Psyllid ID: psy12567
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 142 | ||||||
| 307186218 | 830 | Transcription factor BCFI [Camponotus fl | 0.387 | 0.066 | 0.915 | 1e-28 | |
| 328786707 | 942 | PREDICTED: hypothetical protein LOC72542 | 0.387 | 0.058 | 0.915 | 1e-28 | |
| 332016551 | 833 | Transcription factor GATA-4 [Acromyrmex | 0.387 | 0.066 | 0.915 | 2e-28 | |
| 340720273 | 985 | PREDICTED: hypothetical protein LOC10065 | 0.387 | 0.055 | 0.915 | 2e-28 | |
| 383863205 | 941 | PREDICTED: uncharacterized protein LOC10 | 0.387 | 0.058 | 0.915 | 3e-28 | |
| 307198088 | 785 | Transcription factor GATA-4 [Harpegnatho | 0.387 | 0.070 | 0.898 | 1e-27 | |
| 347967443 | 1157 | AGAP002238-PB [Anopheles gambiae str. PE | 0.387 | 0.047 | 0.881 | 5e-27 | |
| 345491199 | 461 | PREDICTED: hypothetical protein LOC10012 | 0.387 | 0.119 | 0.909 | 8e-27 | |
| 56849575 | 1034 | GATAa2 transcription factor [Aedes aegyp | 0.647 | 0.088 | 0.554 | 1e-26 | |
| 157125536 | 1034 | transcription factor GATA-4 (GATA bindin | 0.647 | 0.088 | 0.554 | 1e-26 |
| >gi|307186218|gb|EFN71902.1| Transcription factor BCFI [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
Score = 130 bits (328), Expect = 1e-28, Method: Composition-based stats.
Identities = 54/59 (91%), Positives = 55/59 (93%)
Query: 71 DIEYFTEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVKQPRRLRFDR 129
+ EYFTEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVKQPRRL R
Sbjct: 557 EAEYFTEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVKQPRRLSASR 615
|
Source: Camponotus floridanus Species: Camponotus floridanus Genus: Camponotus Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328786707|ref|XP_001121273.2| PREDICTED: hypothetical protein LOC725422 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|332016551|gb|EGI57432.1| Transcription factor GATA-4 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|340720273|ref|XP_003398565.1| PREDICTED: hypothetical protein LOC100651336 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|383863205|ref|XP_003707072.1| PREDICTED: uncharacterized protein LOC100875205 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|307198088|gb|EFN79141.1| Transcription factor GATA-4 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|347967443|ref|XP_003436067.1| AGAP002238-PB [Anopheles gambiae str. PEST] gi|333466293|gb|EGK96194.1| AGAP002238-PB [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|345491199|ref|XP_001607828.2| PREDICTED: hypothetical protein LOC100124017 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|56849575|gb|AAW31646.1| GATAa2 transcription factor [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|157125536|ref|XP_001654375.1| transcription factor GATA-4 (GATA binding factor-4) [Aedes aegypti] gi|108873610|gb|EAT37835.1| AAEL010222-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 142 | ||||||
| FB|FBgn0003117 | 540 | pnr "pannier" [Drosophila mela | 0.746 | 0.196 | 0.529 | 1e-24 | |
| UNIPROTKB|Q91677 | 392 | gata4 "Transcription factor GA | 0.521 | 0.188 | 0.658 | 4.2e-24 | |
| UNIPROTKB|P43691 | 380 | GATA4 "Transcription factor GA | 0.725 | 0.271 | 0.504 | 5.3e-24 | |
| UNIPROTKB|E1C9C6 | 411 | GATA4 "Transcription factor GA | 0.718 | 0.248 | 0.509 | 1.4e-23 | |
| UNIPROTKB|B3KUF4 | 236 | GATA4 "cDNA FLJ39741 fis, clon | 0.387 | 0.233 | 0.836 | 1.8e-23 | |
| UNIPROTKB|E9PKS4 | 175 | GATA4 "Transcription factor GA | 0.387 | 0.314 | 0.836 | 1.8e-23 | |
| UNIPROTKB|P43695 | 390 | gata5-a "GATA-binding factor 5 | 0.521 | 0.189 | 0.662 | 1.8e-23 | |
| UNIPROTKB|B7ZKZ4 | 443 | GATA4 "Transcription factor GA | 0.429 | 0.137 | 0.770 | 2.5e-23 | |
| UNIPROTKB|D2HDE5 | 412 | PANDA_008702 "Putative unchara | 0.676 | 0.233 | 0.529 | 2.5e-23 | |
| ZFIN|ZDB-GENE-980526-476 | 352 | gata4 "GATA-binding protein 4" | 0.415 | 0.167 | 0.774 | 3.8e-23 |
| FB|FBgn0003117 pnr "pannier" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 288 (106.4 bits), Expect = 1.0e-24, P = 1.0e-24
Identities = 62/117 (52%), Positives = 75/117 (64%)
Query: 8 SLPVED-IEY-FTEGRECVNCGAISTPLWRRDGTGHYLCNARLFSTSFTGYFIMSRFLFA 65
S P E +++ F EGRECVNCGAISTPLWRRDGTGHYLCNA G M+R L
Sbjct: 152 SSPYESAMDFQFGEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNG---MNRPLIK 208
Query: 66 SLPVEDIEYFTEGRE----CVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPL 118
P + + T R C NCG +T LWRR+ G +CNACGLY+K++G+NRPL
Sbjct: 209 --PSKRLVSATATRRMGLCCTNCGTRTTTLWRRNNDGEPVCNACGLYYKLHGVNRPL 263
|
|
| UNIPROTKB|Q91677 gata4 "Transcription factor GATA-4" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P43691 GATA4 "Transcription factor GATA-4" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C9C6 GATA4 "Transcription factor GATA-4" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B3KUF4 GATA4 "cDNA FLJ39741 fis, clone SMINT2016544, highly similar to TRANSCRIPTION FACTOR GATA-4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PKS4 GATA4 "Transcription factor GATA-4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P43695 gata5-a "GATA-binding factor 5-A" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B7ZKZ4 GATA4 "Transcription factor GATA-4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D2HDE5 PANDA_008702 "Putative uncharacterized protein" [Ailuropoda melanoleuca (taxid:9646)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-980526-476 gata4 "GATA-binding protein 4" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 142 | |||
| cd00202 | 54 | cd00202, ZnF_GATA, Zinc finger DNA binding domain; | 7e-16 | |
| smart00401 | 52 | smart00401, ZnF_GATA, zinc finger binding to DNA c | 1e-12 | |
| pfam00320 | 36 | pfam00320, GATA, GATA zinc finger | 1e-12 | |
| COG5641 | 498 | COG5641, GAT1, GATA Zn-finger-containing transcrip | 9e-08 | |
| pfam00320 | 36 | pfam00320, GATA, GATA zinc finger | 9e-07 | |
| cd00202 | 54 | cd00202, ZnF_GATA, Zinc finger DNA binding domain; | 1e-06 | |
| smart00401 | 52 | smart00401, ZnF_GATA, zinc finger binding to DNA c | 3e-06 |
| >gnl|CDD|238123 cd00202, ZnF_GATA, Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C | Back alignment and domain information |
|---|
Score = 66.6 bits (163), Expect = 7e-16
Identities = 25/46 (54%), Positives = 30/46 (65%), Gaps = 1/46 (2%)
Query: 80 ECVNCGAISTPLWRRDG-TGHYLCNACGLYHKMNGMNRPLVKQPRR 124
C NCG +TPLWRR G LCNACGLY K +G+ RPL K+ +
Sbjct: 1 ACSNCGTTTTPLWRRGPSGGSTLCNACGLYWKKHGVMRPLSKRKKD 46
|
Length = 54 |
| >gnl|CDD|214648 smart00401, ZnF_GATA, zinc finger binding to DNA consensus sequence [AT]GATA[AG] | Back alignment and domain information |
|---|
| >gnl|CDD|109380 pfam00320, GATA, GATA zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|227928 COG5641, GAT1, GATA Zn-finger-containing transcription factor [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|109380 pfam00320, GATA, GATA zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|238123 cd00202, ZnF_GATA, Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C | Back alignment and domain information |
|---|
| >gnl|CDD|214648 smart00401, ZnF_GATA, zinc finger binding to DNA consensus sequence [AT]GATA[AG] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 142 | |||
| cd00202 | 54 | ZnF_GATA Zinc finger DNA binding domain; binds spe | 99.69 | |
| smart00401 | 52 | ZnF_GATA zinc finger binding to DNA consensus sequ | 99.64 | |
| PF00320 | 36 | GATA: GATA zinc finger; InterPro: IPR000679 Zinc f | 99.52 | |
| KOG1601|consensus | 340 | 99.3 | ||
| cd00202 | 54 | ZnF_GATA Zinc finger DNA binding domain; binds spe | 98.99 | |
| smart00401 | 52 | ZnF_GATA zinc finger binding to DNA consensus sequ | 98.99 | |
| PF00320 | 36 | GATA: GATA zinc finger; InterPro: IPR000679 Zinc f | 98.97 | |
| COG5641 | 498 | GAT1 GATA Zn-finger-containing transcription facto | 98.95 | |
| COG5641 | 498 | GAT1 GATA Zn-finger-containing transcription facto | 98.91 | |
| KOG1601|consensus | 340 | 97.73 | ||
| TIGR01384 | 104 | TFS_arch transcription factor S, archaeal. There h | 91.12 | |
| KOG3554|consensus | 693 | 88.53 | ||
| PF12773 | 50 | DZR: Double zinc ribbon | 86.44 | |
| PF08271 | 43 | TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 | 85.45 | |
| COG5347 | 319 | GTPase-activating protein that regulates ARFs (ADP | 81.74 | |
| PRK12286 | 57 | rpmF 50S ribosomal protein L32; Reviewed | 80.8 | |
| PF01412 | 116 | ArfGap: Putative GTPase activating protein for Arf | 80.62 |
| >cd00202 ZnF_GATA Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C | Back alignment and domain information |
|---|
Probab=99.69 E-value=1.6e-17 Score=108.48 Aligned_cols=43 Identities=58% Similarity=1.202 Sum_probs=40.7
Q ss_pred cccccCCCCCCccccCCCC-CcccchhhhhHHhcCCCCCCCCCC
Q psy12567 80 ECVNCGAISTPLWRRDGTG-HYLCNACGLYHKMNGMNRPLVKQP 122 (142)
Q Consensus 80 ~C~nC~tt~Tp~WRr~~~G-~~lCNaCGly~k~~~~~RP~~~~k 122 (142)
+|+||++++||+||++++| ..|||||||||++++..||+.+++
T Consensus 1 ~C~~C~~~~Tp~WR~g~~~~~~LCNaCgl~~~k~~~~rp~~~~~ 44 (54)
T cd00202 1 ACSNCGTTTTPLWRRGPSGGSTLCNACGLYWKKHGVMRPLSKRK 44 (54)
T ss_pred CCCCCCCCCCcccccCCCCcchHHHHHHHHHHhcCCCCCcccCc
Confidence 5999999999999999965 799999999999999999999988
|
|
| >smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG] | Back alignment and domain information |
|---|
| >PF00320 GATA: GATA zinc finger; InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1601|consensus | Back alignment and domain information |
|---|
| >cd00202 ZnF_GATA Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C | Back alignment and domain information |
|---|
| >smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG] | Back alignment and domain information |
|---|
| >PF00320 GATA: GATA zinc finger; InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5641 GAT1 GATA Zn-finger-containing transcription factor [Transcription] | Back alignment and domain information |
|---|
| >COG5641 GAT1 GATA Zn-finger-containing transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG1601|consensus | Back alignment and domain information |
|---|
| >TIGR01384 TFS_arch transcription factor S, archaeal | Back alignment and domain information |
|---|
| >KOG3554|consensus | Back alignment and domain information |
|---|
| >PF12773 DZR: Double zinc ribbon | Back alignment and domain information |
|---|
| >PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK12286 rpmF 50S ribosomal protein L32; Reviewed | Back alignment and domain information |
|---|
| >PF01412 ArfGap: Putative GTPase activating protein for Arf; InterPro: IPR001164 This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 142 | ||||
| 4hc7_A | 115 | Crystal Structure Of The Full Dna Binding Domain Of | 6e-22 | ||
| 4hc7_A | 115 | Crystal Structure Of The Full Dna Binding Domain Of | 1e-21 | ||
| 3vd6_C | 119 | Both Zn Fingers Of Gata1 Bound To Palindromic Dna R | 3e-19 | ||
| 1y0j_A | 46 | Zinc Fingers As Protein Recognition Motifs: Structu | 3e-18 | ||
| 1gnf_A | 46 | Solution Structure Of The N-Terminal Zinc Finger Of | 5e-18 | ||
| 2l6y_A | 39 | Haddock Model Of Gata1nf:lmo2lim2-Ldb1lid Length = | 1e-15 | ||
| 3dfv_D | 63 | Adjacent Gata Dna Binding Length = 63 | 8e-09 | ||
| 2vus_I | 43 | Crystal Structure Of Unliganded Nmra-Area Zinc Fing | 1e-07 | ||
| 4gat_A | 66 | Solution Nmr Structure Of The Wild Type Dna Binding | 1e-07 | ||
| 1gat_A | 60 | Solution Structure Of The Specific Dna Complex Of T | 2e-07 | ||
| 3gat_A | 66 | Solution Nmr Structure Of The C-Terminal Domain Of | 2e-07 | ||
| 7gat_A | 66 | Solution Nmr Structure Of The L22v Mutant Dna Bindi | 3e-07 |
| >pdb|4HC7|A Chain A, Crystal Structure Of The Full Dna Binding Domain Of Gata3-Complex 2 Length = 115 | Back alignment and structure |
|
| >pdb|4HC7|A Chain A, Crystal Structure Of The Full Dna Binding Domain Of Gata3-Complex 2 Length = 115 | Back alignment and structure |
| >pdb|3VD6|C Chain C, Both Zn Fingers Of Gata1 Bound To Palindromic Dna Recognition Site, P21 Crystal Form Length = 119 | Back alignment and structure |
| >pdb|1Y0J|A Chain A, Zinc Fingers As Protein Recognition Motifs: Structural Basis For The Gata-1FRIEND OF GATA INTERACTION Length = 46 | Back alignment and structure |
| >pdb|1GNF|A Chain A, Solution Structure Of The N-Terminal Zinc Finger Of Murine Gata-1, Nmr, 25 Structures Length = 46 | Back alignment and structure |
| >pdb|2L6Y|A Chain A, Haddock Model Of Gata1nf:lmo2lim2-Ldb1lid Length = 39 | Back alignment and structure |
| >pdb|3DFV|D Chain D, Adjacent Gata Dna Binding Length = 63 | Back alignment and structure |
| >pdb|2VUS|I Chain I, Crystal Structure Of Unliganded Nmra-Area Zinc Finger Complex Length = 43 | Back alignment and structure |
| >pdb|4GAT|A Chain A, Solution Nmr Structure Of The Wild Type Dna Binding Domain Of Area Complexed To A 13bp Dna Containing A Cgata Site, Regularized Mean Structure Length = 66 | Back alignment and structure |
| >pdb|1GAT|A Chain A, Solution Structure Of The Specific Dna Complex Of The Zinc Containing Dna Binding Domain Of The Erythroid Transcription Factor Gata-1 By Multidimensional Nmr Length = 60 | Back alignment and structure |
| >pdb|3GAT|A Chain A, Solution Nmr Structure Of The C-Terminal Domain Of Chicken Gata-1 Bound To Dna, 34 Structures Length = 66 | Back alignment and structure |
| >pdb|7GAT|A Chain A, Solution Nmr Structure Of The L22v Mutant Dna Binding Domain Of Area Complexed To A 13 Bp Dna Containing A Tgata Site, 34 Structures Length = 66 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 142 | |||
| 1gnf_A | 46 | Transcription factor GATA-1; zinc finger, transcri | 3e-22 | |
| 1gnf_A | 46 | Transcription factor GATA-1; zinc finger, transcri | 9e-12 | |
| 2kae_A | 71 | GATA-type transcription factor; zinc finger, GATA- | 7e-17 | |
| 2kae_A | 71 | GATA-type transcription factor; zinc finger, GATA- | 2e-07 | |
| 2vut_I | 43 | AREA, nitrogen regulatory protein AREA; transcript | 4e-16 | |
| 2vut_I | 43 | AREA, nitrogen regulatory protein AREA; transcript | 1e-07 | |
| 3dfx_A | 63 | Trans-acting T-cell-specific transcription factor | 4e-15 | |
| 3dfx_A | 63 | Trans-acting T-cell-specific transcription factor | 1e-07 | |
| 4gat_A | 66 | Nitrogen regulatory protein AREA; DNA binding prot | 1e-14 | |
| 4gat_A | 66 | Nitrogen regulatory protein AREA; DNA binding prot | 2e-07 |
| >1gnf_A Transcription factor GATA-1; zinc finger, transcription regulation; NMR {Mus musculus} SCOP: g.39.1.1 PDB: 1y0j_A 2l6y_A 2l6z_A Length = 46 | Back alignment and structure |
|---|
Score = 82.5 bits (204), Expect = 3e-22
Identities = 37/45 (82%), Positives = 41/45 (91%)
Query: 76 TEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVK 120
+E RECVNCGA +TPLWRRD TGHYLCNACGLYHKMNG NRPL++
Sbjct: 2 SEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRPLIR 46
|
| >1gnf_A Transcription factor GATA-1; zinc finger, transcription regulation; NMR {Mus musculus} SCOP: g.39.1.1 PDB: 1y0j_A 2l6y_A 2l6z_A Length = 46 | Back alignment and structure |
|---|
| >2kae_A GATA-type transcription factor; zinc finger, GATA-type, DNA; NMR {Caenorhabditis elegans} Length = 71 | Back alignment and structure |
|---|
| >2kae_A GATA-type transcription factor; zinc finger, GATA-type, DNA; NMR {Caenorhabditis elegans} Length = 71 | Back alignment and structure |
|---|
| >2vut_I AREA, nitrogen regulatory protein AREA; transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation; HET: NAD; 2.3A {Emericella nidulans} SCOP: g.39.1.1 PDB: 2vus_I* 2vuu_I* Length = 43 | Back alignment and structure |
|---|
| >2vut_I AREA, nitrogen regulatory protein AREA; transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation; HET: NAD; 2.3A {Emericella nidulans} SCOP: g.39.1.1 PDB: 2vus_I* 2vuu_I* Length = 43 | Back alignment and structure |
|---|
| >3dfx_A Trans-acting T-cell-specific transcription factor GATA-3; activator, DNA-binding, metal-binding, nucleus; HET: DNA; 2.70A {Mus musculus} PDB: 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* Length = 63 | Back alignment and structure |
|---|
| >3dfx_A Trans-acting T-cell-specific transcription factor GATA-3; activator, DNA-binding, metal-binding, nucleus; HET: DNA; 2.70A {Mus musculus} PDB: 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* Length = 63 | Back alignment and structure |
|---|
| >4gat_A Nitrogen regulatory protein AREA; DNA binding protein, transcription factor, zinc binding domain, complex (transcription regulation/DNA); HET: DNA; NMR {Emericella nidulans} SCOP: g.39.1.1 PDB: 5gat_A* 6gat_A* 7gat_A* Length = 66 | Back alignment and structure |
|---|
| >4gat_A Nitrogen regulatory protein AREA; DNA binding protein, transcription factor, zinc binding domain, complex (transcription regulation/DNA); HET: DNA; NMR {Emericella nidulans} SCOP: g.39.1.1 PDB: 5gat_A* 6gat_A* 7gat_A* Length = 66 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 142 | |||
| 4hc9_A | 115 | Trans-acting T-cell-specific transcription factor; | 100.0 | |
| 3dfx_A | 63 | Trans-acting T-cell-specific transcription factor | 99.84 | |
| 4gat_A | 66 | Nitrogen regulatory protein AREA; DNA binding prot | 99.83 | |
| 1gnf_A | 46 | Transcription factor GATA-1; zinc finger, transcri | 99.82 | |
| 2vut_I | 43 | AREA, nitrogen regulatory protein AREA; transcript | 99.81 | |
| 4hc9_A | 115 | Trans-acting T-cell-specific transcription factor; | 99.75 | |
| 2kae_A | 71 | GATA-type transcription factor; zinc finger, GATA- | 99.74 | |
| 1gnf_A | 46 | Transcription factor GATA-1; zinc finger, transcri | 99.49 | |
| 4gat_A | 66 | Nitrogen regulatory protein AREA; DNA binding prot | 99.36 | |
| 2vut_I | 43 | AREA, nitrogen regulatory protein AREA; transcript | 99.33 | |
| 3dfx_A | 63 | Trans-acting T-cell-specific transcription factor | 99.3 | |
| 2kae_A | 71 | GATA-type transcription factor; zinc finger, GATA- | 99.14 | |
| 3h0g_I | 113 | DNA-directed RNA polymerases I, II, and III subuni | 91.37 | |
| 1twf_I | 122 | B12.6, DNA-directed RNA polymerase II 14.2 kDa pol | 87.75 | |
| 3qt1_I | 133 | DNA-directed RNA polymerases I, II, and III subun; | 86.15 | |
| 1dl6_A | 58 | Transcription factor II B (TFIIB); zinc ribbon, ge | 85.17 | |
| 1dl6_A | 58 | Transcription factor II B (TFIIB); zinc ribbon, ge | 84.19 | |
| 2iqj_A | 134 | Stromal membrane-associated protein 1-like; zinc, | 82.2 | |
| 2owa_A | 138 | Arfgap-like finger domain containing protein; zinc | 81.91 | |
| 1pft_A | 50 | TFIIB, PFTFIIBN; N-terminal domain, transcription | 80.74 | |
| 2crr_A | 141 | Stromal membrane-associated protein SMAP1B; arfgap | 80.4 |
| >4hc9_A Trans-acting T-cell-specific transcription factor; zinc finger, GATA transcription factor, DNA bridging, transc DNA complex; HET: DNA; 1.60A {Homo sapiens} PDB: 4hc7_A* 4hca_A* 3dfx_A* 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* 1gnf_A 1y0j_A 2l6y_A 2l6z_A | Back alignment and structure |
|---|
Probab=100.00 E-value=8.1e-37 Score=225.24 Aligned_cols=110 Identities=46% Similarity=0.876 Sum_probs=91.1
Q ss_pred CCCcccccCCCCCCCCcccCCCCcccccccccccccccccccccccccCCCccccccCCCCccccccCCCCCCccccCCC
Q psy12567 18 TEGRECVNCGAISTPLWRRDGTGHYLCNARLFSTSFTGYFIMSRFLFASLPVEDIEYFTEGRECVNCGAISTPLWRRDGT 97 (142)
Q Consensus 18 ~~~~~C~nCgt~~TplWr~~~~g~~lCnacg~~~k~~G~~~~~R~~~~~~~~~~~~~~~~~~~C~nC~tt~Tp~WRr~~~ 97 (142)
..+++|+|||++.||+||++++|++||||||+|.+.+| .+||.++.. .+..........|+||+|++||+||+|++
T Consensus 3 ~~~~~C~~Cg~~~Tp~WRr~~~g~~lCnaCgl~~Kl~G---~nRP~~KpK-KR~~~~~~~~~~C~~C~t~~tp~WRr~~~ 78 (115)
T 4hc9_A 3 HMGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNG---QNRPLIKPK-RRLSAARRAGTSCANCQTTTTTLWRRNAN 78 (115)
T ss_dssp ---CCCTTTCCSCCSSCEECTTSCEECHHHHHHHHHHS---SCCCCSSCC-CCCCCCCCTTCCCTTTCCSCCSSCEECTT
T ss_pred CCCCCCCCCCCccCCcceECCCCCCcCcchhhhhhhcc---ccccccccc-ccccccccccccCCCcCCCCcceeEECCC
Confidence 35789999999999999999999999999999988887 466654422 22233446679999999999999999999
Q ss_pred CCcccchhhhhHHhcCCCCCCCCCCCCcccccCC
Q psy12567 98 GHYLCNACGLYHKMNGMNRPLVKQPRRLRFDRGN 131 (142)
Q Consensus 98 G~~lCNaCGly~k~~~~~RP~~~~k~~~~~~R~~ 131 (142)
|++|||||||||++|+++||++|++..|...+|.
T Consensus 79 g~~lCNaCgl~~~~~~~~rp~~~~~~~i~~r~r~ 112 (115)
T 4hc9_A 79 GDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRK 112 (115)
T ss_dssp SCEECHHHHHHHHHHSSCCCGGGCCSSCCCCC--
T ss_pred CCCcchHHHHHHHHhCCCCCccccccchhhcccc
Confidence 9999999999999999999999999888776543
|
| >3dfx_A Trans-acting T-cell-specific transcription factor GATA-3; activator, DNA-binding, metal-binding, nucleus; HET: DNA; 2.70A {Mus musculus} PDB: 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* | Back alignment and structure |
|---|
| >4gat_A Nitrogen regulatory protein AREA; DNA binding protein, transcription factor, zinc binding domain, complex (transcription regulation/DNA); HET: DNA; NMR {Emericella nidulans} SCOP: g.39.1.1 PDB: 5gat_A* 6gat_A* 7gat_A* | Back alignment and structure |
|---|
| >1gnf_A Transcription factor GATA-1; zinc finger, transcription regulation; NMR {Mus musculus} SCOP: g.39.1.1 PDB: 1y0j_A 2l6y_A 2l6z_A | Back alignment and structure |
|---|
| >2vut_I AREA, nitrogen regulatory protein AREA; transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation; HET: NAD; 2.3A {Emericella nidulans} SCOP: g.39.1.1 PDB: 2vus_I* 2vuu_I* | Back alignment and structure |
|---|
| >4hc9_A Trans-acting T-cell-specific transcription factor; zinc finger, GATA transcription factor, DNA bridging, transc DNA complex; HET: DNA; 1.60A {Homo sapiens} PDB: 4hc7_A* 4hca_A* 3dfx_A* 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* 1gnf_A 1y0j_A 2l6y_A 2l6z_A | Back alignment and structure |
|---|
| >2kae_A GATA-type transcription factor; zinc finger, GATA-type, DNA; NMR {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1gnf_A Transcription factor GATA-1; zinc finger, transcription regulation; NMR {Mus musculus} SCOP: g.39.1.1 PDB: 1y0j_A 2l6y_A 2l6z_A | Back alignment and structure |
|---|
| >4gat_A Nitrogen regulatory protein AREA; DNA binding protein, transcription factor, zinc binding domain, complex (transcription regulation/DNA); HET: DNA; NMR {Emericella nidulans} SCOP: g.39.1.1 PDB: 5gat_A* 6gat_A* 7gat_A* | Back alignment and structure |
|---|
| >2vut_I AREA, nitrogen regulatory protein AREA; transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation; HET: NAD; 2.3A {Emericella nidulans} SCOP: g.39.1.1 PDB: 2vus_I* 2vuu_I* | Back alignment and structure |
|---|
| >3dfx_A Trans-acting T-cell-specific transcription factor GATA-3; activator, DNA-binding, metal-binding, nucleus; HET: DNA; 2.70A {Mus musculus} PDB: 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* | Back alignment and structure |
|---|
| >2kae_A GATA-type transcription factor; zinc finger, GATA-type, DNA; NMR {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3h0g_I DNA-directed RNA polymerases I, II, and III subunit rpabc5; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1twf_I B12.6, DNA-directed RNA polymerase II 14.2 kDa polypepti; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.3.1 g.41.3.1 PDB: 1i3q_I 1i6h_I 1k83_I* 1nik_I 1nt9_I 1pqv_I 1r5u_I 1r9s_I* 1r9t_I* 1sfo_I* 1twa_I* 1twc_I* 1i50_I* 1twg_I* 1twh_I* 1wcm_I 1y1v_I 1y1w_I 1y1y_I 1y77_I* ... | Back alignment and structure |
|---|
| >3qt1_I DNA-directed RNA polymerases I, II, and III subun; transferase-transcription complex, RNA polymerase II, transc elongation; 4.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A | Back alignment and structure |
|---|
| >1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A | Back alignment and structure |
|---|
| >2iqj_A Stromal membrane-associated protein 1-like; zinc, structural genomics, structural genomics consortium, SGC, protein transport; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2owa_A Arfgap-like finger domain containing protein; zinc finger protein, cysteine-rich motif, GTPase activation; 2.00A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >2crr_A Stromal membrane-associated protein SMAP1B; arfgap domain, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 142 | ||||
| d1y0ja1 | 39 | g.39.1.1 (A:200-238) Erythroid transcription facto | 4e-19 | |
| d1y0ja1 | 39 | g.39.1.1 (A:200-238) Erythroid transcription facto | 1e-11 | |
| d3gata_ | 66 | g.39.1.1 (A:) Erythroid transcription factor GATA- | 3e-17 | |
| d3gata_ | 66 | g.39.1.1 (A:) Erythroid transcription factor GATA- | 1e-09 | |
| d2vuti1 | 42 | g.39.1.1 (I:671-712) Erythroid transcription facto | 3e-16 | |
| d2vuti1 | 42 | g.39.1.1 (I:671-712) Erythroid transcription facto | 2e-08 |
| >d1y0ja1 g.39.1.1 (A:200-238) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 39 | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: Erythroid transcription factor GATA-1 domain: Erythroid transcription factor GATA-1 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 72.8 bits (179), Expect = 4e-19
Identities = 34/39 (87%), Positives = 35/39 (89%)
Query: 77 EGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMN 115
E RECVNCGA +TPLWRRD TGHYLCNACGLYHKMNG N
Sbjct: 1 EARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQN 39
|
| >d1y0ja1 g.39.1.1 (A:200-238) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 39 | Back information, alignment and structure |
|---|
| >d3gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 66 | Back information, alignment and structure |
|---|
| >d3gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 66 | Back information, alignment and structure |
|---|
| >d2vuti1 g.39.1.1 (I:671-712) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]} Length = 42 | Back information, alignment and structure |
|---|
| >d2vuti1 g.39.1.1 (I:671-712) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]} Length = 42 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 142 | |||
| d2vuti1 | 42 | Erythroid transcription factor GATA-1 {Emericella | 99.87 | |
| d3gata_ | 66 | Erythroid transcription factor GATA-1 {Chicken (Ga | 99.85 | |
| d1y0ja1 | 39 | Erythroid transcription factor GATA-1 {Mouse (Mus | 99.81 | |
| d1y0ja1 | 39 | Erythroid transcription factor GATA-1 {Mouse (Mus | 99.57 | |
| d2vuti1 | 42 | Erythroid transcription factor GATA-1 {Emericella | 99.49 | |
| d3gata_ | 66 | Erythroid transcription factor GATA-1 {Chicken (Ga | 99.43 | |
| d1pfta_ | 50 | Transcription initiation factor TFIIB, N-terminal | 89.85 | |
| d1dl6a_ | 58 | Transcription initiation factor TFIIB, N-terminal | 88.67 | |
| d1pfta_ | 50 | Transcription initiation factor TFIIB, N-terminal | 87.98 | |
| d1neea2 | 37 | Zinc-binding domain of translation initiation fact | 87.4 | |
| d1neea2 | 37 | Zinc-binding domain of translation initiation fact | 86.56 | |
| d1dl6a_ | 58 | Transcription initiation factor TFIIB, N-terminal | 85.32 | |
| d2zjrz1 | 58 | Ribosomal protein L32p {Deinococcus radiodurans [T | 81.83 | |
| d2j0151 | 59 | Ribosomal protein L32p {Thermus thermophilus [TaxI | 80.46 | |
| d1dcqa2 | 122 | Pyk2-associated protein beta ARF-GAP domain {Mouse | 80.25 |
| >d2vuti1 g.39.1.1 (I:671-712) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: Erythroid transcription factor GATA-1 domain: Erythroid transcription factor GATA-1 species: Emericella nidulans [TaxId: 162425]
Probab=99.87 E-value=1.6e-23 Score=128.24 Aligned_cols=41 Identities=54% Similarity=1.121 Sum_probs=39.8
Q ss_pred cccccCCCCCCccccCCCCCcccchhhhhHHhcCCCCCCCC
Q psy12567 80 ECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVK 120 (142)
Q Consensus 80 ~C~nC~tt~Tp~WRr~~~G~~lCNaCGly~k~~~~~RP~~~ 120 (142)
.|+||++++||+||++++|++|||||||||++|+++||++|
T Consensus 2 ~C~nC~tt~Tp~WRr~~~G~~lCNACGl~~k~~g~~RP~sl 42 (42)
T d2vuti1 2 TCTNCFTQTTPLWRRNPEGQPLCNACGLFLKLHGVVRPLSL 42 (42)
T ss_dssp CCSSSCCCCCSCCEECTTSCEECHHHHHHHHHHSSCCCCCC
T ss_pred cCCCCCCCCCccceeCCCCCCchhhhhHHHHHcCCCCCCCC
Confidence 69999999999999999999999999999999999999986
|
| >d3gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1y0ja1 g.39.1.1 (A:200-238) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1y0ja1 g.39.1.1 (A:200-238) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2vuti1 g.39.1.1 (I:671-712) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d3gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1neea2 g.59.1.1 (A:99-135) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1neea2 g.59.1.1 (A:99-135) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zjrz1 g.41.8.5 (Z:2-59) Ribosomal protein L32p {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2j0151 g.41.8.5 (5:2-60) Ribosomal protein L32p {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1dcqa2 g.45.1.1 (A:247-368) Pyk2-associated protein beta ARF-GAP domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|