Psyllid ID: psy12567


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140--
MSRFLFASLPVEDIEYFTEGRECVNCGAISTPLWRRDGTGHYLCNARLFSTSFTGYFIMSRFLFASLPVEDIEYFTEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVKQPRRLRFDRGNFNCYERSTLFR
cccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccHHHHHHHHHcccccccccccccccccccccccccccccc
ccccccccccHHHHcccccccEEEcccccccccccccccccEcccccccHHccccccccccccccccccccccccccccEEEcccccccccEccccccccccccccHHHHccccccccccccccccccccccccccccEccc
msrflfaslpvedieyftegrecvncgaistplwrrdgtghylcnarlfstsftGYFIMSRFlfaslpvedieyftegrecvncgaistplwrrdgtghylcnacglyhkmngmnrplvkqprrlrfdrgnfncyerstlfr
msrflfaslpvEDIEYFTEGRECVNCGAISTPLWRRDGTGHYLCNARLFSTSFTGYFIMSRFLFASLPVEDIEYFTEGRECVNCGAistplwrrdgTGHYLCNACGLYHKMNGMNRPLVkqprrlrfdrgnfncyerstlfr
MSRFLFASLPVEDIEYFTEGRECVNCGAISTPLWRRDGTGHYLCNARLFSTSFTGYFIMSRFLFASLPVEDIEYFTEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVKQPRRLRFDRGNFNCYERSTLFR
***FLFASLPVEDIEYFTEGRECVNCGAISTPLWRRDGTGHYLCNARLFSTSFTGYFIMSRFLFASLPVEDIEYFTEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVKQPRRLRFDRGNFNCYE******
*************************CGAISTPLWRRDGTGHYLCNARLFSTSFT**********************EGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGM****************************
MSRFLFASLPVEDIEYFTEGRECVNCGAISTPLWRRDGTGHYLCNARLFSTSFTGYFIMSRFLFASLPVEDIEYFTEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVKQPRRLRFDRGNFNCYERSTLFR
***********E****FTEGRECVNCGAISTPLWRRDGTGHYLCNARLFSTSFTG*****RF***************GRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVKQ*********************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRFLFASLPVEDIEYFTEGRECVNCGAISTPLWRRDGTGHYLCNARLFSTSFTGYFIMSRFLFASLPVEDIEYFTEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVKQPRRLRFDRGNFNCYERSTLFR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query142 2.2.26 [Sep-21-2011]
P52168 540 GATA-binding factor A OS= no N/A 0.683 0.179 0.556 2e-26
P43694 442 Transcription factor GATA yes N/A 0.302 0.097 0.836 1e-24
Q0Q0E4 442 Transcription factor GATA yes N/A 0.302 0.097 0.836 1e-24
P46152 440 Transcription factor GATA yes N/A 0.302 0.097 0.836 1e-24
Q08369 440 Transcription factor GATA yes N/A 0.302 0.097 0.836 2e-24
P52167 508 Transcription factor BCFI N/A N/A 0.732 0.204 0.532 2e-24
Q91677 392 Transcription factor GATA N/A N/A 0.345 0.125 0.770 2e-24
P91623 486 GATA-binding factor C OS= no N/A 0.683 0.199 0.504 1e-23
P43691 380 Transcription factor GATA yes N/A 0.521 0.194 0.662 1e-23
P23773435 GATA-binding factor 3 OS= N/A N/A 0.676 0.220 0.529 1e-23
>sp|P52168|PNR_DROME GATA-binding factor A OS=Drosophila melanogaster GN=pnr PE=1 SV=1 Back     alignment and function desciption
 Score =  117 bits (294), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 59/106 (55%), Positives = 69/106 (65%), Gaps = 9/106 (8%)

Query: 17  FTEGRECVNCGAISTPLWRRDGTGHYLCNARLFSTSFTGYFIMSRFLFASLPVEDIEYFT 76
           F EGRECVNCGAISTPLWRRDGTGHYLCNA        G   M+R L    P + +   T
Sbjct: 163 FGEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNG---MNRPLIK--PSKRLVSAT 217

Query: 77  EGRE----CVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPL 118
             R     C NCG  +T LWRR+  G  +CNACGLY+K++G+NRPL
Sbjct: 218 ATRRMGLCCTNCGTRTTTLWRRNNDGEPVCNACGLYYKLHGVNRPL 263




Transcriptional regulator involved in several developmental processes during embryonic and imaginal disks development. Involved in determining dorsal cell fate. Acts as an essential transcriptional regulator of proneural achaete-scute complex (AS-C) and is required for its spatial regulation during development of the adult peripheral nervous system, and hence for the positioning of neural precursors. It is the only factor to directly activate AS-C genes.
Drosophila melanogaster (taxid: 7227)
>sp|P43694|GATA4_HUMAN Transcription factor GATA-4 OS=Homo sapiens GN=GATA4 PE=1 SV=2 Back     alignment and function description
>sp|Q0Q0E4|GATA4_CANFA Transcription factor GATA-4 OS=Canis familiaris GN=GATA4 PE=2 SV=1 Back     alignment and function description
>sp|P46152|GATA4_RAT Transcription factor GATA-4 OS=Rattus norvegicus GN=Gata4 PE=1 SV=1 Back     alignment and function description
>sp|Q08369|GATA4_MOUSE Transcription factor GATA-4 OS=Mus musculus GN=Gata4 PE=1 SV=3 Back     alignment and function description
>sp|P52167|GATAB_BOMMO Transcription factor BCFI OS=Bombyx mori GN=GATA-B PE=2 SV=1 Back     alignment and function description
>sp|Q91677|GATA4_XENLA Transcription factor GATA-4 OS=Xenopus laevis GN=gata4 PE=2 SV=1 Back     alignment and function description
>sp|P91623|GATAC_DROME GATA-binding factor C OS=Drosophila melanogaster GN=grn PE=2 SV=1 Back     alignment and function description
>sp|P43691|GATA4_CHICK Transcription factor GATA-4 (Fragment) OS=Gallus gallus GN=GATA4 PE=2 SV=1 Back     alignment and function description
>sp|P23773|GATA3_XENLA GATA-binding factor 3 OS=Xenopus laevis GN=gata3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query142
307186218 830 Transcription factor BCFI [Camponotus fl 0.387 0.066 0.915 1e-28
328786707 942 PREDICTED: hypothetical protein LOC72542 0.387 0.058 0.915 1e-28
332016551 833 Transcription factor GATA-4 [Acromyrmex 0.387 0.066 0.915 2e-28
340720273 985 PREDICTED: hypothetical protein LOC10065 0.387 0.055 0.915 2e-28
383863205 941 PREDICTED: uncharacterized protein LOC10 0.387 0.058 0.915 3e-28
307198088 785 Transcription factor GATA-4 [Harpegnatho 0.387 0.070 0.898 1e-27
347967443 1157 AGAP002238-PB [Anopheles gambiae str. PE 0.387 0.047 0.881 5e-27
345491199 461 PREDICTED: hypothetical protein LOC10012 0.387 0.119 0.909 8e-27
56849575 1034 GATAa2 transcription factor [Aedes aegyp 0.647 0.088 0.554 1e-26
157125536 1034 transcription factor GATA-4 (GATA bindin 0.647 0.088 0.554 1e-26
>gi|307186218|gb|EFN71902.1| Transcription factor BCFI [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 54/59 (91%), Positives = 55/59 (93%)

Query: 71  DIEYFTEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVKQPRRLRFDR 129
           + EYFTEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVKQPRRL   R
Sbjct: 557 EAEYFTEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVKQPRRLSASR 615




Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328786707|ref|XP_001121273.2| PREDICTED: hypothetical protein LOC725422 [Apis mellifera] Back     alignment and taxonomy information
>gi|332016551|gb|EGI57432.1| Transcription factor GATA-4 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|340720273|ref|XP_003398565.1| PREDICTED: hypothetical protein LOC100651336 [Bombus terrestris] Back     alignment and taxonomy information
>gi|383863205|ref|XP_003707072.1| PREDICTED: uncharacterized protein LOC100875205 [Megachile rotundata] Back     alignment and taxonomy information
>gi|307198088|gb|EFN79141.1| Transcription factor GATA-4 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|347967443|ref|XP_003436067.1| AGAP002238-PB [Anopheles gambiae str. PEST] gi|333466293|gb|EGK96194.1| AGAP002238-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|345491199|ref|XP_001607828.2| PREDICTED: hypothetical protein LOC100124017 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|56849575|gb|AAW31646.1| GATAa2 transcription factor [Aedes aegypti] Back     alignment and taxonomy information
>gi|157125536|ref|XP_001654375.1| transcription factor GATA-4 (GATA binding factor-4) [Aedes aegypti] gi|108873610|gb|EAT37835.1| AAEL010222-PA [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query142
FB|FBgn0003117 540 pnr "pannier" [Drosophila mela 0.746 0.196 0.529 1e-24
UNIPROTKB|Q91677 392 gata4 "Transcription factor GA 0.521 0.188 0.658 4.2e-24
UNIPROTKB|P43691 380 GATA4 "Transcription factor GA 0.725 0.271 0.504 5.3e-24
UNIPROTKB|E1C9C6 411 GATA4 "Transcription factor GA 0.718 0.248 0.509 1.4e-23
UNIPROTKB|B3KUF4 236 GATA4 "cDNA FLJ39741 fis, clon 0.387 0.233 0.836 1.8e-23
UNIPROTKB|E9PKS4 175 GATA4 "Transcription factor GA 0.387 0.314 0.836 1.8e-23
UNIPROTKB|P43695 390 gata5-a "GATA-binding factor 5 0.521 0.189 0.662 1.8e-23
UNIPROTKB|B7ZKZ4 443 GATA4 "Transcription factor GA 0.429 0.137 0.770 2.5e-23
UNIPROTKB|D2HDE5412 PANDA_008702 "Putative unchara 0.676 0.233 0.529 2.5e-23
ZFIN|ZDB-GENE-980526-476 352 gata4 "GATA-binding protein 4" 0.415 0.167 0.774 3.8e-23
FB|FBgn0003117 pnr "pannier" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 288 (106.4 bits), Expect = 1.0e-24, P = 1.0e-24
 Identities = 62/117 (52%), Positives = 75/117 (64%)

Query:     8 SLPVED-IEY-FTEGRECVNCGAISTPLWRRDGTGHYLCNARLFSTSFTGYFIMSRFLFA 65
             S P E  +++ F EGRECVNCGAISTPLWRRDGTGHYLCNA        G   M+R L  
Sbjct:   152 SSPYESAMDFQFGEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNG---MNRPLIK 208

Query:    66 SLPVEDIEYFTEGRE----CVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPL 118
               P + +   T  R     C NCG  +T LWRR+  G  +CNACGLY+K++G+NRPL
Sbjct:   209 --PSKRLVSATATRRMGLCCTNCGTRTTTLWRRNNDGEPVCNACGLYYKLHGVNRPL 263


GO:0000981 "sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=IDA
GO:0000983 "RNA polymerase II core promoter sequence-specific DNA binding transcription factor activity" evidence=IDA
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IDA
GO:0043565 "sequence-specific DNA binding" evidence=IDA
GO:0005634 "nucleus" evidence=IC;ISS;IDA
GO:0001103 "RNA polymerase II repressing transcription factor binding" evidence=IPI
GO:0046982 "protein heterodimerization activity" evidence=IPI
GO:0007391 "dorsal closure" evidence=IMP;TAS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS;TAS
GO:0007350 "blastoderm segmentation" evidence=IMP
GO:0007507 "heart development" evidence=TAS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0030154 "cell differentiation" evidence=NAS
GO:0007179 "transforming growth factor beta receptor signaling pathway" evidence=TAS
GO:0007389 "pattern specification process" evidence=NAS
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=NAS
GO:0042440 "pigment metabolic process" evidence=IMP
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=TAS
GO:0008407 "chaeta morphogenesis" evidence=TAS
GO:0007498 "mesoderm development" evidence=NAS
GO:0010002 "cardioblast differentiation" evidence=IMP
GO:0061320 "pericardial nephrocyte differentiation" evidence=IMP
GO:0007510 "cardioblast cell fate determination" evidence=IMP
GO:0007398 "ectoderm development" evidence=TAS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0048542 "lymph gland development" evidence=IMP
GO:0035050 "embryonic heart tube development" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0001085 "RNA polymerase II transcription factor binding" evidence=IPI
GO:0035051 "cardiocyte differentiation" evidence=IMP
GO:0022416 "chaeta development" evidence=IGI
GO:0060047 "heart contraction" evidence=IMP
GO:0002805 "regulation of antimicrobial peptide biosynthetic process" evidence=IMP
UNIPROTKB|Q91677 gata4 "Transcription factor GATA-4" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|P43691 GATA4 "Transcription factor GATA-4" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C9C6 GATA4 "Transcription factor GATA-4" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|B3KUF4 GATA4 "cDNA FLJ39741 fis, clone SMINT2016544, highly similar to TRANSCRIPTION FACTOR GATA-4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PKS4 GATA4 "Transcription factor GATA-4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P43695 gata5-a "GATA-binding factor 5-A" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|B7ZKZ4 GATA4 "Transcription factor GATA-4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|D2HDE5 PANDA_008702 "Putative uncharacterized protein" [Ailuropoda melanoleuca (taxid:9646)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-980526-476 gata4 "GATA-binding protein 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P43691GATA4_CHICKNo assigned EC number0.66230.52110.1947yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query142
cd0020254 cd00202, ZnF_GATA, Zinc finger DNA binding domain; 7e-16
smart0040152 smart00401, ZnF_GATA, zinc finger binding to DNA c 1e-12
pfam0032036 pfam00320, GATA, GATA zinc finger 1e-12
COG5641 498 COG5641, GAT1, GATA Zn-finger-containing transcrip 9e-08
pfam0032036 pfam00320, GATA, GATA zinc finger 9e-07
cd0020254 cd00202, ZnF_GATA, Zinc finger DNA binding domain; 1e-06
smart0040152 smart00401, ZnF_GATA, zinc finger binding to DNA c 3e-06
>gnl|CDD|238123 cd00202, ZnF_GATA, Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C Back     alignment and domain information
 Score = 66.6 bits (163), Expect = 7e-16
 Identities = 25/46 (54%), Positives = 30/46 (65%), Gaps = 1/46 (2%)

Query: 80  ECVNCGAISTPLWRRDG-TGHYLCNACGLYHKMNGMNRPLVKQPRR 124
            C NCG  +TPLWRR    G  LCNACGLY K +G+ RPL K+ + 
Sbjct: 1   ACSNCGTTTTPLWRRGPSGGSTLCNACGLYWKKHGVMRPLSKRKKD 46


Length = 54

>gnl|CDD|214648 smart00401, ZnF_GATA, zinc finger binding to DNA consensus sequence [AT]GATA[AG] Back     alignment and domain information
>gnl|CDD|109380 pfam00320, GATA, GATA zinc finger Back     alignment and domain information
>gnl|CDD|227928 COG5641, GAT1, GATA Zn-finger-containing transcription factor [Transcription] Back     alignment and domain information
>gnl|CDD|109380 pfam00320, GATA, GATA zinc finger Back     alignment and domain information
>gnl|CDD|238123 cd00202, ZnF_GATA, Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C Back     alignment and domain information
>gnl|CDD|214648 smart00401, ZnF_GATA, zinc finger binding to DNA consensus sequence [AT]GATA[AG] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 142
cd0020254 ZnF_GATA Zinc finger DNA binding domain; binds spe 99.69
smart0040152 ZnF_GATA zinc finger binding to DNA consensus sequ 99.64
PF0032036 GATA: GATA zinc finger; InterPro: IPR000679 Zinc f 99.52
KOG1601|consensus340 99.3
cd0020254 ZnF_GATA Zinc finger DNA binding domain; binds spe 98.99
smart0040152 ZnF_GATA zinc finger binding to DNA consensus sequ 98.99
PF0032036 GATA: GATA zinc finger; InterPro: IPR000679 Zinc f 98.97
COG5641 498 GAT1 GATA Zn-finger-containing transcription facto 98.95
COG5641 498 GAT1 GATA Zn-finger-containing transcription facto 98.91
KOG1601|consensus340 97.73
TIGR01384104 TFS_arch transcription factor S, archaeal. There h 91.12
KOG3554|consensus 693 88.53
PF1277350 DZR: Double zinc ribbon 86.44
PF0827143 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 85.45
COG5347 319 GTPase-activating protein that regulates ARFs (ADP 81.74
PRK1228657 rpmF 50S ribosomal protein L32; Reviewed 80.8
PF01412116 ArfGap: Putative GTPase activating protein for Arf 80.62
>cd00202 ZnF_GATA Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C Back     alignment and domain information
Probab=99.69  E-value=1.6e-17  Score=108.48  Aligned_cols=43  Identities=58%  Similarity=1.202  Sum_probs=40.7

Q ss_pred             cccccCCCCCCccccCCCC-CcccchhhhhHHhcCCCCCCCCCC
Q psy12567         80 ECVNCGAISTPLWRRDGTG-HYLCNACGLYHKMNGMNRPLVKQP  122 (142)
Q Consensus        80 ~C~nC~tt~Tp~WRr~~~G-~~lCNaCGly~k~~~~~RP~~~~k  122 (142)
                      +|+||++++||+||++++| ..|||||||||++++..||+.+++
T Consensus         1 ~C~~C~~~~Tp~WR~g~~~~~~LCNaCgl~~~k~~~~rp~~~~~   44 (54)
T cd00202           1 ACSNCGTTTTPLWRRGPSGGSTLCNACGLYWKKHGVMRPLSKRK   44 (54)
T ss_pred             CCCCCCCCCCcccccCCCCcchHHHHHHHHHHhcCCCCCcccCc
Confidence            5999999999999999965 799999999999999999999988



>smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG] Back     alignment and domain information
>PF00320 GATA: GATA zinc finger; InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1601|consensus Back     alignment and domain information
>cd00202 ZnF_GATA Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C Back     alignment and domain information
>smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG] Back     alignment and domain information
>PF00320 GATA: GATA zinc finger; InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5641 GAT1 GATA Zn-finger-containing transcription factor [Transcription] Back     alignment and domain information
>COG5641 GAT1 GATA Zn-finger-containing transcription factor [Transcription] Back     alignment and domain information
>KOG1601|consensus Back     alignment and domain information
>TIGR01384 TFS_arch transcription factor S, archaeal Back     alignment and domain information
>KOG3554|consensus Back     alignment and domain information
>PF12773 DZR: Double zinc ribbon Back     alignment and domain information
>PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed Back     alignment and domain information
>PF01412 ArfGap: Putative GTPase activating protein for Arf; InterPro: IPR001164 This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query142
4hc7_A115 Crystal Structure Of The Full Dna Binding Domain Of 6e-22
4hc7_A115 Crystal Structure Of The Full Dna Binding Domain Of 1e-21
3vd6_C119 Both Zn Fingers Of Gata1 Bound To Palindromic Dna R 3e-19
1y0j_A46 Zinc Fingers As Protein Recognition Motifs: Structu 3e-18
1gnf_A46 Solution Structure Of The N-Terminal Zinc Finger Of 5e-18
2l6y_A39 Haddock Model Of Gata1nf:lmo2lim2-Ldb1lid Length = 1e-15
3dfv_D63 Adjacent Gata Dna Binding Length = 63 8e-09
2vus_I43 Crystal Structure Of Unliganded Nmra-Area Zinc Fing 1e-07
4gat_A66 Solution Nmr Structure Of The Wild Type Dna Binding 1e-07
1gat_A60 Solution Structure Of The Specific Dna Complex Of T 2e-07
3gat_A66 Solution Nmr Structure Of The C-Terminal Domain Of 2e-07
7gat_A66 Solution Nmr Structure Of The L22v Mutant Dna Bindi 3e-07
>pdb|4HC7|A Chain A, Crystal Structure Of The Full Dna Binding Domain Of Gata3-Complex 2 Length = 115 Back     alignment and structure

Iteration: 1

Score = 99.4 bits (246), Expect = 6e-22, Method: Compositional matrix adjust. Identities = 52/101 (51%), Positives = 61/101 (60%), Gaps = 6/101 (5%) Query: 20 GRECVNCGAISTPLWRRDGTGHYLCNARLFSTSFTGYFIMSRFLFASLPVEDIEYFTE-G 78 GRECVNCGA STPLWRRDGTGHYLCNA G +R L P + G Sbjct: 5 GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNG---QNRPLIK--PKRRLSAARRAG 59 Query: 79 RECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLV 119 C NC +T LWRR+ G +CNACGLY+K++ +NRPL Sbjct: 60 TSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLT 100
>pdb|4HC7|A Chain A, Crystal Structure Of The Full Dna Binding Domain Of Gata3-Complex 2 Length = 115 Back     alignment and structure
>pdb|3VD6|C Chain C, Both Zn Fingers Of Gata1 Bound To Palindromic Dna Recognition Site, P21 Crystal Form Length = 119 Back     alignment and structure
>pdb|1Y0J|A Chain A, Zinc Fingers As Protein Recognition Motifs: Structural Basis For The Gata-1FRIEND OF GATA INTERACTION Length = 46 Back     alignment and structure
>pdb|1GNF|A Chain A, Solution Structure Of The N-Terminal Zinc Finger Of Murine Gata-1, Nmr, 25 Structures Length = 46 Back     alignment and structure
>pdb|2L6Y|A Chain A, Haddock Model Of Gata1nf:lmo2lim2-Ldb1lid Length = 39 Back     alignment and structure
>pdb|3DFV|D Chain D, Adjacent Gata Dna Binding Length = 63 Back     alignment and structure
>pdb|2VUS|I Chain I, Crystal Structure Of Unliganded Nmra-Area Zinc Finger Complex Length = 43 Back     alignment and structure
>pdb|4GAT|A Chain A, Solution Nmr Structure Of The Wild Type Dna Binding Domain Of Area Complexed To A 13bp Dna Containing A Cgata Site, Regularized Mean Structure Length = 66 Back     alignment and structure
>pdb|1GAT|A Chain A, Solution Structure Of The Specific Dna Complex Of The Zinc Containing Dna Binding Domain Of The Erythroid Transcription Factor Gata-1 By Multidimensional Nmr Length = 60 Back     alignment and structure
>pdb|3GAT|A Chain A, Solution Nmr Structure Of The C-Terminal Domain Of Chicken Gata-1 Bound To Dna, 34 Structures Length = 66 Back     alignment and structure
>pdb|7GAT|A Chain A, Solution Nmr Structure Of The L22v Mutant Dna Binding Domain Of Area Complexed To A 13 Bp Dna Containing A Tgata Site, 34 Structures Length = 66 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query142
1gnf_A46 Transcription factor GATA-1; zinc finger, transcri 3e-22
1gnf_A46 Transcription factor GATA-1; zinc finger, transcri 9e-12
2kae_A71 GATA-type transcription factor; zinc finger, GATA- 7e-17
2kae_A71 GATA-type transcription factor; zinc finger, GATA- 2e-07
2vut_I43 AREA, nitrogen regulatory protein AREA; transcript 4e-16
2vut_I43 AREA, nitrogen regulatory protein AREA; transcript 1e-07
3dfx_A63 Trans-acting T-cell-specific transcription factor 4e-15
3dfx_A63 Trans-acting T-cell-specific transcription factor 1e-07
4gat_A66 Nitrogen regulatory protein AREA; DNA binding prot 1e-14
4gat_A66 Nitrogen regulatory protein AREA; DNA binding prot 2e-07
>1gnf_A Transcription factor GATA-1; zinc finger, transcription regulation; NMR {Mus musculus} SCOP: g.39.1.1 PDB: 1y0j_A 2l6y_A 2l6z_A Length = 46 Back     alignment and structure
 Score = 82.5 bits (204), Expect = 3e-22
 Identities = 37/45 (82%), Positives = 41/45 (91%)

Query: 76  TEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVK 120
           +E RECVNCGA +TPLWRRD TGHYLCNACGLYHKMNG NRPL++
Sbjct: 2   SEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRPLIR 46


>1gnf_A Transcription factor GATA-1; zinc finger, transcription regulation; NMR {Mus musculus} SCOP: g.39.1.1 PDB: 1y0j_A 2l6y_A 2l6z_A Length = 46 Back     alignment and structure
>2kae_A GATA-type transcription factor; zinc finger, GATA-type, DNA; NMR {Caenorhabditis elegans} Length = 71 Back     alignment and structure
>2kae_A GATA-type transcription factor; zinc finger, GATA-type, DNA; NMR {Caenorhabditis elegans} Length = 71 Back     alignment and structure
>2vut_I AREA, nitrogen regulatory protein AREA; transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation; HET: NAD; 2.3A {Emericella nidulans} SCOP: g.39.1.1 PDB: 2vus_I* 2vuu_I* Length = 43 Back     alignment and structure
>2vut_I AREA, nitrogen regulatory protein AREA; transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation; HET: NAD; 2.3A {Emericella nidulans} SCOP: g.39.1.1 PDB: 2vus_I* 2vuu_I* Length = 43 Back     alignment and structure
>3dfx_A Trans-acting T-cell-specific transcription factor GATA-3; activator, DNA-binding, metal-binding, nucleus; HET: DNA; 2.70A {Mus musculus} PDB: 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* Length = 63 Back     alignment and structure
>3dfx_A Trans-acting T-cell-specific transcription factor GATA-3; activator, DNA-binding, metal-binding, nucleus; HET: DNA; 2.70A {Mus musculus} PDB: 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* Length = 63 Back     alignment and structure
>4gat_A Nitrogen regulatory protein AREA; DNA binding protein, transcription factor, zinc binding domain, complex (transcription regulation/DNA); HET: DNA; NMR {Emericella nidulans} SCOP: g.39.1.1 PDB: 5gat_A* 6gat_A* 7gat_A* Length = 66 Back     alignment and structure
>4gat_A Nitrogen regulatory protein AREA; DNA binding protein, transcription factor, zinc binding domain, complex (transcription regulation/DNA); HET: DNA; NMR {Emericella nidulans} SCOP: g.39.1.1 PDB: 5gat_A* 6gat_A* 7gat_A* Length = 66 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query142
4hc9_A115 Trans-acting T-cell-specific transcription factor; 100.0
3dfx_A63 Trans-acting T-cell-specific transcription factor 99.84
4gat_A66 Nitrogen regulatory protein AREA; DNA binding prot 99.83
1gnf_A46 Transcription factor GATA-1; zinc finger, transcri 99.82
2vut_I43 AREA, nitrogen regulatory protein AREA; transcript 99.81
4hc9_A115 Trans-acting T-cell-specific transcription factor; 99.75
2kae_A71 GATA-type transcription factor; zinc finger, GATA- 99.74
1gnf_A46 Transcription factor GATA-1; zinc finger, transcri 99.49
4gat_A66 Nitrogen regulatory protein AREA; DNA binding prot 99.36
2vut_I43 AREA, nitrogen regulatory protein AREA; transcript 99.33
3dfx_A63 Trans-acting T-cell-specific transcription factor 99.3
2kae_A71 GATA-type transcription factor; zinc finger, GATA- 99.14
3h0g_I113 DNA-directed RNA polymerases I, II, and III subuni 91.37
1twf_I122 B12.6, DNA-directed RNA polymerase II 14.2 kDa pol 87.75
3qt1_I133 DNA-directed RNA polymerases I, II, and III subun; 86.15
1dl6_A58 Transcription factor II B (TFIIB); zinc ribbon, ge 85.17
1dl6_A58 Transcription factor II B (TFIIB); zinc ribbon, ge 84.19
2iqj_A134 Stromal membrane-associated protein 1-like; zinc, 82.2
2owa_A138 Arfgap-like finger domain containing protein; zinc 81.91
1pft_A50 TFIIB, PFTFIIBN; N-terminal domain, transcription 80.74
2crr_A141 Stromal membrane-associated protein SMAP1B; arfgap 80.4
>4hc9_A Trans-acting T-cell-specific transcription factor; zinc finger, GATA transcription factor, DNA bridging, transc DNA complex; HET: DNA; 1.60A {Homo sapiens} PDB: 4hc7_A* 4hca_A* 3dfx_A* 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* 1gnf_A 1y0j_A 2l6y_A 2l6z_A Back     alignment and structure
Probab=100.00  E-value=8.1e-37  Score=225.24  Aligned_cols=110  Identities=46%  Similarity=0.876  Sum_probs=91.1

Q ss_pred             CCCcccccCCCCCCCCcccCCCCcccccccccccccccccccccccccCCCccccccCCCCccccccCCCCCCccccCCC
Q psy12567         18 TEGRECVNCGAISTPLWRRDGTGHYLCNARLFSTSFTGYFIMSRFLFASLPVEDIEYFTEGRECVNCGAISTPLWRRDGT   97 (142)
Q Consensus        18 ~~~~~C~nCgt~~TplWr~~~~g~~lCnacg~~~k~~G~~~~~R~~~~~~~~~~~~~~~~~~~C~nC~tt~Tp~WRr~~~   97 (142)
                      ..+++|+|||++.||+||++++|++||||||+|.+.+|   .+||.++.. .+..........|+||+|++||+||+|++
T Consensus         3 ~~~~~C~~Cg~~~Tp~WRr~~~g~~lCnaCgl~~Kl~G---~nRP~~KpK-KR~~~~~~~~~~C~~C~t~~tp~WRr~~~   78 (115)
T 4hc9_A            3 HMGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNG---QNRPLIKPK-RRLSAARRAGTSCANCQTTTTTLWRRNAN   78 (115)
T ss_dssp             ---CCCTTTCCSCCSSCEECTTSCEECHHHHHHHHHHS---SCCCCSSCC-CCCCCCCCTTCCCTTTCCSCCSSCEECTT
T ss_pred             CCCCCCCCCCCccCCcceECCCCCCcCcchhhhhhhcc---ccccccccc-ccccccccccccCCCcCCCCcceeEECCC
Confidence            35789999999999999999999999999999988887   466654422 22233446679999999999999999999


Q ss_pred             CCcccchhhhhHHhcCCCCCCCCCCCCcccccCC
Q psy12567         98 GHYLCNACGLYHKMNGMNRPLVKQPRRLRFDRGN  131 (142)
Q Consensus        98 G~~lCNaCGly~k~~~~~RP~~~~k~~~~~~R~~  131 (142)
                      |++|||||||||++|+++||++|++..|...+|.
T Consensus        79 g~~lCNaCgl~~~~~~~~rp~~~~~~~i~~r~r~  112 (115)
T 4hc9_A           79 GDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRK  112 (115)
T ss_dssp             SCEECHHHHHHHHHHSSCCCGGGCCSSCCCCC--
T ss_pred             CCCcchHHHHHHHHhCCCCCccccccchhhcccc
Confidence            9999999999999999999999999888776543



>3dfx_A Trans-acting T-cell-specific transcription factor GATA-3; activator, DNA-binding, metal-binding, nucleus; HET: DNA; 2.70A {Mus musculus} PDB: 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* Back     alignment and structure
>4gat_A Nitrogen regulatory protein AREA; DNA binding protein, transcription factor, zinc binding domain, complex (transcription regulation/DNA); HET: DNA; NMR {Emericella nidulans} SCOP: g.39.1.1 PDB: 5gat_A* 6gat_A* 7gat_A* Back     alignment and structure
>1gnf_A Transcription factor GATA-1; zinc finger, transcription regulation; NMR {Mus musculus} SCOP: g.39.1.1 PDB: 1y0j_A 2l6y_A 2l6z_A Back     alignment and structure
>2vut_I AREA, nitrogen regulatory protein AREA; transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation; HET: NAD; 2.3A {Emericella nidulans} SCOP: g.39.1.1 PDB: 2vus_I* 2vuu_I* Back     alignment and structure
>4hc9_A Trans-acting T-cell-specific transcription factor; zinc finger, GATA transcription factor, DNA bridging, transc DNA complex; HET: DNA; 1.60A {Homo sapiens} PDB: 4hc7_A* 4hca_A* 3dfx_A* 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* 1gnf_A 1y0j_A 2l6y_A 2l6z_A Back     alignment and structure
>2kae_A GATA-type transcription factor; zinc finger, GATA-type, DNA; NMR {Caenorhabditis elegans} Back     alignment and structure
>1gnf_A Transcription factor GATA-1; zinc finger, transcription regulation; NMR {Mus musculus} SCOP: g.39.1.1 PDB: 1y0j_A 2l6y_A 2l6z_A Back     alignment and structure
>4gat_A Nitrogen regulatory protein AREA; DNA binding protein, transcription factor, zinc binding domain, complex (transcription regulation/DNA); HET: DNA; NMR {Emericella nidulans} SCOP: g.39.1.1 PDB: 5gat_A* 6gat_A* 7gat_A* Back     alignment and structure
>2vut_I AREA, nitrogen regulatory protein AREA; transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation; HET: NAD; 2.3A {Emericella nidulans} SCOP: g.39.1.1 PDB: 2vus_I* 2vuu_I* Back     alignment and structure
>3dfx_A Trans-acting T-cell-specific transcription factor GATA-3; activator, DNA-binding, metal-binding, nucleus; HET: DNA; 2.70A {Mus musculus} PDB: 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* Back     alignment and structure
>2kae_A GATA-type transcription factor; zinc finger, GATA-type, DNA; NMR {Caenorhabditis elegans} Back     alignment and structure
>3h0g_I DNA-directed RNA polymerases I, II, and III subunit rpabc5; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>1twf_I B12.6, DNA-directed RNA polymerase II 14.2 kDa polypepti; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.3.1 g.41.3.1 PDB: 1i3q_I 1i6h_I 1k83_I* 1nik_I 1nt9_I 1pqv_I 1r5u_I 1r9s_I* 1r9t_I* 1sfo_I* 1twa_I* 1twc_I* 1i50_I* 1twg_I* 1twh_I* 1wcm_I 1y1v_I 1y1w_I 1y1y_I 1y77_I* ... Back     alignment and structure
>3qt1_I DNA-directed RNA polymerases I, II, and III subun; transferase-transcription complex, RNA polymerase II, transc elongation; 4.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A Back     alignment and structure
>1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A Back     alignment and structure
>2iqj_A Stromal membrane-associated protein 1-like; zinc, structural genomics, structural genomics consortium, SGC, protein transport; 1.90A {Homo sapiens} Back     alignment and structure
>2owa_A Arfgap-like finger domain containing protein; zinc finger protein, cysteine-rich motif, GTPase activation; 2.00A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 Back     alignment and structure
>2crr_A Stromal membrane-associated protein SMAP1B; arfgap domain, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 142
d1y0ja139 g.39.1.1 (A:200-238) Erythroid transcription facto 4e-19
d1y0ja139 g.39.1.1 (A:200-238) Erythroid transcription facto 1e-11
d3gata_66 g.39.1.1 (A:) Erythroid transcription factor GATA- 3e-17
d3gata_66 g.39.1.1 (A:) Erythroid transcription factor GATA- 1e-09
d2vuti142 g.39.1.1 (I:671-712) Erythroid transcription facto 3e-16
d2vuti142 g.39.1.1 (I:671-712) Erythroid transcription facto 2e-08
>d1y0ja1 g.39.1.1 (A:200-238) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 39 Back     information, alignment and structure

class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: Erythroid transcription factor GATA-1
domain: Erythroid transcription factor GATA-1
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 72.8 bits (179), Expect = 4e-19
 Identities = 34/39 (87%), Positives = 35/39 (89%)

Query: 77  EGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMN 115
           E RECVNCGA +TPLWRRD TGHYLCNACGLYHKMNG N
Sbjct: 1   EARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQN 39


>d1y0ja1 g.39.1.1 (A:200-238) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 39 Back     information, alignment and structure
>d3gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 66 Back     information, alignment and structure
>d3gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 66 Back     information, alignment and structure
>d2vuti1 g.39.1.1 (I:671-712) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]} Length = 42 Back     information, alignment and structure
>d2vuti1 g.39.1.1 (I:671-712) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]} Length = 42 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query142
d2vuti142 Erythroid transcription factor GATA-1 {Emericella 99.87
d3gata_66 Erythroid transcription factor GATA-1 {Chicken (Ga 99.85
d1y0ja139 Erythroid transcription factor GATA-1 {Mouse (Mus 99.81
d1y0ja139 Erythroid transcription factor GATA-1 {Mouse (Mus 99.57
d2vuti142 Erythroid transcription factor GATA-1 {Emericella 99.49
d3gata_66 Erythroid transcription factor GATA-1 {Chicken (Ga 99.43
d1pfta_50 Transcription initiation factor TFIIB, N-terminal 89.85
d1dl6a_58 Transcription initiation factor TFIIB, N-terminal 88.67
d1pfta_50 Transcription initiation factor TFIIB, N-terminal 87.98
d1neea237 Zinc-binding domain of translation initiation fact 87.4
d1neea237 Zinc-binding domain of translation initiation fact 86.56
d1dl6a_58 Transcription initiation factor TFIIB, N-terminal 85.32
d2zjrz158 Ribosomal protein L32p {Deinococcus radiodurans [T 81.83
d2j015159 Ribosomal protein L32p {Thermus thermophilus [TaxI 80.46
d1dcqa2122 Pyk2-associated protein beta ARF-GAP domain {Mouse 80.25
>d2vuti1 g.39.1.1 (I:671-712) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]} Back     information, alignment and structure
class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: Erythroid transcription factor GATA-1
domain: Erythroid transcription factor GATA-1
species: Emericella nidulans [TaxId: 162425]
Probab=99.87  E-value=1.6e-23  Score=128.24  Aligned_cols=41  Identities=54%  Similarity=1.121  Sum_probs=39.8

Q ss_pred             cccccCCCCCCccccCCCCCcccchhhhhHHhcCCCCCCCC
Q psy12567         80 ECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVK  120 (142)
Q Consensus        80 ~C~nC~tt~Tp~WRr~~~G~~lCNaCGly~k~~~~~RP~~~  120 (142)
                      .|+||++++||+||++++|++|||||||||++|+++||++|
T Consensus         2 ~C~nC~tt~Tp~WRr~~~G~~lCNACGl~~k~~g~~RP~sl   42 (42)
T d2vuti1           2 TCTNCFTQTTPLWRRNPEGQPLCNACGLFLKLHGVVRPLSL   42 (42)
T ss_dssp             CCSSSCCCCCSCCEECTTSCEECHHHHHHHHHHSSCCCCCC
T ss_pred             cCCCCCCCCCccceeCCCCCCchhhhhHHHHHcCCCCCCCC
Confidence            69999999999999999999999999999999999999986



>d3gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1y0ja1 g.39.1.1 (A:200-238) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y0ja1 g.39.1.1 (A:200-238) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vuti1 g.39.1.1 (I:671-712) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]} Back     information, alignment and structure
>d3gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1neea2 g.59.1.1 (A:99-135) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1neea2 g.59.1.1 (A:99-135) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zjrz1 g.41.8.5 (Z:2-59) Ribosomal protein L32p {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2j0151 g.41.8.5 (5:2-60) Ribosomal protein L32p {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dcqa2 g.45.1.1 (A:247-368) Pyk2-associated protein beta ARF-GAP domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure