, Crystal Structure Of Yeast Calmodulin Bound To The C-Terminal Fragment Of Spindle Pole Body Protein Spc110 Length = 147 Back     alignment and structure
>pdb|2LLO|A Chain A, Solution Nmr-Derived Structure Of Calmodulin N-Lobe Bound With Er Alpha Peptide Length = 80 Back     alignment and structure
>pdb|1AJ4|A Chain A, Structure Of Calcium-Saturated Cardiac Troponin C, Nmr, 1 Structure Length = 161 Back     alignment and structure
>pdb|3CTN|A Chain A, Structure Of Calcium-Saturated Cardiac Troponin C, Nmr, 30 Structures Length = 76 Back     alignment and structure
>pdb|2RO8|A Chain A, Solution Structure Of Calcium Bound Soybean Calmodulin Isoform 1 N-Terminal Domain Length = 79 Back     alignment and structure
>pdb|3UCT|A Chain A, Structure Of Mn2+-Bound N-Terminal Domain Of Calmodulin In The Presence Of Zn2+ Length = 79 Back     alignment and structure
>pdb|2JOJ|A Chain A, Nmr Solution Structure Of N-Terminal Domain Of Euplotes Octocarinatus Centrin Length = 77 Back     alignment and structure
>pdb|1SW8|A Chain A, Solution Structure Of The N-Terminal Domain Of Human N60d Calmodulin Refined With Paramagnetism Based Strategy Length = 79 Back     alignment and structure
>pdb|1DTL|A Chain A, Crystal Structure Of Calcium-Saturated (3ca2+) Cardiac Troponin C Complexed With The Calcium Sensitizer Bepridil At 2.15 A Resolution Length = 161 Back     alignment and structure
>pdb|1U4Q|A Chain A, Crystal Structure Of Repeats 15, 16 And 17 Of Chicken Brain Alpha Spectrin Length = 322 Back     alignment and structure
>pdb|1U4Q|A Chain A, Crystal Structure Of Repeats 15, 16 And 17 Of Chicken Brain Alpha Spectrin Length = 322 Back     alignment and structure
>pdb|1CUN|A Chain A, Crystal Structure Of Repeats 16 And 17 Of Chicken Brain Alpha Spectrin Length = 213 Back     alignment and structure
>pdb|2LAN|A Chain A, Nmr Structure Of Ca2+-Bound Cabp1 N-Domain With Rdc Length = 167 Back     alignment and structure
>pdb|1ZMZ|A Chain A, Solution Structure Of The N-Terminal Domain (M1-S98) Of Human Centrin 2 Length = 98 Back     alignment and structure
>pdb|2LQC|A Chain A, Nmr Solution Structure Of A Ca2+-Calmodulin With A Binding Motif (Nscate) Peptide From The N-Terminal Cytoplasmic Domain Of The L-Type Voltage-Cated Calcium Channel Alpha1c Subunit Length = 77 Back     alignment and structure
>pdb|1F70|A Chain A, Refined Solution Structure Of Calmodulin N-Terminal Domain Length = 76 Back     alignment and structure
>pdb|3B32|A Chain A, Crystal Structure Of Calcium-Saturated Calmodulin N-Terminal Domain Fragment, Residues 1-75 Length = 75 Back     alignment and structure
>pdb|1AK8|A Chain A, Nmr Solution Structure Of Cerium-Loaded Calmodulin Amino- Terminal Domain (Ce2-Tr1c), 23 Structures Length = 76 Back     alignment and structure
>pdb|1YDI|B Chain B, Human Vinculin Head Domain (Vh1, 1-258) In Complex With Human Alpha-Actinin's Vinculin-Binding Site (Residues 731- 760) Length = 24 Back     alignment and structure
>pdb|1J7O|A Chain A, Solution Structure Of Calcium-calmodulin N-terminal Domain Length = 76 Back     alignment and structure
>pdb|1LA0|A Chain A, Solution Structure Of Calcium Saturated Cardiac Troponin C In The Troponin C-Troponin I Complex Length = 161 Back     alignment and structure
>pdb|1A2X|A Chain A, Complex Of Troponin C With A 47 Residue (1-47) Fragment Of Troponin I Length = 159 Back     alignment and structure
>pdb|1FI5|A Chain A, Nmr Structure Of The C Terminal Domain Of Cardiac Troponin C Bound To The N Terminal Domain Of Cardiac Troponin I. Length = 81 Back     alignment and structure
>pdb|2I08|A Chain A, Solvation Effect In Conformational Changes Of Ef-Hand Proteins: X-Ray Structure Of Ca2+-Saturated Double Mutant Q41l-K75i Of N-Domain Of Calmodulin Length = 78 Back     alignment and structure
>pdb|2AMI|A Chain A, Solution Structure Of The Calcium-Loaded N-Terminal Sensor Domain Of Centrin Length = 96 Back     alignment and structure
>pdb|2GGM|A Chain A, Human Centrin 2 Xeroderma Pigmentosum Group C Protein Complex Length = 172 Back     alignment and structure
>pdb|1TCF|A Chain A, Crystal Structure Of Calcium-Saturated Rabbit Skeletal Troponin C Length = 159 Back     alignment and structure
>pdb|1F54|A Chain A, Solution Structure Of The Apo N-Terminal Domain Of Yeast Calmodulin Length = 77 Back     alignment and structure
>pdb|2JT0|A Chain A, Solution Structure Of F104w Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|2JT3|A Chain A, Solution Structure Of F153w Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|1OZS|A Chain A, C-Domain Of Human Cardiac Troponin C In Complex With The Inhibitory Region Of Human Cardiac Troponin I Length = 73 Back     alignment and structure
>pdb|4TNC|A Chain A, Refined Structure Of Chicken Skeletal Muscle Troponin C In The Two-Calcium State At 2-Angstroms Resolution Length = 162 Back     alignment and structure
>pdb|2ROA|A Chain A, Solution Structure Of Calcium Bound Soybean Calmodulin Isoform 4 N-Terminal Domain Length = 79 Back     alignment and structure
>pdb|2JTZ|A Chain A, Solution Structure And Chemical Shift Assignments Of The F104-To-5-Flurotryptophan Mutant Of Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|2JT8|A Chain A, Solution Structure Of The F153-To-5-Flurotryptophan Mutant Of Human Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|2JT8|A Chain A, Solution Structure Of The F153-To-5-Flurotryptophan Mutant Of Human Cardiac Troponin C Length = 161 Back     alignment and structure
>pdb|1U5P|A Chain A, Crystal Structure Of Repeats 15 And 16 Of Chicken Brain Alpha Spectrin Length = 216 Back     alignment and structure
>pdb|5TNC|A Chain A, Refined Crystal Structure Of Troponin C From Turkey Skeletal Muscle At 2.0 Angstroms Resolution Length = 162 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query599
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 0.0
1sjj_A 863 Actinin; 3-helix bundle, calponin homology domain, 5e-18
1hci_A476 Alpha-actinin 2; triple-helix coiled coil, contrac 1e-107
1hci_A476 Alpha-actinin 2; triple-helix coiled coil, contrac 6e-13
1quu_A250 Human skeletal muscle alpha-actinin 2; triple-heli 2e-66
1quu_A250 Human skeletal muscle alpha-actinin 2; triple-heli 5e-16
1quu_A250 Human skeletal muscle alpha-actinin 2; triple-heli 9e-13
1u4q_A322 Spectrin alpha chain, brain; alpha spectrin, three 2e-54
1u4q_A322 Spectrin alpha chain, brain; alpha spectrin, three 9e-23
1u4q_A322 Spectrin alpha chain, brain; alpha spectrin, three 3e-19
3kbt_A326 Beta-I spectrin, spectrin beta chain, erythrocyte; 2e-47
3kbt_A326 Beta-I spectrin, spectrin beta chain, erythrocyte; 1e-14
2odv_A235 Plectin 1, HD1; plakin domain, spectrin repeat, cy 2e-47
2odv_A235 Plectin 1, HD1; plakin domain, spectrin repeat, cy 5e-18
1wlx_A129 Alpha-actinin 4; three-helix bundle, protein bindi 6e-47
1wlx_A129 Alpha-actinin 4; three-helix bundle, protein bindi 3e-20
1u5p_A216 Spectrin alpha chain, brain; alpha spectrin, two r 4e-34
1u5p_A216 Spectrin alpha chain, brain; alpha spectrin, two r 1e-18
1u5p_A216 Spectrin alpha chain, brain; alpha spectrin, two r 2e-08
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 1e-33
3edv_A323 Spectrin beta chain, brain 1; spectrin repeat, coi 8e-33
3edv_A323 Spectrin beta chain, brain 1; spectrin repeat, coi 5e-31
1cun_A213 Protein (alpha spectrin); two repeats of spectrin, 3e-32
1cun_A213 Protein (alpha spectrin); two repeats of spectrin, 2e-24
1cun_A213 Protein (alpha spectrin); two repeats of spectrin, 1e-06
3fb2_A218 Spectrin alpha chain, brain spectrin; non-erythroi 1e-29
3fb2_A218 Spectrin alpha chain, brain spectrin; non-erythroi 2e-16
3fb2_A218 Spectrin alpha chain, brain spectrin; non-erythroi 2e-06
2spc_A107 Spectrin; cytoskeleton; 1.80A {Drosophila melanoga 6e-29
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 3e-26
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 3e-04
3pdy_A210 Plectin; cytoskeleton, plakin, intermediate filame 4e-26
3pdy_A210 Plectin; cytoskeleton, plakin, intermediate filame 2e-12
3r6n_A450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 4e-26
3r6n_A450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 3e-17
3lbx_A161 Spectrin alpha chain, erythrocyte; tetramer, compl 9e-26
3lbx_A161 Spectrin alpha chain, erythrocyte; tetramer, compl 3e-04
1s35_A214 Beta-I spectrin, spectrin beta chain, erythrocyte; 1e-24
1s35_A214 Beta-I spectrin, spectrin beta chain, erythrocyte; 3e-21
1s35_A214 Beta-I spectrin, spectrin beta chain, erythrocyte; 6e-08
3f31_A149 Spectrin alpha chain, brain; LONE helix followed b 5e-24
3edu_A218 Beta-I spectrin, spectrin beta chain, erythrocyte; 6e-24
3edu_A218 Beta-I spectrin, spectrin beta chain, erythrocyte; 6e-23
2iak_A224 Bullous pemphigoid antigen 1, isoform 5; triple he 2e-23
2iak_A224 Bullous pemphigoid antigen 1, isoform 5; triple he 8e-14
3lbx_B185 Beta-I spectrin, spectrin beta chain, erythrocyte; 2e-22
3lbx_B185 Beta-I spectrin, spectrin beta chain, erythrocyte; 3e-14
3lbx_B185 Beta-I spectrin, spectrin beta chain, erythrocyte; 3e-04
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 3e-17
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 2e-05
1exr_A148 Calmodulin; high resolution, disorder, metal trans 4e-17
1exr_A148 Calmodulin; high resolution, disorder, metal trans 4e-06
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 5e-17
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 6e-05
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 6e-17
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 8e-08
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 1e-16
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 2e-05
3fwb_A161 Cell division control protein 31; gene gating, com 1e-16
3fwb_A161 Cell division control protein 31; gene gating, com 1e-04
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 5e-16
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 3e-04
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 2e-15
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 6e-05
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 3e-15
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 2e-05
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 5e-15
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 6e-15
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 5e-05
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 7e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 2e-14
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 6e-05
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 2e-14
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 8e-04
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 6e-14
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 1e-05
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 7e-14
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 4e-06
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 1e-13
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 5e-05
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 2e-13
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 3e-04
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 2e-13
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 2e-13
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 8e-06
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 2e-13
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 3e-13
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 7e-05
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 7e-13
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 9e-06
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 7e-13
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 8e-13
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 3e-06
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 9e-13
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 1e-04
1avs_A90 Troponin C; muscle contraction, calcium-activated, 1e-12
2jnf_A158 Troponin C; stretch activated muscle contraction, 1e-12
2jnf_A158 Troponin C; stretch activated muscle contraction, 7e-05
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 1e-12
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 3e-07
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 2e-12
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 5e-06
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 2e-12
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 2e-04
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 2e-12
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 3e-05
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 3e-12
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 6e-06
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 4e-12
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 4e-05
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 6e-12
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 2e-11
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 2e-09
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 2e-04
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 2e-11
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 3e-11
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 3e-11
2hps_A186 Coelenterazine-binding protein with bound coelent; 2e-10
2hps_A186 Coelenterazine-binding protein with bound coelent; 6e-07
2be4_A 272 Hypothetical protein LOC449832; DR.36843, BC083168 3e-10
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 1e-05
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 4e-10
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 3e-04
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 5e-10
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 5e-10
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 7e-10
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 4e-05
1y1x_A191 Leishmania major homolog of programmed cell death 1e-09
1y1x_A191 Leishmania major homolog of programmed cell death 7e-08
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 2e-09
3akb_A166 Putative calcium binding protein; EF-hand, metal b 3e-09
3akb_A166 Putative calcium binding protein; EF-hand, metal b 6e-05
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 4e-09
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 1e-06
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 2e-05
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 4e-09
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 1e-06
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 6e-09
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 2e-08
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 2e-08
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 2e-08
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 2e-08
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 3e-08
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 1e-06
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 4e-08
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 2e-05
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 6e-08
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 7e-08
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 4e-05
1ydi_B26 Alpha-actinin 4; cell adhesion, structural protein 7e-08
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 9e-08
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 1e-07
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 1e-06
3lij_A494 Calcium/calmodulin dependent protein kinase with A 1e-07
3lij_A494 Calcium/calmodulin dependent protein kinase with A 2e-05
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 1e-07
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 1e-04
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 2e-07
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 3e-07
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 3e-07
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 4e-06
2ycu_A995 Non muscle myosin 2C, alpha-actinin; motor protein 4e-07
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 7e-07
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 1e-04
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 1e-06
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 3e-04
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 1e-06
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 2e-04
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 1e-06
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 5e-06
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 1e-06
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 1e-04
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 2e-06
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 2e-06
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 3e-06
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 3e-05
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 3e-06
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 3e-06
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 5e-06
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 5e-06
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 8e-06
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 1e-05
1c07_A95 Protein (epidermal growth factor receptor pathway 3e-05
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 4e-05
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 4e-05
3li6_A66 Calcium-binding protein; calcium signaling protein 4e-05
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 7e-05
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 1e-04
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 1e-04
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 1e-04
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 1e-04
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 2e-04
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 3e-04
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 4e-04
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 6e-04
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 7e-04
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 Back     alignment and structure
 Score =  534 bits (1376), Expect = 0.0
 Identities = 382/599 (63%), Positives = 480/599 (80%), Gaps = 5/599 (0%)

Query: 1   MPWLQSRQTDNSLSGVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAY 60
           +PWL++R  +N++  +Q+KLE++R YRR HKPP+V++K +LE NFNTLQTKLRLSNRPA+
Sbjct: 270 IPWLENRAPENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAF 329

Query: 61  MPTEGKMVSDIANAWKGLETSEKSFEEWLLSEMMRLERLEHLAQKFKHKADIHEDWTRGK 120
           MP+EGKMVSDI NAW GLE +EK +EEWLL+E+ RLERL+HLA+KF+ KA IHE WT GK
Sbjct: 330 MPSEGKMVSDINNAWGGLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHESWTDGK 389

Query: 121 EEMLQSSDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNTLEYHDSVSVN 180
           E MLQ  D+    L+E+KAL KKHEAFESDLAAHQDRVEQIAAIAQELN L+Y+DS SVN
Sbjct: 390 EAMLQQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVN 449

Query: 181 ARCQRICDQWDHLGALTQQRRHALDEAEKILEKIDILHLEFAKRAAPFNNWLDGTREDLV 240
           ARCQ+ICDQWD+LGALTQ+RR AL+  EK+LE ID L+LE+AKRAAPFNNW++G  EDL 
Sbjct: 450 ARCQKICDQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQ 509

Query: 241 DMFIVHTMEEIQGLIDAHSQFKATLGEADKEYNSIVNLVREVESTVQQYQIPGGLENPYT 300
           D FIVHT+EEIQGL  AH QFKATL +ADKE  +I+ +  EV   VQ Y +     NPYT
Sbjct: 510 DTFIVHTIEEIQGLTTAHEQFKATLPDADKERQAILGIHNEVSKIVQTYHVNMAGTNPYT 569

Query: 301 ALTANDLTKKWTDVRKLVPQRDTTLQAELRKQQNNETLRRQFAEKANQVGPWIERQMDAV 360
            +T  ++  KW  VR+LVP+RD  L  E  +QQ NE LR+QF  +AN +GPWI+ +M+ +
Sbjct: 570 TITPQEINGKWEHVRQLVPRRDQALMEEHARQQQNERLRKQFGAQANVIGPWIQTKMEEI 629

Query: 361 TSIGMGLQGSLEDQLHRLKEYEQGVYAYKPHIEELEKIHQAVQEGMIFENRYTQYTMETL 420
             I + + G+LEDQL+ L++YE+ +  YKP I++LE  HQ +QE +IF+N++T YTME +
Sbjct: 630 GRISIEMHGTLEDQLNHLRQYEKSIVNYKPKIDQLEGDHQQIQEALIFDNKHTNYTMEHI 689

Query: 421 RVGWEQLLTSINRNINEVENQILTRDSKGITQEQLNEFRASFNHFDKNRTGRLAPEEFKS 480
           RVGWEQLLT+I R INEVENQILTRD+KGI+QEQ+NEFRASFNHFD+ +TG +  E+F++
Sbjct: 690 RVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRKKTGMMDCEDFRA 749

Query: 481 CLVSLGYSIGKDRQGEIDFQRILAVVDPNSTGYVHFDAFLDFMTRESTDTDTAEQVIDSF 540
           CL+S+GY++     GE +F RI+++VDPN  G V F AF+DFM+RE+ DTDTA+QV+ SF
Sbjct: 750 CLISMGYNM-----GEAEFARIMSIVDPNRMGVVTFQAFIDFMSRETADTDTADQVMASF 804

Query: 541 RILAGDKPYILPDELRRELPPDQAEYCIQRMPPYKGPNAIPGALDYQSFSTALYGESDL 599
           +ILAGDK YI  DELRRELPPDQAEYCI RM PY G +A+PGALDY SFSTALYGESDL
Sbjct: 805 KILAGDKNYITVDELRRELPPDQAEYCIARMAPYNGRDAVPGALDYMSFSTALYGESDL 863
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 Back     alignment and structure
>1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 Length = 476 Back     alignment and structure
>1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 Length = 476 Back     alignment and structure
>1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 250 Back     alignment and structure
>1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 250 Back     alignment and structure
>1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 250 Back     alignment and structure
>1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322 Back     alignment and structure
>1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322 Back     alignment and structure
>1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Length = 322 Back     alignment and structure
>3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326 Back     alignment and structure
>3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Length = 326 Back     alignment and structure
>2odv_A Plectin 1, HD1; plakin domain, spectrin repeat, cytoskeleton, hemidesmosomes epidermolysis bullosa, structural protein; 2.05A {Homo sapiens} PDB: 2odu_A Length = 235 Back     alignment and structure
>2odv_A Plectin 1, HD1; plakin domain, spectrin repeat, cytoskeleton, hemidesmosomes epidermolysis bullosa, structural protein; 2.05A {Homo sapiens} PDB: 2odu_A Length = 235 Back     alignment and structure
>1wlx_A Alpha-actinin 4; three-helix bundle, protein binding; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>1wlx_A Alpha-actinin 4; three-helix bundle, protein binding; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216 Back     alignment and structure
>1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216 Back     alignment and structure
>1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Length = 216 Back     alignment and structure
>3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Length = 323 Back     alignment and structure
>3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Length = 323 Back     alignment and structure
>1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213 Back     alignment and structure
>1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213 Back     alignment and structure
>1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Length = 213 Back     alignment and structure
>3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Length = 218 Back     alignment and structure
>3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Length = 218 Back     alignment and structure
>3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Length = 218 Back     alignment and structure
>2spc_A Spectrin; cytoskeleton; 1.80A {Drosophila melanogaster} SCOP: a.7.1.1 Length = 107 Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Length = 283 Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Length = 283 Back     alignment and structure
>3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Length = 210 Back     alignment and structure
>3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Length = 210 Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Length = 450 Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Length = 450 Back     alignment and structure
>3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Length = 161 Back     alignment and structure
>3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Length = 161 Back     alignment and structure
>1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 214 Back     alignment and structure
>1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 214 Back     alignment and structure
>1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Length = 214 Back     alignment and structure
>3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} Length = 149 Back     alignment and structure
>3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Length = 218 Back     alignment and structure
>3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Length = 218 Back     alignment and structure
>2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Length = 224 Back     alignment and structure
>2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Length = 224 Back     alignment and structure
>3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Length = 185 Back     alignment and structure
>3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Length = 185 Back     alignment and structure
>3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Length = 185 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Length = 107 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Length = 150 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>1ydi_B Alpha-actinin 4; cell adhesion, structural protein; 1.80A {Homo sapiens} Length = 26 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95 Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Length = 76 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Length = 624 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query599
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 100.0
1hci_A476 Alpha-actinin 2; triple-helix coiled coil, contrac 100.0
1u4q_A322 Spectrin alpha chain, brain; alpha spectrin, three 100.0
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 100.0
3edv_A323 Spectrin beta chain, brain 1; spectrin repeat, coi 100.0
3kbt_A326 Beta-I spectrin, spectrin beta chain, erythrocyte; 100.0
1quu_A250 Human skeletal muscle alpha-actinin 2; triple-heli 100.0
1u4q_A322 Spectrin alpha chain, brain; alpha spectrin, three 100.0
3edv_A323 Spectrin beta chain, brain 1; spectrin repeat, coi 99.97
3kbt_A326 Beta-I spectrin, spectrin beta chain, erythrocyte; 99.97
3r6n_A450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 99.97
1hci_A476 Alpha-actinin 2; triple-helix coiled coil, contrac 99.97
1u5p_A216 Spectrin alpha chain, brain; alpha spectrin, two r 99.96
1cun_A213 Protein (alpha spectrin); two repeats of spectrin, 99.96
2odv_A235 Plectin 1, HD1; plakin domain, spectrin repeat, cy 99.96
3r6n_A450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 99.96
3edu_A218 Beta-I spectrin, spectrin beta chain, erythrocyte; 99.95
1s35_A214 Beta-I spectrin, spectrin beta chain, erythrocyte; 99.94
3fb2_A218 Spectrin alpha chain, brain spectrin; non-erythroi 99.92
1quu_A250 Human skeletal muscle alpha-actinin 2; triple-heli 99.92
2iak_A224 Bullous pemphigoid antigen 1, isoform 5; triple he 99.91
3pdy_A210 Plectin; cytoskeleton, plakin, intermediate filame 99.91
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 99.91
1u5p_A216 Spectrin alpha chain, brain; alpha spectrin, two r 99.9
1cun_A213 Protein (alpha spectrin); two repeats of spectrin, 99.9
1s35_A214 Beta-I spectrin, spectrin beta chain, erythrocyte; 99.88
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 99.88
3lbx_B185 Beta-I spectrin, spectrin beta chain, erythrocyte; 99.88
3pdy_A210 Plectin; cytoskeleton, plakin, intermediate filame 99.87
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.87
3edu_A218 Beta-I spectrin, spectrin beta chain, erythrocyte; 99.87
2ycu_A995 Non muscle myosin 2C, alpha-actinin; motor protein 99.86
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.85
3fb2_A218 Spectrin alpha chain, brain spectrin; non-erythroi 99.85
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.84
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.84
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.84
2iak_A224 Bullous pemphigoid antigen 1, isoform 5; triple he 99.83
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.83
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.82
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.81
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.8
3fwb_A161 Cell division control protein 31; gene gating, com 99.8
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.79
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.79
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.79
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.78
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 99.78
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.78
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.78
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.77
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.77
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.77
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 99.77
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 99.76
3lbx_A161 Spectrin alpha chain, erythrocyte; tetramer, compl 99.76
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.76
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.76
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.75
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 99.75
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 99.75
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.74
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 99.74
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 99.74
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.74
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.73
3lbx_B185 Beta-I spectrin, spectrin beta chain, erythrocyte; 99.73
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.73
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.73
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.73
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.73
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 99.72
3f31_A149 Spectrin alpha chain, brain; LONE helix followed b 99.72
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.72
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 99.72
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 99.71
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.71
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.71
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 99.71
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.7
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 99.7
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.7
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.7
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.69
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 99.69
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 99.69
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 99.68
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 99.68
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 99.68
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 99.67
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 99.67
1y1x_A191 Leishmania major homolog of programmed cell death 99.67
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.66
2odv_A235 Plectin 1, HD1; plakin domain, spectrin repeat, cy 99.66
3lbx_A161 Spectrin alpha chain, erythrocyte; tetramer, compl 99.66
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.66
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.66
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.65
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.65
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 99.65
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.65
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.64
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.63
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.62
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.62
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.62
1wlx_A129 Alpha-actinin 4; three-helix bundle, protein bindi 99.62
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.62
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 99.62
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.62
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.61
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.61
2ycu_A995 Non muscle myosin 2C, alpha-actinin; motor protein 99.61
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.61
3f31_A149 Spectrin alpha chain, brain; LONE helix followed b 99.61
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.6
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.6
3uul_A118 Utrophin; spectrin repeat, structural protein, cyt 99.6
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.6
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.59
2spc_A107 Spectrin; cytoskeleton; 1.80A {Drosophila melanoga 99.58
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.58
3uun_A119 Dystrophin; triple helical, cell structure and sta 99.57
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.57
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.57
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.56
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 99.56
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.55
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 99.55
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.54
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.54
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.53
2hps_A186 Coelenterazine-binding protein with bound coelent; 99.52
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 99.47
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 99.44
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 99.36
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 99.35
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.33
1wlx_A129 Alpha-actinin 4; three-helix bundle, protein bindi 99.33
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.32
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.32
2lv7_A100 Calcium-binding protein 7; metal binding protein; 99.32
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.32
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 99.32
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 99.31
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 99.29
3uun_A119 Dystrophin; triple helical, cell structure and sta 99.29
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 99.28
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 99.28
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.28
1y1x_A191 Leishmania major homolog of programmed cell death 99.27
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 99.27
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.27
1qxp_A 900 MU-like calpain; M-calpain, MU-calpain, catalytic 99.26
3uul_A118 Utrophin; spectrin repeat, structural protein, cyt 99.25
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.24
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 99.24
2spc_A107 Spectrin; cytoskeleton; 1.80A {Drosophila melanoga 99.24
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 99.22
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.22
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.22
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 99.21
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 99.21
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 99.18
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 99.18
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.17
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.16
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.16
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 99.16
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 99.14
3a4u_B143 Multiple coagulation factor deficiency protein 2; 99.13
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 99.12
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.12
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.11
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.1
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.1
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 99.1
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.1
1avs_A90 Troponin C; muscle contraction, calcium-activated, 99.09
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 99.08
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 99.06
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 99.05
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.04
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 99.02
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 99.01
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.01
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 99.01
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 99.01
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 99.0
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.0
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 99.0
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 99.0
3akb_A166 Putative calcium binding protein; EF-hand, metal b 98.99
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 98.99
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 98.99
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 98.98
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 98.98
1c07_A95 Protein (epidermal growth factor receptor pathway 98.97
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.97
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 98.96
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 98.96
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 98.96
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 98.96
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 98.96
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 98.95
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 98.95
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 98.94
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 98.94
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 98.94
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 98.94
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 98.94
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 98.93
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 98.92
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 98.92
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 98.92
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 98.92
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 98.91
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.91
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 98.91
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 98.91
3li6_A66 Calcium-binding protein; calcium signaling protein 98.9
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 98.89
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 98.89
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 98.89
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 98.89
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 98.88
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 98.88
2jnf_A158 Troponin C; stretch activated muscle contraction, 98.87
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 98.87
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.87
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.87
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 98.87
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 98.87
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 98.86
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 98.86
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 98.86
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 98.86
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 98.86
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 98.86
1qjt_A99 EH1, epidermal growth factor receptor substrate su 98.86
1exr_A148 Calmodulin; high resolution, disorder, metal trans 98.85
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 98.85
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.84
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 98.84
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 98.84
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 98.83
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 98.83
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 98.82
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 98.82
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 98.82
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 98.82
3fwb_A161 Cell division control protein 31; gene gating, com 98.82
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 98.82
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.82
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 98.81
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.8
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.8
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 98.79
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 98.78
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.76
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 98.76
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 98.75
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 98.74
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 98.74
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 98.74
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 98.73
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 98.73
2jq6_A139 EH domain-containing protein 1; metal binding prot 98.73
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 98.73
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 98.71
2lv7_A100 Calcium-binding protein 7; metal binding protein; 98.71
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 98.71
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 98.71
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 98.7
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.7
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 98.68
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 98.68
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 98.68
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.66
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 98.66
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 98.65
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 98.65
3lij_A494 Calcium/calmodulin dependent protein kinase with A 98.65
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 98.62
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 98.6
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 98.6
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 98.6
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.6
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 98.59
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 98.59
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 98.59
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 98.58
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 98.58
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 98.56
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 98.54
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 98.52
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 98.52
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 98.51
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 98.51
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 98.49
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 98.48
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 98.47
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 98.46
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 98.46
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 98.44
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 98.43
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 98.43
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 98.41
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 98.41
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.4
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 98.36
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 98.36
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 98.36
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 98.34
1qjt_A99 EH1, epidermal growth factor receptor substrate su 98.33
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 98.33
1c07_A95 Protein (epidermal growth factor receptor pathway 98.3
2hps_A186 Coelenterazine-binding protein with bound coelent; 98.3
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 98.28
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 98.27
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 98.26
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 98.26
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 98.26
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.26
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.26
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 98.24
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 98.21
3li6_A66 Calcium-binding protein; calcium signaling protein 98.21
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 98.19
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 98.19
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 98.17
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.14
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 98.14
2jq6_A139 EH domain-containing protein 1; metal binding prot 98.12
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 98.1
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 98.1
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.09
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 98.07
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.05
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.04
1avs_A90 Troponin C; muscle contraction, calcium-activated, 98.03
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 98.02
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 98.0
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 97.99
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 97.97
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 97.93
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 97.93
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 97.9
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 97.89
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 97.89
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 97.86
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 97.81
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 97.71
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 97.69
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 97.65
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 97.62
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 97.31
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 97.29
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 97.25
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 97.21
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 96.99
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 96.86
1nub_A229 Basement membrane protein BM-40; extracellular mod 96.68
1nub_A229 Basement membrane protein BM-40; extracellular mod 96.64
2kav_A129 Sodium channel protein type 2 subunit alpha; volta 94.25
1pul_A125 Hypothetical protein C32E8.3 in chromosome I; alph 93.74
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 92.32
4dck_A168 Sodium channel protein type 5 subunit alpha; IQ-mo 92.27
1wlm_A151 Protein CGI-38; structural genomics, NPPSFA, natio 86.97
2l5y_A150 Stromal interaction molecule 2; EF-hand, SAM domai 84.24
2jrf_A184 Tubulin polymerization-promoting protein family me 83.36
3kev_A199 Galieria sulfuraria DCUN1 domain-containing prote; 80.83
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
Probab=100.00  E-value=1.1e-70  Score=624.43  Aligned_cols=592  Identities=64%  Similarity=1.073  Sum_probs=559.4

Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHhhhhccCCchHHHHHHHHHHHHHhHHhHHhcCCCCCCCCCCCchhHHHHHHHHHHHh
Q psy12562          2 PWLQSRQTDNSLSGVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAYMPTEGKMVSDIANAWKGLETS   81 (599)
Q Consensus         2 ~~l~~~~~~~~~~~v~~~l~~~~~~~~~~~~~~~~~~~~le~~l~~~~~~l~~~~~~~~~~~~~~~~~~l~~~w~~L~~~   81 (599)
                      ++|.+++||+++.+|+.+|.+|+.|++.++||++++++.++..+..++++++..+.+++.|+.+..+.+|+++|..|..+
T Consensus       271 ~~l~~~~~~~~l~~v~~~l~~~~~~~~~~k~~~~~e~~~le~~~~~l~~~l~~~~~~~~~~~~~~~~~~i~~~w~~L~~~  350 (863)
T 1sjj_A          271 PWLENRAPENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNAWGGLEQA  350 (863)
T ss_dssp             GGSSCCCCCSSHHHHHHHHHHHHHHHHTTSHHHHHHHHHHHHTTTHHHHHTTTTSSCCCCCSTTSCGGGHHHHHHHHHHH
T ss_pred             HHHhccCcCCCHHHHHHHHHHHHHHHHhccchHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
Confidence            46889999999999999999999999999999999999999999999999999999899999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhHHHhcccCCCCCCCHHHHHHHHHHHHHHHHhHHhhHHHHHHH
Q psy12562         82 EKSFEEWLLSEMMRLERLEHLAQKFKHKADIHEDWTRGKEEMLQSSDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQI  161 (599)
Q Consensus        82 ~~~r~~~L~~~~~rl~~l~~l~~~f~~~~~~~~~Wl~~~e~~l~~~~~~~~~l~~v~~~l~~h~~~~~el~~~~~~v~~l  161 (599)
                      ...|+..|..+..|+++|+.++.+|.+++.++++||.+++..+.+.++|..|+.+|+.++++|++|+.+|.+++..+..|
T Consensus       351 ~~~r~~~l~~~~~R~~~Le~l~~~F~~~~~~~~~Wl~~~e~~l~~~~~g~~dl~~v~~ll~kh~~f~~el~~~~~~v~~l  430 (863)
T 1sjj_A          351 EKGYEEWLLNEIRRLERLDHLAEKFRQKASIHESWTDGKEAMLQQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQI  430 (863)
T ss_dssp             HTTTHHHHHHHHEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCTTTSSCHHHHHHHHHHHHHHHHHHTTHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999988975599999999999999999999999999999


Q ss_pred             HHHHHHHhhccCCCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhhhhhhHHHhhH
Q psy12562        162 AAIAQELNTLEYHDSVSVNARCQRICDQWDHLGALTQQRRHALDEAEKILEKIDILHLEFAKRAAPFNNWLDGTREDLVD  241 (599)
Q Consensus       162 ~~~~~~L~~~~~~~~~~i~~~~~~l~~rw~~L~~~~~~R~~~L~~~~~~~q~~~~~~~~f~~~~~~l~~Wl~~~~~~l~~  241 (599)
                      ...|++|...+|++++.|..++..|+.+|..|..++..|+.+|++++..++.++.++.+|.++++++..||.+++..|.+
T Consensus       431 ~~~~~~L~~~~~~~~~~I~~~~~~l~~~W~~L~~~~~~R~~~L~~~l~~~q~~~~l~~~f~~~a~~~~~Wl~~~e~~l~~  510 (863)
T 1sjj_A          431 AAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQD  510 (863)
T ss_dssp             HHHHHHHHHTCCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTHHHHHHHHHHHHC
T ss_pred             HHHHHHHHhCCcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhcHHHHHHHHHHhHHHHhhHHHHHHHHhHHHHHHHHHHHHHHhhcCCCCCCCCCCCCChHHHHHHHHHHHHhhHhH
Q psy12562        242 MFIVHTMEEIQGLIDAHSQFKATLGEADKEYNSIVNLVREVESTVQQYQIPGGLENPYTALTANDLTKKWTDVRKLVPQR  321 (599)
Q Consensus       242 ~~~~~~~~~v~~ll~~h~~l~~el~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~l~~~w~~L~~~~~~R  321 (599)
                      .++|.++++|+.++++|+.|+.++.+++.++..+..+++++..++..++.++..+++++..++..|..+|+.|+..+..|
T Consensus       511 ~~~g~dl~~ve~ll~kh~~~~~~l~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~L~~rw~~L~~~~~~R  590 (863)
T 1sjj_A          511 TFIVHTIEEIQGLTTAHEQFKATLPDADKERQAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWEHVRQLVPRR  590 (863)
T ss_dssp             CCCCSSSGGGHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHTTTCCCCSCCSSSSCCHHHHHHHHHHHHHHHHHH
T ss_pred             hHhhccHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHhcccccCCCCCCcCCHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999988887665555678899999999999999999999999


Q ss_pred             hHHHHHHHHhhcchHHHHHHHHHHhchhhhhHHHHHHHHhhhhccCCCCHHHHHHHHHHHHhhhhccccchHHHHHHHHH
Q psy12562        322 DTTLQAELRKQQNNETLRRQFAEKANQVGPWIERQMDAVTSIGMGLQGSLEDQLHRLKEYEQGVYAYKPHIEELEKIHQA  401 (599)
Q Consensus       322 ~~~L~~~l~~~~~~~~l~~~f~~~~~~~~~Wl~e~~~~l~~~~~~~~~~~e~~~~~~~~~~~ei~~~~~~~~~l~~~~~~  401 (599)
                      +.+|++++.+++.|++++++|..+++++..||.+++..+.+.+++..++++.++++|+.|..++......+..+..+++.
T Consensus       591 ~~~L~~~l~~~~~~~~l~~~F~~~a~~~~~Wi~e~e~~l~~~~~~~~~~le~~l~~~~~~~~el~~~~~~i~~l~~l~~~  670 (863)
T 1sjj_A          591 DQALMEEHARQQQNERLRKQFGAQANVIGPWIQTKMEEIGRISIEMHGTLEDQLNHLRQYEKSIVNYKPKIDQLEGDHQQ  670 (863)
T ss_dssp             HHHHGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCTTCTTTSSHHHHHHHHHHHHHHHTTGGGHHHHHHHHHH
T ss_pred             HHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCCCCCHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999998776666889999999999999999999999999999999


Q ss_pred             HhhcccccCCCccccHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhccCCCHHHHHHHHHHHHhhcCCCCCCcCHHHHHHH
Q psy12562        402 VQEGMIFENRYTQYTMETLRVGWEQLLTSINRNINEVENQILTRDSKGITQEQLNEFRASFNHFDKNRTGRLAPEEFKSC  481 (599)
Q Consensus       402 l~~~~~~~~~~~~~~~~~l~~~w~~l~~~~~~r~~~Le~~~~~~~~~~~~~~~~~~~~~~F~~~d~~~~g~l~~~e~~~~  481 (599)
                      |...++.+++.+..+++++...|..|...+..+....+..+......+++.+.+..+..+|..||.|++|+|+..||..+
T Consensus       671 L~~~~~~~~~~~~~s~e~l~i~~~eF~~~~~~~~~~~e~~~l~~~~~~l~~~~~~~~~~~F~~~D~d~~G~I~~~El~~~  750 (863)
T 1sjj_A          671 IQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRKKTGMMDCEDFRAC  750 (863)
T ss_dssp             HHTTTCCCCTTCSSTTHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCSSHHHHHHHHHHHTTTCSSSSSEEESTTHHHH
T ss_pred             HHHhcCCCCCcccccHHHHHHHHHHHHHHHHHHHhhHHHHHHHhhccCCCHHHHHHHHHHHHHHCCCCCCCcCHHHHHHH
Confidence            99988888999999999999999999999999999999888888888999999999999999999999999999999999


Q ss_pred             HHHcCCCCCCCCCCHHHHHHHHHHhCCCCCCccchHHHHHHHhhhcCCCCCHHHHHHHHHhhhCC-CCCcCHHHHhccCC
Q psy12562        482 LVSLGYSIGKDRQGEIDFQRILAVVDPNSTGYVHFDAFLDFMTRESTDTDTAEQVIDSFRILAGD-KPYILPDELRRELP  560 (599)
Q Consensus       482 l~~~g~~~~~~~~~~~~~~~~~~~~d~~~~g~I~~~eF~~~~~~~~~~~~~~~~~~~~F~~~D~d-~G~it~~el~~~l~  560 (599)
                      ++.+|..+     +..++..+|..+|.|++|.|+|+||+.++..........+.+..+|+.| .+ +|+||.+||+.+|+
T Consensus       751 l~~~g~~~-----~~~~~~~~~~~~D~d~dG~I~~~EF~~~~~~~~~~~~~~~~l~~aF~~~-~d~~G~Is~~El~~~l~  824 (863)
T 1sjj_A          751 LISMGYNM-----GEAEFARIMSIVDPNRMGVVTFQAFIDFMSRETADTDTADQVMASFKIL-AGDKNYITVDELRRELP  824 (863)
T ss_dssp             HHHHTCCC-----CTHHHHHHHHHHCTTSCSEEETTHHHHTHHHHSTTCSSSHHHHHHHHGG-GTSSSEEEHHHHHHHSC
T ss_pred             HHHcCCCC-----CHHHHHHHHHHhCCCCCCcCcHHHHHHHHHHHhcCCCCHHHHHHHHHHH-hCCCCcCcHHHHHHHCC
Confidence            99999999     8899999999999999999999999999987655556678999999999 67 99999999999999


Q ss_pred             cchHHHHHHhcCCCCCCCCCCCCccHHHHHHHhhcCCCC
Q psy12562        561 PDQAEYCIQRMPPYKGPNAIPGALDYQSFSTALYGESDL  599 (599)
Q Consensus       561 ~~~~~~~~~~~~~~~d~~~~dg~i~~~eF~~~~~~~~~~  599 (599)
                      +++++.++..+....+++++||.|+|++|+..|++.|+|
T Consensus       825 ~~~~~~l~~~~d~~~~~~~~dg~I~~~eF~~~~~~~~~l  863 (863)
T 1sjj_A          825 PDQAEYCIARMAPYNGRDAVPGALDYMSFSTALYGESDL  863 (863)
T ss_dssp             HHHHHHHHHHSEECCSSCCCTTEEESHHHHHHHSCCSCC
T ss_pred             HHHHHHHHHHcchhcCCCCCCCceeHHHHHHHHhcCCCC
Confidence            999999998874433334238999999999999999876
>1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 Back     alignment and structure
>1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Back     alignment and structure
>3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Back     alignment and structure
>1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Back     alignment and structure
>1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 Back     alignment and structure
>3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} Back     alignment and structure
>3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Back     alignment and structure
>1hci_A Alpha-actinin 2; triple-helix coiled coil, contractIle protein, muscle, Z- LINE, actin-binding protein; 2.8A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 a.7.1.1 Back     alignment and structure
>1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Back     alignment and structure
>1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Back     alignment and structure
>2odv_A Plectin 1, HD1; plakin domain, spectrin repeat, cytoskeleton, hemidesmosomes epidermolysis bullosa, structural protein; 2.05A {Homo sapiens} PDB: 2odu_A Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Back     alignment and structure
>3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Back     alignment and structure
>1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Back     alignment and structure
>3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Back     alignment and structure
>1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Back     alignment and structure
>2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Back     alignment and structure
>3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Back     alignment and structure
>1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 Back     alignment and structure
>1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A Back     alignment and structure
>1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Back     alignment and structure
>3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Back     alignment and structure
>3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>3lbx_B Beta-I spectrin, spectrin beta chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Back     alignment and structure
>3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} SCOP: a.7.1.0 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>2odv_A Plectin 1, HD1; plakin domain, spectrin repeat, cytoskeleton, hemidesmosomes epidermolysis bullosa, structural protein; 2.05A {Homo sapiens} PDB: 2odu_A Back     alignment and structure
>3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1wlx_A Alpha-actinin 4; three-helix bundle, protein binding; NMR {Homo sapiens} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} SCOP: a.7.1.0 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>3uul_A Utrophin; spectrin repeat, structural protein, cytoskeletal, helical bundle; 1.95A {Rattus norvegicus} PDB: 3uum_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2spc_A Spectrin; cytoskeleton; 1.80A {Drosophila melanogaster} SCOP: a.7.1.1 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>3uun_A Dystrophin; triple helical, cell structure and stability, cytoskeletal, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1wlx_A Alpha-actinin 4; three-helix bundle, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3uun_A Dystrophin; triple helical, cell structure and stability, cytoskeletal, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>3uul_A Utrophin; spectrin repeat, structural protein, cytoskeletal, helical bundle; 1.95A {Rattus norvegicus} PDB: 3uum_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>2spc_A Spectrin; cytoskeleton; 1.80A {Drosophila melanogaster} SCOP: a.7.1.1 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>2kav_A Sodium channel protein type 2 subunit alpha; voltage-gated sodium channel, alternative splicing, disease epilepsy, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kbi_A Back     alignment and structure
>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>4dck_A Sodium channel protein type 5 subunit alpha; IQ-motif, EF-hand, voltage-gated sodium channel regulation, CTD binds to FGF13 and CAM. CAM binds to Ca2+.; 2.20A {Homo sapiens} PDB: 2kbi_A Back     alignment and structure
>1wlm_A Protein CGI-38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.39.1.11 Back     alignment and structure
>2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2jrf_A Tubulin polymerization-promoting protein family member 3; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3kev_A Galieria sulfuraria DCUN1 domain-containing prote; cullin, neddylation, DCN-1, center for eukaryotic structural genomics, PSI; HET: CSO MSE; 1.30A {Galdieria sulphuraria} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 599
d1h8ba_73 a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) 1e-36
d1quua1124 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapie 5e-28
d1quua1124 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapie 9e-06
d1hcia1125 a.7.1.1 (A:272-396) alpha-actinin {Human (Homo sap 7e-28
d1hcia1125 a.7.1.1 (A:272-396) alpha-actinin {Human (Homo sap 4e-20
d1hcia4114 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sap 4e-24
d1hcia4114 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sap 1e-17
d1hcia4114 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sap 6e-06
d1quua2124 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sap 2e-18
d1quua2124 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sap 6e-16
d1quua2124 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sap 0.004
d1u5pa1110 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicke 3e-16
d2spca_107 a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. 6e-16
d1cuna2104 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken 2e-15
d1u5pa2101 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicke 3e-14
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 5e-12
d2pq3a173 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T 3e-11
d1s35a2105 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human ( 4e-11
d1owaa_156 a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sap 5e-11
d1s35a1106 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human ( 5e-10
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 5e-10
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 5e-10
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 9e-10
d1wrka182 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) 1e-09
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 2e-09
d1lkja_146 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 2e-09
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 3e-09
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 6e-09
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 3e-08
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 3e-08
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 8e-08
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 4e-04
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 2e-07
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 2e-07
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 2e-07
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 5e-07
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9e-07
d1cb1a_78 a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax 1e-06
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 1e-06
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 2e-06
d3c1va193 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa 2e-06
d1a4pa_92 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 2e-06
d1juoa_172 a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 3e-06
d1c07a_95 a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 3e-06
d1w7jb1139 a.39.1.5 (B:11-149) Myosin Essential Chain {Human 4e-06
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 5e-06
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 2e-05
d1qx2a_76 a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [Tax 6e-06
d1snla_99 a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo 3e-05
d1jbaa_189 a.39.1.5 (A:) Guanylate cyclase activating protein 4e-05
d1zfsa193 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus no 4e-05
d2scpa_174 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 6e-05
d1ksoa_93 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 7e-05
d2sasa_185 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 7e-05
d1alva_173 a.39.1.8 (A:) Calpain small (regulatory) subunit ( 8e-05
d1wlza183 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {H 1e-04
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 2e-04
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 0.001
d2hf5a133 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapien 2e-04
d1k94a_165 a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta 2e-04
d1uhka1187 a.39.1.5 (A:3-189) Calcium-regulated photoprotein 3e-04
d1s6ia_182 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 3e-04
d1nyaa_176 a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth 4e-04
d1yuta198 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sa 4e-04
d1qxpa2188 a.39.1.8 (A:515-702) Calpain large subunit, C-term 4e-04
d1fi6a_92 a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 4e-04
d1qv0a_189 a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr 5e-04
d1psra_100 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 6e-04
d1wdcc_152 a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop 7e-04
d1wdcb_142 a.39.1.5 (B:) Myosin Essential Chain {Bay scallop 8e-04
d2zkmx1170 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human 0.001
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 0.001
d1m45a_146 a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's ye 0.002
d1ggwa_140 a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharo 0.003
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 0.004
>d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure

class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: EF-hand modules in multidomain proteins
domain: alpha-Actinin
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  129 bits (325), Expect = 1e-36
 Identities = 57/72 (79%), Positives = 64/72 (88%)

Query: 528 TDTDTAEQVIDSFRILAGDKPYILPDELRRELPPDQAEYCIQRMPPYKGPNAIPGALDYQ 587
            DTDTAEQVI SFRILA DKPYIL +ELRRELPPDQA+YCI+RMP Y GP ++PGALDY 
Sbjct: 2   ADTDTAEQVIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALDYA 61

Query: 588 SFSTALYGESDL 599
           +FS+ALYGESDL
Sbjct: 62  AFSSALYGESDL 73
>d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1hcia1 a.7.1.1 (A:272-396) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1hcia1 a.7.1.1 (A:272-396) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 110 Back     information, alignment and structure
>d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} Length = 107 Back     information, alignment and structure
>d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 104 Back     information, alignment and structure
>d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 101 Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Length = 76 Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185 Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Length = 173 Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 182 Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 92 Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189 Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 152 Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 142 Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 140 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query599
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.81
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.81
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.78
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 99.78
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.77
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 99.77
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.76
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.74
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.73
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 99.73
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.73
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.72
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 99.72
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 99.71
d1quua1124 alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.69
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 99.69
d1quua2124 alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.66
d1s35a2105 Spectrin beta chain {Human (Homo sapiens) [TaxId: 99.65
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 99.65
d1quua2124 alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.64
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 99.64
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.63
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.62
d1cuna2104 Spectrin alpha chain {Chicken (Gallus gallus) [Tax 99.62
d1u5pa1110 Spectrin alpha chain {Chicken (Gallus gallus) [Tax 99.61
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 99.6
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 99.59
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 99.59
d1u5pa2101 Spectrin alpha chain {Chicken (Gallus gallus) [Tax 99.58
d1hcia4114 alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} 99.58
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 99.57
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 99.57
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 99.56
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 99.56
d1hcia4114 alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} 99.54
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 99.52
d1s35a1106 Spectrin beta chain {Human (Homo sapiens) [TaxId: 99.51
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 99.51
d2spca_107 Spectrin alpha chain {Drosophila sp. [TaxId: 7242] 99.5
d1hcia1125 alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1owaa_156 Spectrin alpha chain {Human (Homo sapiens) [TaxId: 99.47
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 99.46
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 99.44
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.42
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.42
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.42
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.42
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.42
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.41
d1owaa_156 Spectrin alpha chain {Human (Homo sapiens) [TaxId: 99.41
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.39
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 99.37
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 99.37
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.34
d1cuna2104 Spectrin alpha chain {Chicken (Gallus gallus) [Tax 99.33
d1s35a2105 Spectrin beta chain {Human (Homo sapiens) [TaxId: 99.3
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.29
d1u5pa1110 Spectrin alpha chain {Chicken (Gallus gallus) [Tax 99.28
d1quua1124 alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} 99.28
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.27
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.26
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.25
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 99.24
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 99.23
d1u5pa2101 Spectrin alpha chain {Chicken (Gallus gallus) [Tax 99.23
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.22
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 99.22
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.22
d2spca_107 Spectrin alpha chain {Drosophila sp. [TaxId: 7242] 99.21
d1s35a1106 Spectrin beta chain {Human (Homo sapiens) [TaxId: 99.2
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 99.2
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 99.19
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 99.19
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 99.18
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 99.18
d1h8ba_73 alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} 99.14
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.13
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 99.12
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.12
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.07
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.04
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 99.01
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 98.99
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.99
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 98.98
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.94
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 98.93
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 98.93
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 98.92
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 98.92
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.9
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.89
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 98.87
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 98.87
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 98.86
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 98.84
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.83
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 98.83
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.82
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 98.82
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.81
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 98.78
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.78
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.77
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 98.77
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 98.76
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.75
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.74
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 98.74
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.73
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 98.72
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 98.72
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.71
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.71
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 98.71
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.7
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.67
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 98.67
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 98.67
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 98.67
d1hcia1125 alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} 98.65
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.65
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.65
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 98.64
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 98.63
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 98.63
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 98.63
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.62
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 98.62
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 98.61
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 98.59
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 98.59
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.58
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 98.57
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 98.57
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 98.56
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.55
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.53
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 98.53
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.52
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 98.51
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 98.51
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 98.51
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.5
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.47
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 98.46
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 98.44
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 98.4
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.37
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.33
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.3
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.22
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.15
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 98.15
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.15
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.13
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.11
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 98.1
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 98.08
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 98.05
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.04
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.0
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 97.98
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 97.93
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 97.9
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 97.9
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 97.89
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 97.88
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.86
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 97.84
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 97.84
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.7
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 97.63
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 97.58
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 97.56
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 97.49
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 97.45
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 97.4
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 97.07
d1j7qa_86 Calcium vector protein {Amphioxus (Branchiostoma l 96.09
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 95.13
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 94.4
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 93.54
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 90.09
d1pula1103 Hypothetical protein c32e8.3 {Caenorhabditis elega 88.79
d1eg3a297 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 80.07
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Calmodulin
species: Ciliate (Paramecium tetraurelia) [TaxId: 5888]

Probab=99.81  E-value=4.5e-20  Score=159.73  Aligned_cols=137  Identities=28%  Similarity=0.567  Sum_probs=121.5

Q ss_pred             CCCHHHHHHHHHHHHhhcCCCCCCcCHHHHHHHHHHcCCCCCCCCCCHHHHHHHHHHhCCCCCCccchHHHHHHHhhhcC
Q psy12562        449 GITQEQLNEFRASFNHFDKNRTGRLAPEEFKSCLVSLGYSIGKDRQGEIDFQRILAVVDPNSTGYVHFDAFLDFMTREST  528 (599)
Q Consensus       449 ~~~~~~~~~~~~~F~~~d~~~~g~l~~~e~~~~l~~~g~~~~~~~~~~~~~~~~~~~~d~~~~g~I~~~eF~~~~~~~~~  528 (599)
                      .+|++++..++.+|..+|++++|.|+..+|..++...|..+     +...+..++..+|.+++|.|+|++|+.++.....
T Consensus         2 ~lt~~e~~~l~~~F~~~D~~~~G~Is~~e~~~~l~~~~~~~-----~~~~~~~~~~~~d~~~~g~i~~~ef~~~~~~~~~   76 (146)
T d1exra_           2 QLTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNP-----TEAELQDMINEVDADGNGTIDFPEFLSLMARKMK   76 (146)
T ss_dssp             CCCHHHHHHHHHHHHHHCTTCSSEECHHHHHHHHHHHTCCC-----CHHHHHHHHHHHCTTCSSSEEHHHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHcCCCCCeECHHHHHHHHHhcCCCC-----CHHHHHHHHHhcCCCCCCcccHHHHHHHHHHHhh
Confidence            47889999999999999999999999999999999999999     9999999999999999999999999999876544


Q ss_pred             CCCCHHHHHHHHHhhhCC-CCCcCHHHHhccC-------CcchHHHHHHhcCCCCCCCCCCCCccHHHHHHHhhc
Q psy12562        529 DTDTAEQVIDSFRILAGD-KPYILPDELRREL-------PPDQAEYCIQRMPPYKGPNAIPGALDYQSFSTALYG  595 (599)
Q Consensus       529 ~~~~~~~~~~~F~~~D~d-~G~it~~el~~~l-------~~~~~~~~~~~~~~~~d~~~~dg~i~~~eF~~~~~~  595 (599)
                      .....+.++.+|+.+|.+ +|+|+..||+.++       ++++++.++..+    |.|+ ||.|+|++|++.|++
T Consensus        77 ~~~~~~~~~~~F~~~D~d~~G~i~~~e~~~~l~~~~~~~~~~~~~~i~~~~----D~d~-dG~i~~~eF~~~l~s  146 (146)
T d1exra_          77 EQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDDEVDEMIREA----DIDG-DGHINYEEFVRMMVS  146 (146)
T ss_dssp             HHHHHHHHHHHHHHHSTTCSSCBCHHHHHHHHHHTTCCCCHHHHHHHHHHH----CSSS-SSSBCHHHHHHHHHC
T ss_pred             ccChHHHHHHHHHHhCCCCCCcCCHHHHHHHHHHHhhcCCHHHHHHHHHHh----CCCC-CCeEeHHHHHHHhcC
Confidence            334467899999999999 9999999999976       456677666665    8888 999999999999874
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} Back     information, alignment and structure
>d1hcia1 a.7.1.1 (A:272-396) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} Back     information, alignment and structure
>d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1hcia1 a.7.1.1 (A:272-396) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pula1 a.39.1.11 (A:18-120) Hypothetical protein c32e8.3 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1eg3a2 a.39.1.7 (A:210-306) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure