Psyllid ID: psy12583


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90------
MNEPLVDSEGYPRQDVDVYQGLVKDDIILEFGPINSSNFKSLQDIASTVRAGVNTDIPITVLRNEGTRQRLVLRPQPFEGQGLVGCYFLNVENVER
ccccEEEEccccccccHHHcccccccEEEEEccEEccccccHHHHHHHHHHccccEEEEEEEcccccEEEEEEEEcccccccEEEEEEEEEEcccc
cccccEEccccccccHHHHcccccccEEEEEcccccccHHHHHHHHHHHHHcccccEEEEEEEcccEEEEEEEEccccccccccccEEEEcEEccc
mneplvdsegyprqdvdvyqglvkddiilefgpinssnfksLQDIASTVragvntdipitvlrnegtrqrlvlrpqpfegqglvgcyflnvenver
mneplvdsegyprqdVDVYQGLVKDDIILEFGPINSSNFKSLQDIASTVragvntdipitvlrnegtrqrlvlrpqpfegqglvgcyflnvenver
MNEPLVDSEGYPRQDVDVYQGLVKDDIILEFGPINSSNFKSLQDIASTVRAGVNTDIPITVLRNEGTRQRLVLRPQPFEGQGLVGCYFLNVENVER
**************DVDVYQGLVKDDIILEFGPINSSNFKSLQDIASTVRAGVNTDIPITVLRNEGTRQRLVLRPQPFEGQGLVGCYFLNVE****
*NEPLVDSEGYPRQDVDVYQGLVKDDIILEFGPINSSNFKSLQDIASTVRAGVNTDIPITVLRNEGTRQRLVLRPQPFEGQGLVGCYFLNVEN***
*********GYPRQDVDVYQGLVKDDIILEFGPINSSNFKSLQDIASTVRAGVNTDIPITVLRNEGTRQRLVLRPQPFEGQGLVGCYFLNVENVER
******DSE*YPRQDVDVYQGLVKDDIILEFGPINSSNFKSLQDIASTVRAGVNTDIPITVLRNEGTRQRLVLRPQPFEGQGLVGCYFLNVENVE*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNEPLVDSEGYPRQDVDVYQGLVKDDIILEFGPINSSNFKSLQDIASTVRAGVNTDIPITVLRNEGTRQRLVLRPQPFEGQGLVGCYFLNVENVER
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query96 2.2.26 [Sep-21-2011]
Q3SZ19221 26S proteasome non-ATPase yes N/A 0.708 0.307 0.434 4e-09
O00233223 26S proteasome non-ATPase yes N/A 0.708 0.304 0.405 4e-08
Q9WTV5222 26S proteasome non-ATPase yes N/A 0.677 0.292 0.393 1e-07
Q9CR00222 26S proteasome non-ATPase yes N/A 0.708 0.306 0.376 1e-07
Q10920197 Probable 26S proteasome n yes N/A 0.677 0.329 0.348 8e-06
>sp|Q3SZ19|PSMD9_BOVIN 26S proteasome non-ATPase regulatory subunit 9 OS=Bos taurus GN=PSMD9 PE=1 SV=1 Back     alignment and function desciption
 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 44/69 (63%), Gaps = 1/69 (1%)

Query: 21  GLVKDDIILEFGPINSSNFKSLQDIASTVRAGVNTDIPITVLRNEGTRQRLVLRPQPFEG 80
           GL  DD ILEFG +N+ NF+SLQ+I S V+      + +TV+R  G + +L L P  + G
Sbjct: 150 GLQVDDEILEFGSVNTQNFQSLQNIGSVVQHSEGKPLNVTVMRR-GEKHQLRLVPTRWAG 208

Query: 81  QGLVGCYFL 89
           +GL+GC  +
Sbjct: 209 KGLLGCNII 217




Acts as a chaperone during the assembly of the 26S proteasome, specifically of the base subcomplex of the PA700/19S regulatory complex (RC). During the base subcomplex assembly is part of an intermediate PSMD9:PSMC6:PSMC3 module, also known as modulator trimer complex; PSMD9 is released during the further base assembly process.
Bos taurus (taxid: 9913)
>sp|O00233|PSMD9_HUMAN 26S proteasome non-ATPase regulatory subunit 9 OS=Homo sapiens GN=PSMD9 PE=1 SV=3 Back     alignment and function description
>sp|Q9WTV5|PSMD9_RAT 26S proteasome non-ATPase regulatory subunit 9 OS=Rattus norvegicus GN=Psmd9 PE=1 SV=1 Back     alignment and function description
>sp|Q9CR00|PSMD9_MOUSE 26S proteasome non-ATPase regulatory subunit 9 OS=Mus musculus GN=Psmd9 PE=1 SV=1 Back     alignment and function description
>sp|Q10920|PSMD9_CAEEL Probable 26S proteasome non-ATPase regulatory subunit 9 OS=Caenorhabditis elegans GN=C44B7.1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query96
307191076140 26S proteasome non-ATPase regulatory sub 0.989 0.678 0.5 2e-16
242010661 203 26S proteasome non-ATPase regulatory sub 0.781 0.369 0.486 2e-11
170040003 217 26S proteasome non-ATPase regulatory sub 0.895 0.396 0.395 1e-09
157137956 228 26S proteasome non-atpase regulatory sub 0.864 0.364 0.386 4e-09
321449678 204 hypothetical protein DAPPUDRAFT_302228 [ 0.875 0.411 0.382 6e-09
91085583 201 PREDICTED: similar to 26S proteasome non 0.645 0.308 0.478 2e-08
345489493195 PREDICTED: 26S proteasome non-ATPase reg 0.791 0.389 0.415 3e-08
345489489 208 PREDICTED: 26S proteasome non-ATPase reg 0.781 0.360 0.421 3e-08
57525182 207 26S proteasome non-ATPase regulatory sub 0.677 0.314 0.469 6e-08
326929670176 PREDICTED: 26S proteasome non-ATPase reg 0.708 0.386 0.449 6e-08
>gi|307191076|gb|EFN74816.1| 26S proteasome non-ATPase regulatory subunit 9 [Camponotus floridanus] Back     alignment and taxonomy information
 Score = 89.7 bits (221), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 62/96 (64%), Gaps = 1/96 (1%)

Query: 1   MNEPLVDSEGYPRQDVDVYQGLVKDDIILEFGPINSSNFKSLQDIASTVRAGVNTDIPIT 60
           M+E LVDSEGYPRQD+DVYQG+  +D+ILEFG I+  NFKSL DI   V       I + 
Sbjct: 46  MDESLVDSEGYPRQDIDVYQGIQVEDLILEFGSIHYRNFKSLTDIGKLVENSRYKVINLK 105

Query: 61  VLRNEGTRQRLVLRPQPFEGQGLVGCYFLNVENVER 96
           + R       L L P+P+ G+GL+GC  + +E VER
Sbjct: 106 IKRGSNVI-VLSLTPRPWVGKGLLGCNVIPLEIVER 140




Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242010661|ref|XP_002426079.1| 26S proteasome non-ATPase regulatory subunit, putative [Pediculus humanus corporis] gi|212510107|gb|EEB13341.1| 26S proteasome non-ATPase regulatory subunit, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|170040003|ref|XP_001847804.1| 26S proteasome non-ATPase regulatory subunit 9 [Culex quinquefasciatus] gi|167863584|gb|EDS26967.1| 26S proteasome non-ATPase regulatory subunit 9 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157137956|ref|XP_001664093.1| 26S proteasome non-atpase regulatory subunit [Aedes aegypti] gi|108869609|gb|EAT33834.1| AAEL013890-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|321449678|gb|EFX62012.1| hypothetical protein DAPPUDRAFT_302228 [Daphnia pulex] gi|321474924|gb|EFX85888.1| hypothetical protein DAPPUDRAFT_309024 [Daphnia pulex] Back     alignment and taxonomy information
>gi|91085583|ref|XP_968374.1| PREDICTED: similar to 26S proteasome non-ATPase regulatory subunit 9 [Tribolium castaneum] gi|270010071|gb|EFA06519.1| hypothetical protein TcasGA2_TC009422 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|345489493|ref|XP_001602875.2| PREDICTED: 26S proteasome non-ATPase regulatory subunit 9-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|345489489|ref|XP_003426148.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 9-like isoform 2 [Nasonia vitripennis] gi|345489491|ref|XP_003426149.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 9-like isoform 3 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|57525182|ref|NP_001006189.1| 26S proteasome non-ATPase regulatory subunit 9 [Gallus gallus] gi|53133386|emb|CAG32022.1| hypothetical protein RCJMB04_16d3 [Gallus gallus] Back     alignment and taxonomy information
>gi|326929670|ref|XP_003210980.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 9-like, partial [Meleagris gallopavo] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query96
UNIPROTKB|Q3SZ19221 PSMD9 "26S proteasome non-ATPa 0.739 0.321 0.416 2.7e-18
UNIPROTKB|O00233223 PSMD9 "26S proteasome non-ATPa 0.739 0.318 0.388 2.3e-17
MGI|MGI:1914401222 Psmd9 "proteasome (prosome, ma 0.739 0.319 0.361 5.1e-17
RGD|621110222 Psmd9 "proteasome (prosome, ma 0.75 0.324 0.368 6.7e-17
TAIR|locus:2174453227 AT5G57950 "AT5G57950" [Arabido 0.687 0.290 0.294 6.1e-09
SGD|S000001269220 NAS2 "Proteasome-interacting p 0.635 0.277 0.317 1.1e-08
UNIPROTKB|Q10920197 C44B7.1 "Probable 26S proteaso 0.864 0.421 0.337 4.2e-08
CGD|CAL0000640231 orf19.2301 [Candida albicans ( 0.729 0.303 0.342 7.9e-08
UNIPROTKB|Q59WK1231 CaO19.1014 "Putative uncharact 0.729 0.303 0.342 7.9e-08
FB|FBgn0038166220 CG9588 [Drosophila melanogaste 0.677 0.295 0.417 1.5e-06
UNIPROTKB|Q3SZ19 PSMD9 "26S proteasome non-ATPase regulatory subunit 9" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 141 (54.7 bits), Expect = 2.7e-18, Sum P(2) = 2.7e-18
 Identities = 30/72 (41%), Positives = 46/72 (63%)

Query:    21 GLVKDDIILEFGPINSSNFKSLQDIASTVRAGVNTDIPITVLRNEGTRQRLVLRPQPFEG 80
             GL  DD ILEFG +N+ NF+SLQ+I S V+      + +TV+R  G + +L L P  + G
Sbjct:   150 GLQVDDEILEFGSVNTQNFQSLQNIGSVVQHSEGKPLNVTVMRR-GEKHQLRLVPTRWAG 208

Query:    81 QGLVGCYFLNVE 92
             +GL+GC  + ++
Sbjct:   209 KGLLGCNIIPLQ 220


GO:0070682 "proteasome regulatory particle assembly" evidence=ISS
UNIPROTKB|O00233 PSMD9 "26S proteasome non-ATPase regulatory subunit 9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1914401 Psmd9 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 9" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621110 Psmd9 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 9" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
TAIR|locus:2174453 AT5G57950 "AT5G57950" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
SGD|S000001269 NAS2 "Proteasome-interacting protein" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|Q10920 C44B7.1 "Probable 26S proteasome non-ATPase regulatory subunit 9" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
CGD|CAL0000640 orf19.2301 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q59WK1 CaO19.1014 "Putative uncharacterized protein" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
FB|FBgn0038166 CG9588 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 96
KOG3129|consensus231 99.75
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 99.48
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 99.36
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 99.36
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 99.3
TIGR02860 402 spore_IV_B stage IV sporulation protein B. SpoIVB, 99.29
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 99.29
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 99.29
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 99.28
PRK10779 449 zinc metallopeptidase RseP; Provisional 99.24
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 99.14
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 99.14
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 99.05
PRK10139455 serine endoprotease; Provisional 99.01
TIGR01713259 typeII_sec_gspC general secretion pathway protein 98.99
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.98
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 98.98
PRK10898353 serine endoprotease; Provisional 98.97
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 98.93
PLN00049 389 carboxyl-terminal processing protease; Provisional 98.93
PRK10779 449 zinc metallopeptidase RseP; Provisional 98.93
PRK10139455 serine endoprotease; Provisional 98.9
TIGR00225 334 prc C-terminal peptidase (prc). A C-terminal pepti 98.88
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 98.83
PRK10942473 serine endoprotease; Provisional 98.82
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 98.8
PRK10942473 serine endoprotease; Provisional 98.75
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 98.62
COG0793 406 Prc Periplasmic protease [Cell envelope biogenesis 98.6
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 98.6
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 98.53
PRK11186 667 carboxy-terminal protease; Provisional 98.45
PRK09681276 putative type II secretion protein GspC; Provision 98.39
COG0265347 DegQ Trypsin-like serine proteases, typically peri 98.22
COG3480 342 SdrC Predicted secreted protein containing a PDZ d 98.18
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 98.18
KOG1421|consensus 955 97.85
KOG3834|consensus 462 97.74
COG0750 375 Predicted membrane-associated Zn-dependent proteas 97.49
KOG3553|consensus124 97.45
KOG3209|consensus 984 97.36
KOG3834|consensus 462 97.33
COG3975558 Predicted protease with the C-terminal PDZ domain 97.3
COG3031275 PulC Type II secretory pathway, component PulC [In 97.29
KOG3580|consensus 1027 97.02
KOG1320|consensus473 96.9
KOG3580|consensus 1027 96.84
KOG3651|consensus 429 95.75
KOG3605|consensus829 95.6
PF1281278 PDZ_1: PDZ-like domain 95.24
KOG3209|consensus984 95.22
KOG3532|consensus 1051 95.11
KOG3550|consensus207 94.35
KOG1421|consensus 955 94.32
KOG3542|consensus 1283 93.52
KOG3552|consensus 1298 93.45
KOG0606|consensus 1205 93.01
KOG3551|consensus 506 92.49
KOG0609|consensus 542 90.86
KOG3606|consensus358 90.18
KOG3571|consensus 626 89.74
KOG1892|consensus 1629 89.43
KOG2921|consensus 484 88.89
KOG3549|consensus 505 83.95
>KOG3129|consensus Back     alignment and domain information
Probab=99.75  E-value=4.3e-18  Score=120.47  Aligned_cols=79  Identities=35%  Similarity=0.647  Sum_probs=69.3

Q ss_pred             CCCCccccccccCCCCCCEEEEECCeecCCcccHHHHHHHHHhCCCceEEEEEEeCCceEEEEEEeecCCCCeeeEEEE-
Q psy12583          9 EGYPRQDVDVYQGLVKDDIILEFGPINSSNFKSLQDIASTVRAGVNTDIPITVLRNEGTRQRLVLRPQPFEGQGLVGCY-   87 (96)
Q Consensus         9 ~~~pa~~~~~~aGLk~GD~Il~vng~~~~~~~~~~di~~~i~~~~g~~i~l~V~R~g~~~~~l~v~p~~~~~~~~lGi~-   87 (96)
                      ++|||+    +|||+.||.|++|+++...+...+..+....+.+.++++.++|.|.+ +.+.+.++|..|.|+|+|||. 
T Consensus       148 ~~SPA~----~aGl~~gD~il~fGnV~sgn~~~lq~i~~~v~~~e~~~v~v~v~R~g-~~v~L~ltP~~W~GrGLLGC~~  222 (231)
T KOG3129|consen  148 PGSPAD----EAGLCVGDEILKFGNVHSGNFLPLQNIAAVVQSNEDQIVSVTVIREG-QKVVLSLTPKKWQGRGLLGCNY  222 (231)
T ss_pred             CCChhh----hhCcccCceEEEecccccccchhHHHHHHHHHhccCcceeEEEecCC-CEEEEEeCcccccCCcceeeee
Confidence            444555    55999999999999988777777889999999999999999999999 999999999999999999999 


Q ss_pred             Eecce
Q psy12583         88 FLNVE   92 (96)
Q Consensus        88 ~~~~~   92 (96)
                      +.|+.
T Consensus       223 i~pi~  227 (231)
T KOG3129|consen  223 IQPIL  227 (231)
T ss_pred             ecccc
Confidence            55543



>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>KOG3550|consensus Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>KOG2921|consensus Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query96
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 99.65
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 99.59
2kl1_A94 YLBL protein; structure genomics, structural genom 99.55
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 99.54
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 99.43
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 99.41
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 99.38
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 99.37
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 99.35
2hga_A125 Conserved protein MTH1368; GFT structural genomics 99.35
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 99.33
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 99.31
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 99.3
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 99.29
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 99.27
2awx_A105 Synapse associated protein 97; membrane protein, s 99.26
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 99.26
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 99.25
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.24
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 99.24
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 99.23
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.23
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 99.23
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.22
2eaq_A90 LIM domain only protein 7; conserved hypothetical 99.22
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 99.21
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 99.2
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.2
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 99.19
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 99.19
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 99.18
2eeh_A100 PDZ domain-containing protein 7; structural genomi 99.18
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 99.17
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.17
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 99.17
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 99.17
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 99.17
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 99.17
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.16
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.16
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.14
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.14
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 99.13
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 99.13
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 99.12
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 99.11
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 99.11
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 99.11
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.11
3khf_A99 Microtubule-associated serine/threonine-protein ki 99.11
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.11
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 99.11
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 99.11
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 99.11
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.11
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 99.11
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 99.11
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 99.11
2d90_A102 PDZ domain containing protein 1; structural genomi 99.11
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 99.1
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 99.1
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 99.1
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.1
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 99.1
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 99.09
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.09
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 99.09
2o2t_A117 Multiple PDZ domain protein; structural protein, s 99.09
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 99.09
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.09
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 99.09
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 99.08
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 99.08
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.08
2djt_A104 Unnamed protein product; PDZ domain, structural ge 99.08
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.07
2ego_A96 General receptor for phosphoinositides 1- associat 99.07
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.07
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 99.07
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.07
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 99.07
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.07
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 99.06
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.06
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 99.06
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 99.06
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 99.06
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 99.05
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 99.05
2fne_A117 Multiple PDZ domain protein; structural protein, s 99.05
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 99.05
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 99.05
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 99.05
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 99.04
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 99.04
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.04
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.04
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 99.04
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 99.04
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 99.03
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.03
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 99.03
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 99.03
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 99.03
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 99.03
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 99.02
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 99.02
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 99.02
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 99.02
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 99.01
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 99.01
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 99.01
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 99.01
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.0
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 99.0
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 99.0
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 99.0
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.0
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 98.99
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 98.99
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 98.99
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 98.99
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 98.99
2byg_A117 Channel associated protein of synapse-110; DLG2, P 98.98
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 98.98
4fgm_A597 Aminopeptidase N family protein; structural genomi 98.98
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 98.98
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 98.97
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 98.96
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 98.96
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 98.95
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 98.95
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 98.94
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 98.94
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 98.94
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 98.94
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 98.94
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 98.94
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 98.94
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 98.94
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.94
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 98.93
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 98.93
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 98.93
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 98.93
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 98.92
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 98.92
3k1r_A192 Harmonin; protein-protein complex, alternative spl 98.92
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 98.92
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 98.92
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 98.92
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 98.91
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 98.91
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 98.91
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 98.91
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 98.91
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 98.91
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 98.9
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 98.89
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 98.89
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 98.89
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 98.89
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 98.89
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 98.89
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 98.88
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 98.88
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 98.88
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 98.88
2eei_A106 PDZ domain-containing protein 1; regulatory factor 98.87
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 98.87
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 98.87
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 98.87
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 98.86
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 98.85
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 98.85
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 98.84
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 98.84
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 98.83
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 98.83
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 98.81
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 98.77
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.76
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 98.76
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 98.75
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 98.71
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 98.68
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 98.68
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 98.67
3k50_A 403 Putative S41 protease; structural genomics, joint 98.61
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 98.6
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 98.6
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 98.02
1k32_A 1045 Tricorn protease; protein degradation, substrate g 98.57
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 98.56
4fln_A 539 Protease DO-like 2, chloroplastic; protease, DEG, 98.4
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 98.38
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 98.23
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 98.15
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 98.1
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 97.89
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 97.18
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
Probab=99.65  E-value=1.9e-15  Score=94.37  Aligned_cols=80  Identities=16%  Similarity=0.220  Sum_probs=67.2

Q ss_pred             CCCCCccccccccCCCCCCEEEEECCeecCCcccHHHHHHHHHhC-CCceEEEEEEeCCceEEEEEEeecC--CCCeeeE
Q psy12583          8 SEGYPRQDVDVYQGLVKDDIILEFGPINSSNFKSLQDIASTVRAG-VNTDIPITVLRNEGTRQRLVLRPQP--FEGQGLV   84 (96)
Q Consensus         8 ~~~~pa~~~~~~aGLk~GD~Il~vng~~~~~~~~~~di~~~i~~~-~g~~i~l~V~R~g~~~~~l~v~p~~--~~~~~~l   84 (96)
                      .++|||+    + ||++||+|++|||.+   +.+|.++..+++.. ++.++.++|.|++ +..++++++..  ..+++.|
T Consensus        15 ~~~spA~----~-GL~~GD~I~~Ing~~---v~~~~dl~~~l~~~~~g~~v~l~v~R~g-~~~~~~v~~~~~~~~~~~~i   85 (100)
T 3i18_A           15 KDDVPAA----D-VLHAGDLITEIDGNA---FKSSQEFIDYIHSKKVGDTVKINYKHGD-KNEQADIKLTAIDKKGTPGI   85 (100)
T ss_dssp             CTTSGGG----G-TCCTTCEEEEETTBC---CSSHHHHHHHHHTSCTTCEEEEEEEETT-EEEEEEEECEECSTTCCEEC
T ss_pred             CCCCchH----H-CCCCCCEEEEECCEE---CCCHHHHHHHHHhCCCCCEEEEEEEECC-EEEEEEEEEecCCCCCCcEE
Confidence            4789999    7 999999999999955   68899999999874 6889999999999 98888888864  3468899


Q ss_pred             EEEEecceeecC
Q psy12583         85 GCYFLNVENVER   96 (96)
Q Consensus        85 Gi~~~~~~~~~~   96 (96)
                      |+.+.+...-|+
T Consensus        86 Gi~~~~~~~~~~   97 (100)
T 3i18_A           86 GITLVDDLEHHH   97 (100)
T ss_dssp             SEEEGGGC-CCC
T ss_pred             eEEEecCCcccc
Confidence            999988776664



>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query96
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 99.55
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 99.53
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 99.44
d1fc6a392 Photosystem II D1 C-terminal processing protease { 99.41
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 99.4
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 99.4
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 99.38
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 99.34
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 99.33
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.1
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.07
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.06
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.02
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.0
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 98.99
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 98.98
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 98.98
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 98.96
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 98.94
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 98.93
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 98.92
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 98.9
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 98.9
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 98.89
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 98.88
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 98.87
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 98.84
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 98.84
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 98.83
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.83
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 98.82
d1y7na179 Amyloid beta A4 precursor protein-binding family A 98.81
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 98.79
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 98.79
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 98.78
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 98.78
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 98.76
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 98.76
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 98.75
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 98.75
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 98.74
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 98.74
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 98.74
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 98.71
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 98.7
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 98.69
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 98.69
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 98.68
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 98.68
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 98.67
d1rzxa_98 GTPase-binding domain of the cell polarity protein 98.67
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 98.65
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 98.65
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 98.65
d1x45a185 Amyloid beta A4 precursor protein-binding family A 98.65
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 98.64
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 98.63
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 98.61
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 98.6
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 98.6
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 98.56
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 98.56
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 98.54
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 98.54
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 98.53
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 98.52
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 98.5
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 98.49
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 98.48
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 98.31
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: MTH1368 C-terminal domain-like
domain: Uncharacterized protein MTH1368
species: Methanobacterium thermoautotrophicum [TaxId: 145262]
Probab=99.55  E-value=3.3e-15  Score=92.93  Aligned_cols=73  Identities=16%  Similarity=0.156  Sum_probs=61.2

Q ss_pred             CCCCCccccccccCCCCCCEEEEECCeecCCcccHHHHHHHHHhC-CCceEEEEEEeCCceEEEEEEeecCCCCeeeEEE
Q psy12583          8 SEGYPRQDVDVYQGLVKDDIILEFGPINSSNFKSLQDIASTVRAG-VNTDIPITVLRNEGTRQRLVLRPQPFEGQGLVGC   86 (96)
Q Consensus         8 ~~~~pa~~~~~~aGLk~GD~Il~vng~~~~~~~~~~di~~~i~~~-~g~~i~l~V~R~g~~~~~l~v~p~~~~~~~~lGi   86 (96)
                      .+||||+    ++ |++||+|++|||.+   +.+|.++..+|+.+ +|+.++|+|+|++ ..+++...|.. .+.+++|+
T Consensus        11 ~~~sPA~----~~-L~~GD~I~~ing~~---v~~~~~l~~~i~~~~~G~~v~l~v~R~~-~~~~l~~~p~~-~~~~~iGi   80 (103)
T d2hgaa1          11 VPGSPAS----KV-LTPGLVIESINGMP---TSNLTTYSAALKTISVGEVINITTDQGT-FHLKTGRNPNN-SSRAYMGI   80 (103)
T ss_dssp             CSSSGGG----GT-SCTTCEEEEETTEE---CSSHHHHHHHHTTCCTTCEEEEEETTEE-EEEECCBCSSS-CCSCBCCE
T ss_pred             CCCChHH----hc-CCCCCEEEEECCEE---cCCHHHHHHHHhhCCCCCEEEEEEEECC-EEEEEEeccCC-CCceEEEE
Confidence            5799999    75 99999999999966   58899999999875 6999999999998 77777666653 56788999


Q ss_pred             EEec
Q psy12583         87 YFLN   90 (96)
Q Consensus        87 ~~~~   90 (96)
                      .+..
T Consensus        81 ~~~~   84 (103)
T d2hgaa1          81 RTSN   84 (103)
T ss_dssp             EEEC
T ss_pred             Eecc
Confidence            8763



>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure