Psyllid ID: psy12583
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 96 | ||||||
| 307191076 | 140 | 26S proteasome non-ATPase regulatory sub | 0.989 | 0.678 | 0.5 | 2e-16 | |
| 242010661 | 203 | 26S proteasome non-ATPase regulatory sub | 0.781 | 0.369 | 0.486 | 2e-11 | |
| 170040003 | 217 | 26S proteasome non-ATPase regulatory sub | 0.895 | 0.396 | 0.395 | 1e-09 | |
| 157137956 | 228 | 26S proteasome non-atpase regulatory sub | 0.864 | 0.364 | 0.386 | 4e-09 | |
| 321449678 | 204 | hypothetical protein DAPPUDRAFT_302228 [ | 0.875 | 0.411 | 0.382 | 6e-09 | |
| 91085583 | 201 | PREDICTED: similar to 26S proteasome non | 0.645 | 0.308 | 0.478 | 2e-08 | |
| 345489493 | 195 | PREDICTED: 26S proteasome non-ATPase reg | 0.791 | 0.389 | 0.415 | 3e-08 | |
| 345489489 | 208 | PREDICTED: 26S proteasome non-ATPase reg | 0.781 | 0.360 | 0.421 | 3e-08 | |
| 57525182 | 207 | 26S proteasome non-ATPase regulatory sub | 0.677 | 0.314 | 0.469 | 6e-08 | |
| 326929670 | 176 | PREDICTED: 26S proteasome non-ATPase reg | 0.708 | 0.386 | 0.449 | 6e-08 |
| >gi|307191076|gb|EFN74816.1| 26S proteasome non-ATPase regulatory subunit 9 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
Score = 89.7 bits (221), Expect = 2e-16, Method: Compositional matrix adjust.
Identities = 48/96 (50%), Positives = 62/96 (64%), Gaps = 1/96 (1%)
Query: 1 MNEPLVDSEGYPRQDVDVYQGLVKDDIILEFGPINSSNFKSLQDIASTVRAGVNTDIPIT 60
M+E LVDSEGYPRQD+DVYQG+ +D+ILEFG I+ NFKSL DI V I +
Sbjct: 46 MDESLVDSEGYPRQDIDVYQGIQVEDLILEFGSIHYRNFKSLTDIGKLVENSRYKVINLK 105
Query: 61 VLRNEGTRQRLVLRPQPFEGQGLVGCYFLNVENVER 96
+ R L L P+P+ G+GL+GC + +E VER
Sbjct: 106 IKRGSNVI-VLSLTPRPWVGKGLLGCNVIPLEIVER 140
|
Source: Camponotus floridanus Species: Camponotus floridanus Genus: Camponotus Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|242010661|ref|XP_002426079.1| 26S proteasome non-ATPase regulatory subunit, putative [Pediculus humanus corporis] gi|212510107|gb|EEB13341.1| 26S proteasome non-ATPase regulatory subunit, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|170040003|ref|XP_001847804.1| 26S proteasome non-ATPase regulatory subunit 9 [Culex quinquefasciatus] gi|167863584|gb|EDS26967.1| 26S proteasome non-ATPase regulatory subunit 9 [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|157137956|ref|XP_001664093.1| 26S proteasome non-atpase regulatory subunit [Aedes aegypti] gi|108869609|gb|EAT33834.1| AAEL013890-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|321449678|gb|EFX62012.1| hypothetical protein DAPPUDRAFT_302228 [Daphnia pulex] gi|321474924|gb|EFX85888.1| hypothetical protein DAPPUDRAFT_309024 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|91085583|ref|XP_968374.1| PREDICTED: similar to 26S proteasome non-ATPase regulatory subunit 9 [Tribolium castaneum] gi|270010071|gb|EFA06519.1| hypothetical protein TcasGA2_TC009422 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|345489493|ref|XP_001602875.2| PREDICTED: 26S proteasome non-ATPase regulatory subunit 9-like isoform 1 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|345489489|ref|XP_003426148.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 9-like isoform 2 [Nasonia vitripennis] gi|345489491|ref|XP_003426149.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 9-like isoform 3 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|57525182|ref|NP_001006189.1| 26S proteasome non-ATPase regulatory subunit 9 [Gallus gallus] gi|53133386|emb|CAG32022.1| hypothetical protein RCJMB04_16d3 [Gallus gallus] | Back alignment and taxonomy information |
|---|
| >gi|326929670|ref|XP_003210980.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 9-like, partial [Meleagris gallopavo] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 96 | ||||||
| UNIPROTKB|Q3SZ19 | 221 | PSMD9 "26S proteasome non-ATPa | 0.739 | 0.321 | 0.416 | 2.7e-18 | |
| UNIPROTKB|O00233 | 223 | PSMD9 "26S proteasome non-ATPa | 0.739 | 0.318 | 0.388 | 2.3e-17 | |
| MGI|MGI:1914401 | 222 | Psmd9 "proteasome (prosome, ma | 0.739 | 0.319 | 0.361 | 5.1e-17 | |
| RGD|621110 | 222 | Psmd9 "proteasome (prosome, ma | 0.75 | 0.324 | 0.368 | 6.7e-17 | |
| TAIR|locus:2174453 | 227 | AT5G57950 "AT5G57950" [Arabido | 0.687 | 0.290 | 0.294 | 6.1e-09 | |
| SGD|S000001269 | 220 | NAS2 "Proteasome-interacting p | 0.635 | 0.277 | 0.317 | 1.1e-08 | |
| UNIPROTKB|Q10920 | 197 | C44B7.1 "Probable 26S proteaso | 0.864 | 0.421 | 0.337 | 4.2e-08 | |
| CGD|CAL0000640 | 231 | orf19.2301 [Candida albicans ( | 0.729 | 0.303 | 0.342 | 7.9e-08 | |
| UNIPROTKB|Q59WK1 | 231 | CaO19.1014 "Putative uncharact | 0.729 | 0.303 | 0.342 | 7.9e-08 | |
| FB|FBgn0038166 | 220 | CG9588 [Drosophila melanogaste | 0.677 | 0.295 | 0.417 | 1.5e-06 |
| UNIPROTKB|Q3SZ19 PSMD9 "26S proteasome non-ATPase regulatory subunit 9" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Score = 141 (54.7 bits), Expect = 2.7e-18, Sum P(2) = 2.7e-18
Identities = 30/72 (41%), Positives = 46/72 (63%)
Query: 21 GLVKDDIILEFGPINSSNFKSLQDIASTVRAGVNTDIPITVLRNEGTRQRLVLRPQPFEG 80
GL DD ILEFG +N+ NF+SLQ+I S V+ + +TV+R G + +L L P + G
Sbjct: 150 GLQVDDEILEFGSVNTQNFQSLQNIGSVVQHSEGKPLNVTVMRR-GEKHQLRLVPTRWAG 208
Query: 81 QGLVGCYFLNVE 92
+GL+GC + ++
Sbjct: 209 KGLLGCNIIPLQ 220
|
|
| UNIPROTKB|O00233 PSMD9 "26S proteasome non-ATPase regulatory subunit 9" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1914401 Psmd9 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 9" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|621110 Psmd9 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 9" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2174453 AT5G57950 "AT5G57950" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| SGD|S000001269 NAS2 "Proteasome-interacting protein" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q10920 C44B7.1 "Probable 26S proteasome non-ATPase regulatory subunit 9" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0000640 orf19.2301 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q59WK1 CaO19.1014 "Putative uncharacterized protein" [Candida albicans SC5314 (taxid:237561)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0038166 CG9588 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 96 | |||
| KOG3129|consensus | 231 | 99.75 | ||
| PF13180 | 82 | PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ | 99.48 | |
| cd00991 | 79 | PDZ_archaeal_metalloprotease PDZ domain of archaea | 99.36 | |
| cd00989 | 79 | PDZ_metalloprotease PDZ domain of bacterial and pl | 99.36 | |
| cd00988 | 85 | PDZ_CTP_protease PDZ domain of C-terminal processi | 99.3 | |
| TIGR02860 | 402 | spore_IV_B stage IV sporulation protein B. SpoIVB, | 99.29 | |
| TIGR00054 | 420 | RIP metalloprotease RseP. A model that detects fra | 99.29 | |
| cd00986 | 79 | PDZ_LON_protease PDZ domain of ATP-dependent LON s | 99.29 | |
| PF04495 | 138 | GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: | 99.28 | |
| PRK10779 | 449 | zinc metallopeptidase RseP; Provisional | 99.24 | |
| cd00987 | 90 | PDZ_serine_protease PDZ domain of tryspin-like ser | 99.14 | |
| cd00990 | 80 | PDZ_glycyl_aminopeptidase PDZ domain associated wi | 99.14 | |
| TIGR02037 | 428 | degP_htrA_DO periplasmic serine protease, Do/DeqQ | 99.05 | |
| PRK10139 | 455 | serine endoprotease; Provisional | 99.01 | |
| TIGR01713 | 259 | typeII_sec_gspC general secretion pathway protein | 98.99 | |
| cd00136 | 70 | PDZ PDZ domain, also called DHR (Dlg homologous re | 98.98 | |
| TIGR02038 | 351 | protease_degS periplasmic serine pepetdase DegS. T | 98.98 | |
| PRK10898 | 353 | serine endoprotease; Provisional | 98.97 | |
| TIGR03279 | 433 | cyano_FeS_chp putative FeS-containing Cyanobacteri | 98.93 | |
| PLN00049 | 389 | carboxyl-terminal processing protease; Provisional | 98.93 | |
| PRK10779 | 449 | zinc metallopeptidase RseP; Provisional | 98.93 | |
| PRK10139 | 455 | serine endoprotease; Provisional | 98.9 | |
| TIGR00225 | 334 | prc C-terminal peptidase (prc). A C-terminal pepti | 98.88 | |
| PF00595 | 81 | PDZ: PDZ domain (Also known as DHR or GLGF) Coordi | 98.83 | |
| PRK10942 | 473 | serine endoprotease; Provisional | 98.82 | |
| TIGR02037 | 428 | degP_htrA_DO periplasmic serine protease, Do/DeqQ | 98.8 | |
| PRK10942 | 473 | serine endoprotease; Provisional | 98.75 | |
| cd00992 | 82 | PDZ_signaling PDZ domain found in a variety of Eum | 98.62 | |
| COG0793 | 406 | Prc Periplasmic protease [Cell envelope biogenesis | 98.6 | |
| smart00228 | 85 | PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als | 98.6 | |
| TIGR00054 | 420 | RIP metalloprotease RseP. A model that detects fra | 98.53 | |
| PRK11186 | 667 | carboxy-terminal protease; Provisional | 98.45 | |
| PRK09681 | 276 | putative type II secretion protein GspC; Provision | 98.39 | |
| COG0265 | 347 | DegQ Trypsin-like serine proteases, typically peri | 98.22 | |
| COG3480 | 342 | SdrC Predicted secreted protein containing a PDZ d | 98.18 | |
| PF14685 | 88 | Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 | 98.18 | |
| KOG1421|consensus | 955 | 97.85 | ||
| KOG3834|consensus | 462 | 97.74 | ||
| COG0750 | 375 | Predicted membrane-associated Zn-dependent proteas | 97.49 | |
| KOG3553|consensus | 124 | 97.45 | ||
| KOG3209|consensus | 984 | 97.36 | ||
| KOG3834|consensus | 462 | 97.33 | ||
| COG3975 | 558 | Predicted protease with the C-terminal PDZ domain | 97.3 | |
| COG3031 | 275 | PulC Type II secretory pathway, component PulC [In | 97.29 | |
| KOG3580|consensus | 1027 | 97.02 | ||
| KOG1320|consensus | 473 | 96.9 | ||
| KOG3580|consensus | 1027 | 96.84 | ||
| KOG3651|consensus | 429 | 95.75 | ||
| KOG3605|consensus | 829 | 95.6 | ||
| PF12812 | 78 | PDZ_1: PDZ-like domain | 95.24 | |
| KOG3209|consensus | 984 | 95.22 | ||
| KOG3532|consensus | 1051 | 95.11 | ||
| KOG3550|consensus | 207 | 94.35 | ||
| KOG1421|consensus | 955 | 94.32 | ||
| KOG3542|consensus | 1283 | 93.52 | ||
| KOG3552|consensus | 1298 | 93.45 | ||
| KOG0606|consensus | 1205 | 93.01 | ||
| KOG3551|consensus | 506 | 92.49 | ||
| KOG0609|consensus | 542 | 90.86 | ||
| KOG3606|consensus | 358 | 90.18 | ||
| KOG3571|consensus | 626 | 89.74 | ||
| KOG1892|consensus | 1629 | 89.43 | ||
| KOG2921|consensus | 484 | 88.89 | ||
| KOG3549|consensus | 505 | 83.95 |
| >KOG3129|consensus | Back alignment and domain information |
|---|
Probab=99.75 E-value=4.3e-18 Score=120.47 Aligned_cols=79 Identities=35% Similarity=0.647 Sum_probs=69.3
Q ss_pred CCCCccccccccCCCCCCEEEEECCeecCCcccHHHHHHHHHhCCCceEEEEEEeCCceEEEEEEeecCCCCeeeEEEE-
Q psy12583 9 EGYPRQDVDVYQGLVKDDIILEFGPINSSNFKSLQDIASTVRAGVNTDIPITVLRNEGTRQRLVLRPQPFEGQGLVGCY- 87 (96)
Q Consensus 9 ~~~pa~~~~~~aGLk~GD~Il~vng~~~~~~~~~~di~~~i~~~~g~~i~l~V~R~g~~~~~l~v~p~~~~~~~~lGi~- 87 (96)
++|||+ +|||+.||.|++|+++...+...+..+....+.+.++++.++|.|.+ +.+.+.++|..|.|+|+|||.
T Consensus 148 ~~SPA~----~aGl~~gD~il~fGnV~sgn~~~lq~i~~~v~~~e~~~v~v~v~R~g-~~v~L~ltP~~W~GrGLLGC~~ 222 (231)
T KOG3129|consen 148 PGSPAD----EAGLCVGDEILKFGNVHSGNFLPLQNIAAVVQSNEDQIVSVTVIREG-QKVVLSLTPKKWQGRGLLGCNY 222 (231)
T ss_pred CCChhh----hhCcccCceEEEecccccccchhHHHHHHHHHhccCcceeEEEecCC-CEEEEEeCcccccCCcceeeee
Confidence 444555 55999999999999988777777889999999999999999999999 999999999999999999999
Q ss_pred Eecce
Q psy12583 88 FLNVE 92 (96)
Q Consensus 88 ~~~~~ 92 (96)
+.|+.
T Consensus 223 i~pi~ 227 (231)
T KOG3129|consen 223 IQPIL 227 (231)
T ss_pred ecccc
Confidence 55543
|
|
| >PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C | Back alignment and domain information |
|---|
| >cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms | Back alignment and domain information |
|---|
| >cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms | Back alignment and domain information |
|---|
| >cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts | Back alignment and domain information |
|---|
| >TIGR02860 spore_IV_B stage IV sporulation protein B | Back alignment and domain information |
|---|
| >TIGR00054 RIP metalloprotease RseP | Back alignment and domain information |
|---|
| >cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases | Back alignment and domain information |
|---|
| >PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous | Back alignment and domain information |
|---|
| >PRK10779 zinc metallopeptidase RseP; Provisional | Back alignment and domain information |
|---|
| >cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis | Back alignment and domain information |
|---|
| >cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases | Back alignment and domain information |
|---|
| >TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >PRK10139 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >TIGR01713 typeII_sec_gspC general secretion pathway protein C | Back alignment and domain information |
|---|
| >cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) | Back alignment and domain information |
|---|
| >TIGR02038 protease_degS periplasmic serine pepetdase DegS | Back alignment and domain information |
|---|
| >PRK10898 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase | Back alignment and domain information |
|---|
| >PLN00049 carboxyl-terminal processing protease; Provisional | Back alignment and domain information |
|---|
| >PRK10779 zinc metallopeptidase RseP; Provisional | Back alignment and domain information |
|---|
| >PRK10139 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >TIGR00225 prc C-terminal peptidase (prc) | Back alignment and domain information |
|---|
| >PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] | Back alignment and domain information |
|---|
| >PRK10942 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >PRK10942 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements | Back alignment and domain information |
|---|
| >COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 | Back alignment and domain information |
|---|
| >TIGR00054 RIP metalloprotease RseP | Back alignment and domain information |
|---|
| >PRK11186 carboxy-terminal protease; Provisional | Back alignment and domain information |
|---|
| >PRK09681 putative type II secretion protein GspC; Provisional | Back alignment and domain information |
|---|
| >COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A | Back alignment and domain information |
|---|
| >KOG1421|consensus | Back alignment and domain information |
|---|
| >KOG3834|consensus | Back alignment and domain information |
|---|
| >COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG3553|consensus | Back alignment and domain information |
|---|
| >KOG3209|consensus | Back alignment and domain information |
|---|
| >KOG3834|consensus | Back alignment and domain information |
|---|
| >COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] | Back alignment and domain information |
|---|
| >COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG3580|consensus | Back alignment and domain information |
|---|
| >KOG1320|consensus | Back alignment and domain information |
|---|
| >KOG3580|consensus | Back alignment and domain information |
|---|
| >KOG3651|consensus | Back alignment and domain information |
|---|
| >KOG3605|consensus | Back alignment and domain information |
|---|
| >PF12812 PDZ_1: PDZ-like domain | Back alignment and domain information |
|---|
| >KOG3209|consensus | Back alignment and domain information |
|---|
| >KOG3532|consensus | Back alignment and domain information |
|---|
| >KOG3550|consensus | Back alignment and domain information |
|---|
| >KOG1421|consensus | Back alignment and domain information |
|---|
| >KOG3542|consensus | Back alignment and domain information |
|---|
| >KOG3552|consensus | Back alignment and domain information |
|---|
| >KOG0606|consensus | Back alignment and domain information |
|---|
| >KOG3551|consensus | Back alignment and domain information |
|---|
| >KOG0609|consensus | Back alignment and domain information |
|---|
| >KOG3606|consensus | Back alignment and domain information |
|---|
| >KOG3571|consensus | Back alignment and domain information |
|---|
| >KOG1892|consensus | Back alignment and domain information |
|---|
| >KOG2921|consensus | Back alignment and domain information |
|---|
| >KOG3549|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 96 | |||
| 3i18_A | 100 | LMO2051 protein; alpha-beta protein, structural ge | 99.65 | |
| 2kjp_A | 91 | Uncharacterized protein YLBL; mixed alpha-beta pro | 99.59 | |
| 2kl1_A | 94 | YLBL protein; structure genomics, structural genom | 99.55 | |
| 2zpm_A | 91 | Regulator of sigma E protease; metalloproteinase, | 99.54 | |
| 3rle_A | 209 | Golgi reassembly-stacking protein 2; PDZ, tether, | 99.43 | |
| 2i6v_A | 87 | General secretion pathway protein C; EPSC, GSPC, P | 99.41 | |
| 3id1_A | 95 | Regulator of sigma E protease; hydrolase, cell inn | 99.38 | |
| 2l97_A | 134 | HTRA, putative serine protease; HTRA-PDZ, protein | 99.37 | |
| 2i4s_A | 105 | General secretion pathway protein C; EPSC, GSPC, P | 99.35 | |
| 2hga_A | 125 | Conserved protein MTH1368; GFT structural genomics | 99.35 | |
| 1qau_A | 112 | Neuronal nitric oxide synthase (residues 1-130); b | 99.33 | |
| 3cyy_A | 92 | Tight junction protein ZO-1; protein-ligand comple | 99.31 | |
| 2pzd_A | 113 | Serine protease HTRA2; PDZ domain, apoptosis, mito | 99.3 | |
| 1wf7_A | 103 | Enigma homologue protein; PDZ domain, structural g | 99.29 | |
| 2p3w_A | 112 | Probable serine protease HTRA3; PDZ domain, phage | 99.27 | |
| 2awx_A | 105 | Synapse associated protein 97; membrane protein, s | 99.26 | |
| 1te0_A | 318 | Protease DEGS; two domains, serine protease, PDZ, | 99.26 | |
| 2vz5_A | 139 | TAX1-binding protein 3; WNT signaling pathway, pro | 99.25 | |
| 2vsp_A | 91 | PDZ domain-containing protein 1; membrane, cytopla | 99.24 | |
| 2pkt_A | 91 | PDZ and LIM domain protein 1; PDZ domain, structur | 99.24 | |
| 3stj_A | 345 | Protease DEGQ; serine protease, PDZ domain, protea | 99.23 | |
| 2pa1_A | 87 | PDZ and LIM domain protein 2; PDZ domain, structur | 99.23 | |
| 1y8t_A | 324 | Hypothetical protein RV0983; serine protease, stru | 99.23 | |
| 2v90_A | 96 | PDZ domain-containing protein 3; membrane, protein | 99.22 | |
| 2eaq_A | 90 | LIM domain only protein 7; conserved hypothetical | 99.22 | |
| 1wh1_A | 124 | KIAA1095 protein; PDZ domain, structural genomics, | 99.21 | |
| 1vb7_A | 94 | PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, | 99.2 | |
| 2uzc_A | 88 | Human pdlim5, PDZ and LIM domain 5; metal-binding, | 99.2 | |
| 2q3g_A | 89 | PDZ and LIM domain protein 7; structural genomics, | 99.19 | |
| 3rle_A | 209 | Golgi reassembly-stacking protein 2; PDZ, tether, | 99.19 | |
| 3sfj_A | 104 | TAX1-binding protein 3; PDZ:peptide complex, signa | 99.18 | |
| 2eeh_A | 100 | PDZ domain-containing protein 7; structural genomi | 99.18 | |
| 1v5l_A | 103 | PDZ and LIM domain 3; actinin alpha 2 associated L | 99.17 | |
| 2jil_A | 97 | GRIP1 protein, glutamate receptor interacting prot | 99.17 | |
| 2eeg_A | 94 | PDZ and LIM domain protein 4; PDZ domain, structur | 99.17 | |
| 2edz_A | 114 | PDZ domain-containing protein 1; CFTR-associated p | 99.17 | |
| 2yub_A | 118 | LIMK-2, LIM domain kinase 2; PDZ domain, structura | 99.17 | |
| 1b8q_A | 127 | Protein (neuronal nitric oxide synthase); PDZ doma | 99.17 | |
| 1ihj_A | 98 | INAD; intermolecular disulfide bond, PDZ domain, s | 99.16 | |
| 1kwa_A | 88 | Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca | 99.16 | |
| 2opg_A | 98 | Multiple PDZ domain protein; structural protein, s | 99.14 | |
| 1n7e_A | 97 | AMPA receptor interacting protein GRIP; PDZ, prote | 99.14 | |
| 1um1_A | 110 | KIAA1849 protein, RSGI RUH-007; PDZ domain, human | 99.13 | |
| 2vsv_A | 109 | Rhophilin-2; scaffold protein, RHO GTPase binding, | 99.13 | |
| 2jxo_A | 98 | Ezrin-radixin-moesin-binding phosphoprotein 50; nh | 99.12 | |
| 1uf1_A | 128 | KIAA1526 protein; PDZ domain, structural genomics, | 99.11 | |
| 2jre_A | 108 | C60-1 PDZ domain peptide; de novo protein; NMR {Sy | 99.11 | |
| 3bpu_A | 88 | Membrane-associated guanylate kinase, WW and PDZ c | 99.11 | |
| 1uep_A | 103 | Membrane associated guanylate kinase inverted-2 (M | 99.11 | |
| 3khf_A | 99 | Microtubule-associated serine/threonine-protein ki | 99.11 | |
| 2i04_A | 85 | Membrane-associated guanylate kinase, WW and PDZ d | 99.11 | |
| 1lcy_A | 325 | HTRA2 serine protease; apoptosis, PDZ domain, casp | 99.11 | |
| 2f5y_A | 91 | Regulator of G-protein signalling 3 isoform 1; PDZ | 99.11 | |
| 2rcz_A | 81 | Tight junction protein ZO-1; PDZ, domain-swapping, | 99.11 | |
| 4amh_A | 106 | Disks large homolog 1; permutation, protein foldin | 99.11 | |
| 1d5g_A | 96 | Human phosphatase HPTP1E; protein-peptide complex, | 99.11 | |
| 1w9e_A | 166 | Syntenin 1; cell adhesion, adhesion/complex, PDZ d | 99.11 | |
| 2kv8_A | 83 | RGS12, regulator of G-protein signaling 12; PDZ do | 99.11 | |
| 2d90_A | 102 | PDZ domain containing protein 1; structural genomi | 99.11 | |
| 1rgw_A | 85 | ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, | 99.1 | |
| 2g5m_B | 113 | Neurabin-2; spinophilin, PDZ domain, CNS, synaptic | 99.1 | |
| 4a8c_A | 436 | Periplasmic PH-dependent serine endoprotease DEGQ; | 99.1 | |
| 2dls_A | 93 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 99.1 | |
| 1x5q_A | 110 | LAP4 protein; PDZ domain, scribble homolog protein | 99.1 | |
| 3qo6_A | 348 | Protease DO-like 1, chloroplastic; protease, HTRA, | 99.09 | |
| 2he4_A | 90 | Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p | 99.09 | |
| 1uew_A | 114 | Membrane associated guanylate kinase inverted-2 (M | 99.09 | |
| 2o2t_A | 117 | Multiple PDZ domain protein; structural protein, s | 99.09 | |
| 1whd_A | 100 | RGS3, regulator of G-protein signaling 3; PDZ doma | 99.09 | |
| 2iwo_A | 120 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 99.09 | |
| 2kom_A | 121 | Partitioning defective 3 homolog; PAR-3B, PDZ doma | 99.09 | |
| 3ngh_A | 106 | PDZ domain-containing protein 1; adaptor protein, | 99.08 | |
| 2koj_A | 111 | Partitioning defective 3 homolog; PDZ domain, stru | 99.08 | |
| 1i16_A | 130 | Interleukin 16, LCF; cytokine, lymphocyte chemoatt | 99.08 | |
| 2djt_A | 104 | Unnamed protein product; PDZ domain, structural ge | 99.08 | |
| 2w4f_A | 97 | Protein LAP4; structural protein, phosphoprotein, | 99.07 | |
| 2ego_A | 96 | General receptor for phosphoinositides 1- associat | 99.07 | |
| 2fe5_A | 94 | Presynaptic protein SAP102; PDZ domain, DLG3, huma | 99.07 | |
| 2kjd_A | 128 | Sodium/hydrogen exchange regulatory cofactor NHE- | 99.07 | |
| 3cbz_A | 108 | Dishevelled-2; PDZ domain, phage derived high affi | 99.07 | |
| 3qik_A | 101 | Phosphatidylinositol 3,4,5-trisphosphate-dependen | 99.07 | |
| 1wi4_A | 109 | Synip, syntaxin binding protein 4; syntaxin4-inter | 99.07 | |
| 1vae_A | 111 | Rhophilin 2, rhophilin, RHO GTPase binding protein | 99.06 | |
| 2r4h_A | 112 | Membrane-associated guanylate kinase, WW and PDZ c | 99.06 | |
| 3num_A | 332 | Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom | 99.06 | |
| 1v5q_A | 122 | GRIP1 homolog, glutamate receptor interacting prot | 99.06 | |
| 3pv2_A | 451 | DEGQ; trypsin fold, PDZ domain, chaperone protease | 99.06 | |
| 1ujd_A | 117 | KIAA0559 protein; PDZ domain, structural genomics, | 99.05 | |
| 2dlu_A | 111 | INAD-like protein; PDZ domain, inadl protein, hina | 99.05 | |
| 2fne_A | 117 | Multiple PDZ domain protein; structural protein, s | 99.05 | |
| 1wif_A | 126 | RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s | 99.05 | |
| 2edp_A | 100 | Fragment, shroom family member 4; APX/shroom famil | 99.05 | |
| 2kpk_A | 129 | Membrane-associated guanylate kinase, WW and PDZ c | 99.05 | |
| 2d92_A | 108 | INAD-like protein; PDZ domain, inadl protein, hina | 99.04 | |
| 1wfg_A | 131 | Regulating synaptic membrane exocytosis protein 2; | 99.04 | |
| 1ueq_A | 123 | Membrane associated guanylate kinase inverted-2 (M | 99.04 | |
| 1g9o_A | 91 | NHE-RF; PDZ domain, complex, signaling protein; 1. | 99.04 | |
| 3tsv_A | 124 | Tight junction protein ZO-1; PDZ, scaffolding, JAM | 99.04 | |
| 2yt7_A | 101 | Amyloid beta A4 precursor protein-binding family A | 99.04 | |
| 1y7n_A | 90 | Amyloid beta A4 precursor protein-binding family A | 99.03 | |
| 2iwn_A | 97 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 99.03 | |
| 4a8c_A | 436 | Periplasmic PH-dependent serine endoprotease DEGQ; | 99.03 | |
| 1x5n_A | 114 | Harmonin; PDZ domain, usher syndrome 1C protein, a | 99.03 | |
| 1wfv_A | 103 | Membrane associated guanylate kinase inverted-2; a | 99.03 | |
| 2jik_A | 101 | Synaptojanin-2 binding protein; transmembrane, out | 99.03 | |
| 2fcf_A | 103 | Multiple PDZ domain protein; adaptor molecule, pro | 99.02 | |
| 2ejy_A | 97 | 55 kDa erythrocyte membrane protein; GPC, maguk, P | 99.02 | |
| 1wha_A | 105 | KIAA0147 protein, scribble; PDZ domain, cellular s | 99.02 | |
| 2i1n_A | 102 | Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig | 99.02 | |
| 2vwr_A | 95 | Ligand of NUMB protein X 2; protein-binding, metal | 99.01 | |
| 1m5z_A | 91 | GRIP, AMPA receptor interacting protein; six beta- | 99.01 | |
| 2dm8_A | 116 | INAD-like protein; PDZ domain, inadl protein, hina | 99.01 | |
| 1ujv_A | 96 | Membrane associated guanylate kinase inverted-2 (M | 99.01 | |
| 1p1d_A | 196 | PDZ45, glutamate receptor interacting protein; PDZ | 99.0 | |
| 3axa_A | 106 | Afadin, nectin-3, protein AF-6; PDZ domain, fusion | 99.0 | |
| 1wi2_A | 104 | Riken cDNA 2700099C19; structural genomics, riken | 99.0 | |
| 2edv_A | 96 | FERM and PDZ domain-containing protein 1; cytoskel | 99.0 | |
| 2q9v_A | 90 | Membrane-associated guanylate kinase, WW and PDZ c | 99.0 | |
| 3qe1_A | 107 | Sorting nexin-27, G protein-activated inward RECT | 98.99 | |
| 1qav_A | 90 | Alpha-1 syntrophin (residues 77-171); beta-finger, | 98.99 | |
| 3r0h_A | 206 | INAD, inactivation-NO-after-potential D protein; p | 98.99 | |
| 1q7x_A | 108 | PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str | 98.99 | |
| 2qg1_A | 92 | Multiple PDZ domain protein; MPDZ, MUPP1, structur | 98.99 | |
| 2byg_A | 117 | Channel associated protein of synapse-110; DLG2, P | 98.98 | |
| 1r6j_A | 82 | Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap | 98.98 | |
| 4fgm_A | 597 | Aminopeptidase N family protein; structural genomi | 98.98 | |
| 2cs5_A | 119 | Tyrosine-protein phosphatase, non-receptor type 4; | 98.98 | |
| 3o46_A | 93 | Maguk P55 subfamily member 7; PDZ domain, structur | 98.97 | |
| 1x6d_A | 119 | Interleukin-16; PDZ domain, lymphocyte chemoattrac | 98.96 | |
| 2qbw_A | 195 | PDZ-fibronectin fusion protein; fibronectin PDZ, u | 98.96 | |
| 1wg6_A | 127 | Hypothetical protein (riken cDNA 2810455B10); stru | 98.95 | |
| 1v62_A | 117 | KIAA1719 protein; structural genomics, synaptic tr | 98.95 | |
| 3hpk_A | 125 | Protein interacting with PRKCA 1; oxidized, PDZ do | 98.94 | |
| 2dkr_A | 93 | LIN-7 homolog B; LIN-7B, PDZ, structural genomics, | 98.94 | |
| 1fc6_A | 388 | Photosystem II D1 protease; D1 C-terminal processi | 98.94 | |
| 3r68_A | 95 | Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P | 98.94 | |
| 2db5_A | 128 | INAD-like protein; PDZ domain, hinadl, PALS1- asso | 98.94 | |
| 2dmz_A | 129 | INAD-like protein; PDZ domain, inadl protein, hina | 98.94 | |
| 1ufx_A | 103 | KIAA1526 protein; PDZ domain, structural genomics, | 98.94 | |
| 1mfg_A | 95 | ERB-B2 interacting protein; PDZ domain, protein-pe | 98.94 | |
| 2iwq_A | 123 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 98.94 | |
| 1uit_A | 117 | Human discs large 5 protein; PDZ domain, HDLG5, ma | 98.93 | |
| 1v6b_A | 118 | Harmonin isoform A1; structural genomics, usher sy | 98.93 | |
| 3nfk_A | 107 | Tyrosine-protein phosphatase non-receptor type 4; | 98.93 | |
| 1va8_A | 113 | Maguk P55 subfamily member 5; PDZ domain, palmitoy | 98.93 | |
| 1wf8_A | 107 | Neurabin-I; PDZ domain, structural genomics, NPPSF | 98.92 | |
| 3gsl_A | 196 | Disks large homolog 4; PDZ domain, tandem, PSD-95, | 98.92 | |
| 3k1r_A | 192 | Harmonin; protein-protein complex, alternative spl | 98.92 | |
| 1uhp_A | 107 | Hypothetical protein KIAA1095; PDZ domain, semapho | 98.92 | |
| 2yuy_A | 126 | RHO GTPase activating protein 21; PDZ domain, stru | 98.92 | |
| 1q3o_A | 109 | Shank1; PDZ, GKAP, peptide binding protein; 1.80A | 98.92 | |
| 3l4f_D | 132 | SH3 and multiple ankyrin repeat domains protein 1; | 98.91 | |
| 2d8i_A | 114 | T-cell lymphoma invasion and metastasis 1 variant; | 98.91 | |
| 3kzd_A | 94 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 98.91 | |
| 1n7t_A | 103 | 99-MER peptide of densin-180-like protein; PDZ dom | 98.91 | |
| 1nf3_C | 128 | PAR-6B; semi-CRIB motif, switch I and II, PDZ doma | 98.91 | |
| 4e34_A | 87 | Golgi-associated PDZ and coiled-coil motif-contai | 98.91 | |
| 2eno_A | 120 | Synaptojanin-2-binding protein; mitochondrial oute | 98.9 | |
| 2dc2_A | 103 | GOPC, golgi associated PDZ and coiled-coil motif c | 98.89 | |
| 3pv2_A | 451 | DEGQ; trypsin fold, PDZ domain, chaperone protease | 98.89 | |
| 3i4w_A | 104 | Disks large homolog 4; alpha and beta protein, alt | 98.89 | |
| 2e7k_A | 91 | Maguk P55 subfamily member 2; PDZ domain, MPP2 pro | 98.89 | |
| 2daz_A | 124 | INAD-like protein; PDZ domain, inadl protein, hina | 98.89 | |
| 1uez_A | 101 | KIAA1526 protein; PDZ domain, structural genomics, | 98.89 | |
| 2qt5_A | 200 | Glutamate receptor-interacting protein 1; PDZ-pept | 98.88 | |
| 1ky9_A | 448 | Protease DO, DEGP, HTRA; protein quality control, | 98.88 | |
| 3b76_A | 118 | E3 ubiquitin-protein ligase LNX; PDZ, bound ligand | 98.88 | |
| 2ehr_A | 117 | INAD-like protein; PDZ domain, inadl protein, hina | 98.88 | |
| 2eei_A | 106 | PDZ domain-containing protein 1; regulatory factor | 98.87 | |
| 3e17_A | 88 | Tight junction protein ZO-2; domain swapping, alte | 98.87 | |
| 2qkv_A | 96 | Inactivation-NO-after-potential D protein; PDZ dom | 98.87 | |
| 3soe_A | 113 | Membrane-associated guanylate kinase, WW and PDZ c | 98.87 | |
| 2h2b_A | 107 | Tight junction protein ZO-1; PDZ domain, phage der | 98.86 | |
| 3egg_C | 170 | Spinophilin; PP1, serine/threonine phosphatase, po | 98.85 | |
| 2gzv_A | 114 | PRKCA-binding protein; protein kinase C, PDZ domai | 98.85 | |
| 2la8_A | 106 | Inactivation-NO-after-potential D protein, KON-TI | 98.84 | |
| 2qt5_A | 200 | Glutamate receptor-interacting protein 1; PDZ-pept | 98.84 | |
| 3gsl_A | 196 | Disks large homolog 4; PDZ domain, tandem, PSD-95, | 98.83 | |
| 1p1d_A | 196 | PDZ45, glutamate receptor interacting protein; PDZ | 98.83 | |
| 1uju_A | 111 | Scribble; PDZ domain, cellular signaling, structur | 98.81 | |
| 1um7_A | 113 | Synapse-associated protein 102; PDZ, discs large h | 98.77 | |
| 3tsz_A | 391 | Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol | 98.76 | |
| 2z17_A | 104 | Pleckstrin homology SEC7 and coiled-coil domains- | 98.76 | |
| 2csj_A | 117 | TJP2 protein; PDZ domain, structural genomics, NPP | 98.75 | |
| 3suz_A | 388 | Amyloid beta A4 precursor protein-binding family 2 | 98.71 | |
| 1tp5_A | 119 | Presynaptic density protein 95; PDZ-peptide ligand | 98.68 | |
| 3r0h_A | 206 | INAD, inactivation-NO-after-potential D protein; p | 98.68 | |
| 2krg_A | 216 | Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a | 98.67 | |
| 3k50_A | 403 | Putative S41 protease; structural genomics, joint | 98.61 | |
| 1ky9_A | 448 | Protease DO, DEGP, HTRA; protein quality control, | 98.6 | |
| 1z87_A | 263 | Alpha-1-syntrophin; protein binding; NMR {Mus musc | 98.6 | |
| 2lob_A | 112 | Golgi-associated PDZ and coiled-coil motif-contai | 98.02 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 98.57 | |
| 3shw_A | 468 | Tight junction protein ZO-1; PDZ-SH3-GUK supramodu | 98.56 | |
| 4fln_A | 539 | Protease DO-like 2, chloroplastic; protease, DEG, | 98.4 | |
| 1w9e_A | 166 | Syntenin 1; cell adhesion, adhesion/complex, PDZ d | 98.38 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 98.23 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 98.15 | |
| 3gge_A | 95 | PDZ domain-containing protein GIPC2; structural ge | 98.1 | |
| 3suz_A | 388 | Amyloid beta A4 precursor protein-binding family 2 | 97.89 | |
| 4fln_A | 539 | Protease DO-like 2, chloroplastic; protease, DEG, | 97.18 |
| >3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A | Back alignment and structure |
|---|
Probab=99.65 E-value=1.9e-15 Score=94.37 Aligned_cols=80 Identities=16% Similarity=0.220 Sum_probs=67.2
Q ss_pred CCCCCccccccccCCCCCCEEEEECCeecCCcccHHHHHHHHHhC-CCceEEEEEEeCCceEEEEEEeecC--CCCeeeE
Q psy12583 8 SEGYPRQDVDVYQGLVKDDIILEFGPINSSNFKSLQDIASTVRAG-VNTDIPITVLRNEGTRQRLVLRPQP--FEGQGLV 84 (96)
Q Consensus 8 ~~~~pa~~~~~~aGLk~GD~Il~vng~~~~~~~~~~di~~~i~~~-~g~~i~l~V~R~g~~~~~l~v~p~~--~~~~~~l 84 (96)
.++|||+ + ||++||+|++|||.+ +.+|.++..+++.. ++.++.++|.|++ +..++++++.. ..+++.|
T Consensus 15 ~~~spA~----~-GL~~GD~I~~Ing~~---v~~~~dl~~~l~~~~~g~~v~l~v~R~g-~~~~~~v~~~~~~~~~~~~i 85 (100)
T 3i18_A 15 KDDVPAA----D-VLHAGDLITEIDGNA---FKSSQEFIDYIHSKKVGDTVKINYKHGD-KNEQADIKLTAIDKKGTPGI 85 (100)
T ss_dssp CTTSGGG----G-TCCTTCEEEEETTBC---CSSHHHHHHHHHTSCTTCEEEEEEEETT-EEEEEEEECEECSTTCCEEC
T ss_pred CCCCchH----H-CCCCCCEEEEECCEE---CCCHHHHHHHHHhCCCCCEEEEEEEECC-EEEEEEEEEecCCCCCCcEE
Confidence 4789999 7 999999999999955 68899999999874 6889999999999 98888888864 3468899
Q ss_pred EEEEecceeecC
Q psy12583 85 GCYFLNVENVER 96 (96)
Q Consensus 85 Gi~~~~~~~~~~ 96 (96)
|+.+.+...-|+
T Consensus 86 Gi~~~~~~~~~~ 97 (100)
T 3i18_A 86 GITLVDDLEHHH 97 (100)
T ss_dssp SEEEGGGC-CCC
T ss_pred eEEEecCCcccc
Confidence 999988776664
|
| >2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} | Back alignment and structure |
|---|
| >2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} | Back alignment and structure |
|---|
| >2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A | Back alignment and structure |
|---|
| >3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A | Back alignment and structure |
|---|
| >2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 | Back alignment and structure |
|---|
| >3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A | Back alignment and structure |
|---|
| >2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 | Back alignment and structure |
|---|
| >2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 | Back alignment and structure |
|---|
| >1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B | Back alignment and structure |
|---|
| >3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 | Back alignment and structure |
|---|
| >1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A | Back alignment and structure |
|---|
| >1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A | Back alignment and structure |
|---|
| >2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A | Back alignment and structure |
|---|
| >2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A | Back alignment and structure |
|---|
| >2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* | Back alignment and structure |
|---|
| >3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A | Back alignment and structure |
|---|
| >1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A | Back alignment and structure |
|---|
| >2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} | Back alignment and structure |
|---|
| >1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} | Back alignment and structure |
|---|
| >3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A | Back alignment and structure |
|---|
| >3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A | Back alignment and structure |
|---|
| >2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A | Back alignment and structure |
|---|
| >1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A | Back alignment and structure |
|---|
| >2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} | Back alignment and structure |
|---|
| >1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 | Back alignment and structure |
|---|
| >2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A | Back alignment and structure |
|---|
| >4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A | Back alignment and structure |
|---|
| >1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A | Back alignment and structure |
|---|
| >2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A | Back alignment and structure |
|---|
| >2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A | Back alignment and structure |
|---|
| >2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A | Back alignment and structure |
|---|
| >1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A | Back alignment and structure |
|---|
| >1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A | Back alignment and structure |
|---|
| >2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 | Back alignment and structure |
|---|
| >2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A | Back alignment and structure |
|---|
| >1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 | Back alignment and structure |
|---|
| >2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A | Back alignment and structure |
|---|
| >2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A | Back alignment and structure |
|---|
| >2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A | Back alignment and structure |
|---|
| >3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A | Back alignment and structure |
|---|
| >1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A | Back alignment and structure |
|---|
| >1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A | Back alignment and structure |
|---|
| >2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A | Back alignment and structure |
|---|
| >1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A | Back alignment and structure |
|---|
| >3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A | Back alignment and structure |
|---|
| >2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A | Back alignment and structure |
|---|
| >1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A | Back alignment and structure |
|---|
| >1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A | Back alignment and structure |
|---|
| >2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A | Back alignment and structure |
|---|
| >1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A | Back alignment and structure |
|---|
| >2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A | Back alignment and structure |
|---|
| >3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A | Back alignment and structure |
|---|
| >1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A | Back alignment and structure |
|---|
| >3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A | Back alignment and structure |
|---|
| >4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} | Back alignment and structure |
|---|
| >2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 | Back alignment and structure |
|---|
| >1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 | Back alignment and structure |
|---|
| >2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A | Back alignment and structure |
|---|
| >1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A | Back alignment and structure |
|---|
| >1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A | Back alignment and structure |
|---|
| >2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A | Back alignment and structure |
|---|
| >3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* | Back alignment and structure |
|---|
| >2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A | Back alignment and structure |
|---|
| >2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A | Back alignment and structure |
|---|
| >1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A | Back alignment and structure |
|---|
| >3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A | Back alignment and structure |
|---|
| >1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* | Back alignment and structure |
|---|
| >3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A | Back alignment and structure |
|---|
| >1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A | Back alignment and structure |
|---|
| >1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A | Back alignment and structure |
|---|
| >4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A | Back alignment and structure |
|---|
| >2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A | Back alignment and structure |
|---|
| >3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A | Back alignment and structure |
|---|
| >2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A | Back alignment and structure |
|---|
| >3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A | Back alignment and structure |
|---|
| >3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A | Back alignment and structure |
|---|
| >3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A | Back alignment and structure |
|---|
| >2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A | Back alignment and structure |
|---|
| >2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A | Back alignment and structure |
|---|
| >1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A | Back alignment and structure |
|---|
| >1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A | Back alignment and structure |
|---|
| >2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A | Back alignment and structure |
|---|
| >1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A | Back alignment and structure |
|---|
| >3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A | Back alignment and structure |
|---|
| >1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A | Back alignment and structure |
|---|
| >4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 96 | |||
| d2hgaa1 | 103 | Uncharacterized protein MTH1368 {Methanobacterium | 99.55 | |
| d1lcya1 | 100 | Mitochondrial serine protease HtrA2 {Human (Homo s | 99.53 | |
| d2z9ia1 | 88 | Protease PepD {Mycobacterium tuberculosis [TaxId: | 99.44 | |
| d1fc6a3 | 92 | Photosystem II D1 C-terminal processing protease { | 99.41 | |
| d1k32a1 | 91 | Tricorn protease {Archaeon Thermoplasma acidophilu | 99.4 | |
| d2i6va1 | 87 | General secretion pathway protein C, EpsC {Vibrio | 99.4 | |
| d1ky9b2 | 88 | Protease Do (DegP, HtrA), C-terminal domains {Esch | 99.38 | |
| d1ky9a1 | 94 | Protease Do (DegP, HtrA), C-terminal domains {Esch | 99.34 | |
| d1sota1 | 99 | Stress sensor protease DegS, C-terminal domain {Es | 99.33 | |
| d1rgwa_ | 85 | Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax | 99.1 | |
| d1w9ea1 | 85 | Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | 99.07 | |
| d2f5ya1 | 77 | Regulator of G-protein signaling 3, RGS3 {Human (H | 99.06 | |
| d1x5qa1 | 97 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 99.02 | |
| d1vb7a_ | 94 | PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta | 99.0 | |
| d1m5za_ | 91 | Glutamate receptor interacting protein {Rat (Rattu | 98.99 | |
| d1q3oa_ | 104 | Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId | 98.98 | |
| d1t2ma1 | 92 | Afadin {Human (Homo sapiens) [TaxId: 9606]} | 98.98 | |
| d2fe5a1 | 92 | Synapse-associated protein 102 {Human (Homo sapien | 98.96 | |
| d1ozia_ | 99 | Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 | 98.94 | |
| d1rgra_ | 93 | Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ | 98.93 | |
| d1ihja_ | 94 | Inad {Fruit fly (Drosophila melanogaster) [TaxId: | 98.92 | |
| d1wf8a1 | 94 | Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} | 98.9 | |
| d1vaea_ | 111 | Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} | 98.9 | |
| d2fcfa1 | 96 | Multiple PDZ domain protein {Human (Homo sapiens) | 98.89 | |
| d1p1da2 | 99 | Glutamate receptor interacting protein {Rat (Rattu | 98.88 | |
| d1g9oa_ | 91 | Na+/H+ exchanger regulatory factor, NHERF {Human ( | 98.87 | |
| d1qava_ | 90 | Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | 98.84 | |
| d1whaa_ | 105 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 98.84 | |
| d1wifa_ | 126 | hypothetical PDZ domain containing protein Uqcrc2 | 98.83 | |
| d1r6ja_ | 82 | Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | 98.83 | |
| d1v5la_ | 103 | Alpha-actinin-2 associated LIM protein {Mouse (Mus | 98.82 | |
| d1y7na1 | 79 | Amyloid beta A4 precursor protein-binding family A | 98.81 | |
| d1wf7a_ | 103 | Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 | 98.79 | |
| d1wi2a_ | 104 | PDZ domain containing protein 11, Pdzk11 {Mouse (M | 98.79 | |
| d1n7ea_ | 95 | Glutamate receptor-interacting protein 1, GRIP1 {R | 98.78 | |
| d1uewa_ | 114 | Membrane associated guanylate kinase inverted-2 (M | 98.78 | |
| d1uhpa_ | 107 | Hypothetical protein KIAA1095 {Human (Homo sapiens | 98.76 | |
| d1um1a_ | 110 | Hypothetical protein KIAA1849 {Human (Homo sapiens | 98.76 | |
| d1wi4a1 | 96 | Syntaxin binding protein 4 {Mouse (Mus musculus) [ | 98.75 | |
| d1ujda_ | 117 | Hypothetical protein KIAA0559 {Human (Homo sapiens | 98.75 | |
| d1i16a_ | 130 | Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] | 98.74 | |
| d1uepa_ | 103 | Membrane associated guanylate kinase inverted-2 (M | 98.74 | |
| d1ueqa_ | 123 | Membrane associated guanylate kinase inverted-2 (M | 98.74 | |
| d1uf1a_ | 128 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 98.71 | |
| d1qaua_ | 112 | Neuronal nitric oxide synthase, NNOS {Rat (Rattus | 98.7 | |
| d2csja1 | 104 | Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc | 98.69 | |
| d2h3la1 | 103 | Erbin {Human (Homo sapiens) [TaxId: 9606]} | 98.69 | |
| d1kwaa_ | 88 | Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} | 98.68 | |
| d1tp5a1 | 102 | Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ | 98.68 | |
| d2f0aa1 | 92 | Segment polarity protein dishevelled homolog Dvl-2 | 98.67 | |
| d1rzxa_ | 98 | GTPase-binding domain of the cell polarity protein | 98.67 | |
| d2cssa1 | 108 | Regulating synaptic membrane exocytosis protein 1, | 98.65 | |
| d1wfva_ | 103 | Membrane associated guanylate kinase inverted-2 (M | 98.65 | |
| d2cs5a1 | 106 | Tyrosine-protein phosphatase non-receptor type 4, | 98.65 | |
| d1x45a1 | 85 | Amyloid beta A4 precursor protein-binding family A | 98.65 | |
| d2fnea1 | 88 | Multiple PDZ domain protein {Human (Homo sapiens) | 98.64 | |
| d1uita_ | 117 | Discs large 5 protein KIAA0583 {Human (Homo sapien | 98.63 | |
| d1ujua_ | 111 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 98.61 | |
| d1ujva_ | 96 | Membrane associated guanylate kinase inverted-2 (M | 98.6 | |
| d1ueza_ | 101 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 98.6 | |
| d1wh1a_ | 124 | Hypothetical protein KIAA1095 {Human (Homo sapiens | 98.56 | |
| d1v62a_ | 117 | Glutamate receptor interacting protein 2, GRIP2 (K | 98.56 | |
| d1v6ba_ | 118 | Harmonin {Mouse (Mus musculus) [TaxId: 10090]} | 98.54 | |
| d1x5na1 | 101 | Harmonin {Human (Homo sapiens) [TaxId: 9606]} | 98.54 | |
| d1va8a1 | 100 | Maguk p55 subfamily member 5 {Mouse (Mus musculus) | 98.53 | |
| d1x6da1 | 107 | Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] | 98.52 | |
| d1x5ra1 | 99 | Glutamate receptor interacting protein 2, GRIP2 (K | 98.5 | |
| d1wg6a_ | 127 | Partitioning-defective 3-like protein, PAR3-L (RIK | 98.49 | |
| d1v5qa_ | 122 | Glutamate receptor interacting protein {Mouse (Mus | 98.48 | |
| d1ufxa_ | 103 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 98.31 |
| >d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: PDZ domain-like superfamily: PDZ domain-like family: MTH1368 C-terminal domain-like domain: Uncharacterized protein MTH1368 species: Methanobacterium thermoautotrophicum [TaxId: 145262]
Probab=99.55 E-value=3.3e-15 Score=92.93 Aligned_cols=73 Identities=16% Similarity=0.156 Sum_probs=61.2
Q ss_pred CCCCCccccccccCCCCCCEEEEECCeecCCcccHHHHHHHHHhC-CCceEEEEEEeCCceEEEEEEeecCCCCeeeEEE
Q psy12583 8 SEGYPRQDVDVYQGLVKDDIILEFGPINSSNFKSLQDIASTVRAG-VNTDIPITVLRNEGTRQRLVLRPQPFEGQGLVGC 86 (96)
Q Consensus 8 ~~~~pa~~~~~~aGLk~GD~Il~vng~~~~~~~~~~di~~~i~~~-~g~~i~l~V~R~g~~~~~l~v~p~~~~~~~~lGi 86 (96)
.+||||+ ++ |++||+|++|||.+ +.+|.++..+|+.+ +|+.++|+|+|++ ..+++...|.. .+.+++|+
T Consensus 11 ~~~sPA~----~~-L~~GD~I~~ing~~---v~~~~~l~~~i~~~~~G~~v~l~v~R~~-~~~~l~~~p~~-~~~~~iGi 80 (103)
T d2hgaa1 11 VPGSPAS----KV-LTPGLVIESINGMP---TSNLTTYSAALKTISVGEVINITTDQGT-FHLKTGRNPNN-SSRAYMGI 80 (103)
T ss_dssp CSSSGGG----GT-SCTTCEEEEETTEE---CSSHHHHHHHHTTCCTTCEEEEEETTEE-EEEECCBCSSS-CCSCBCCE
T ss_pred CCCChHH----hc-CCCCCEEEEECCEE---cCCHHHHHHHHhhCCCCCEEEEEEEECC-EEEEEEeccCC-CCceEEEE
Confidence 5799999 75 99999999999966 58899999999875 6999999999998 77777666653 56788999
Q ss_pred EEec
Q psy12583 87 YFLN 90 (96)
Q Consensus 87 ~~~~ 90 (96)
.+..
T Consensus 81 ~~~~ 84 (103)
T d2hgaa1 81 RTSN 84 (103)
T ss_dssp EEEC
T ss_pred Eecc
Confidence 8763
|
| >d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} | Back information, alignment and structure |
|---|
| >d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|