Psyllid ID: psy12591
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 144 | ||||||
| 383855430 | 2033 | PREDICTED: uncharacterized protein LOC10 | 0.736 | 0.052 | 0.886 | 5e-49 | |
| 442622906 | 1472 | mangetout, isoform G [Drosophila melanog | 0.736 | 0.072 | 0.858 | 1e-48 | |
| 221330059 | 1248 | mangetout, isoform F [Drosophila melanog | 0.736 | 0.084 | 0.858 | 1e-48 | |
| 221330057 | 1095 | mangetout, isoform E [Drosophila melanog | 0.736 | 0.096 | 0.858 | 1e-48 | |
| 221330055 | 1415 | mangetout, isoform D [Drosophila melanog | 0.736 | 0.074 | 0.858 | 1e-48 | |
| 195332500 | 1292 | GM20683 [Drosophila sechellia] gi|194124 | 0.736 | 0.082 | 0.858 | 1e-48 | |
| 194863463 | 1259 | GG10638 [Drosophila erecta] gi|190662320 | 0.736 | 0.084 | 0.858 | 1e-48 | |
| 42538965 | 1073 | metabotropic X receptor [Drosophila mela | 0.736 | 0.098 | 0.858 | 1e-48 | |
| 195474735 | 1306 | GE22975 [Drosophila yakuba] gi|194175746 | 0.736 | 0.081 | 0.858 | 2e-48 | |
| 194753055 | 1293 | GF12584 [Drosophila ananassae] gi|190620 | 0.736 | 0.081 | 0.858 | 2e-48 |
| >gi|383855430|ref|XP_003703215.1| PREDICTED: uncharacterized protein LOC100881789 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Score = 198 bits (504), Expect = 5e-49, Method: Composition-based stats.
Identities = 94/106 (88%), Positives = 102/106 (96%)
Query: 1 VSFWSTSPELSNKQRFEYFTRTIPSDHHQVKAMVEIVKKLGWSYVSIIYEESNYGVKAFE 60
VSF+STSPELSNKQRFEYFTRTIPSDH+QVKAM++IV K+GWSYVSIIYEESNYG+KAFE
Sbjct: 1225 VSFFSTSPELSNKQRFEYFTRTIPSDHYQVKAMIDIVLKMGWSYVSIIYEESNYGIKAFE 1284
Query: 61 ELEVLLAKYSICIAIKEKLVKDSGVAEETAYDDIVLKLLTKPRARG 106
ELE LL K+ ICIAIKEKLVKDSGVAEETAYD+IVLKLLTKPRARG
Sbjct: 1285 ELEELLGKHDICIAIKEKLVKDSGVAEETAYDNIVLKLLTKPRARG 1330
|
Source: Megachile rotundata Species: Megachile rotundata Genus: Megachile Family: Megachilidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|442622906|ref|NP_001260806.1| mangetout, isoform G [Drosophila melanogaster] gi|440214203|gb|AGB93339.1| mangetout, isoform G [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|221330059|ref|NP_724683.2| mangetout, isoform F [Drosophila melanogaster] gi|220902130|gb|AAF59082.3| mangetout, isoform F [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|221330057|ref|NP_610386.2| mangetout, isoform E [Drosophila melanogaster] gi|220902129|gb|AAF59081.3| mangetout, isoform E [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|221330055|ref|NP_001137619.1| mangetout, isoform D [Drosophila melanogaster] gi|220902128|gb|ACL83073.1| mangetout, isoform D [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195332500|ref|XP_002032935.1| GM20683 [Drosophila sechellia] gi|194124905|gb|EDW46948.1| GM20683 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|194863463|ref|XP_001970453.1| GG10638 [Drosophila erecta] gi|190662320|gb|EDV59512.1| GG10638 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|42538965|emb|CAE46392.1| metabotropic X receptor [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195474735|ref|XP_002089645.1| GE22975 [Drosophila yakuba] gi|194175746|gb|EDW89357.1| GE22975 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|194753055|ref|XP_001958834.1| GF12584 [Drosophila ananassae] gi|190620132|gb|EDV35656.1| GF12584 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 144 | ||||||
| FB|FBgn0050361 | 1415 | mtt "mangetout" [Drosophila me | 0.736 | 0.074 | 0.858 | 1e-43 | |
| UNIPROTKB|Q2PNZ6 | 535 | GRM3 "Metabotropic glutamate r | 0.708 | 0.190 | 0.419 | 2.8e-18 | |
| UNIPROTKB|G5E9K2 | 537 | GRM3 "Glutamate receptor, meta | 0.708 | 0.189 | 0.419 | 2.9e-18 | |
| UNIPROTKB|F5GYZ2 | 751 | GRM3 "Metabotropic glutamate r | 0.708 | 0.135 | 0.419 | 7.8e-18 | |
| UNIPROTKB|C9J2I2 | 171 | GRM3 "Metabotropic glutamate r | 0.708 | 0.596 | 0.419 | 9.5e-18 | |
| UNIPROTKB|E1BUE5 | 879 | GRM3 "Uncharacterized protein" | 0.708 | 0.116 | 0.419 | 1e-17 | |
| MGI|MGI:1351340 | 879 | Grm3 "glutamate receptor, meta | 0.708 | 0.116 | 0.419 | 1.3e-17 | |
| UNIPROTKB|Q14832 | 879 | GRM3 "Metabotropic glutamate r | 0.708 | 0.116 | 0.419 | 1.3e-17 | |
| UNIPROTKB|A5D7D8 | 879 | GRM3 "GRM3 protein" [Bos tauru | 0.708 | 0.116 | 0.419 | 1.6e-17 | |
| RGD|2744 | 879 | Grm3 "glutamate receptor, meta | 0.708 | 0.116 | 0.419 | 1.6e-17 |
| FB|FBgn0050361 mtt "mangetout" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 474 (171.9 bits), Expect = 1.0e-43, P = 1.0e-43
Identities = 91/106 (85%), Positives = 103/106 (97%)
Query: 1 VSFWSTSPELSNKQRFEYFTRTIPSDHHQVKAMVEIVKKLGWSYVSIIYEESNYGVKAFE 60
VS++STSPELSNKQRFEYF+RTIPSDH+QVKAMVEIVK++GWSYVSIIYEESNYG+KAFE
Sbjct: 517 VSYFSTSPELSNKQRFEYFSRTIPSDHYQVKAMVEIVKRMGWSYVSIIYEESNYGIKAFE 576
Query: 61 ELEVLLAKYSICIAIKEKLVKDSGVAEETAYDDIVLKLLTKPRARG 106
ELE LLA+++ICIAIKEKLVKDSGVAE+ AYD+IV KLLTKPRARG
Sbjct: 577 ELEELLARHNICIAIKEKLVKDSGVAEDIAYDNIVQKLLTKPRARG 622
|
|
| UNIPROTKB|Q2PNZ6 GRM3 "Metabotropic glutamate receptor 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G5E9K2 GRM3 "Glutamate receptor, metabotropic 3, isoform CRA_a" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F5GYZ2 GRM3 "Metabotropic glutamate receptor 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9J2I2 GRM3 "Metabotropic glutamate receptor 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BUE5 GRM3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1351340 Grm3 "glutamate receptor, metabotropic 3" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q14832 GRM3 "Metabotropic glutamate receptor 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A5D7D8 GRM3 "GRM3 protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|2744 Grm3 "glutamate receptor, metabotropic 3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 144 | |||
| cd06362 | 452 | cd06362, PBP1_mGluR, Ligand binding domain of the | 1e-46 | |
| cd06350 | 348 | cd06350, PBP1_GPCR_family_C_like, Ligand-binding d | 7e-29 | |
| cd06375 | 458 | cd06375, PBP1_mGluR_groupII, Ligand binding domain | 9e-28 | |
| cd06374 | 472 | cd06374, PBP1_mGluR_groupI, Ligand binding domain | 1e-26 | |
| cd06269 | 298 | cd06269, PBP1_glutamate_receptors_like, Family C G | 6e-23 | |
| cd06376 | 463 | cd06376, PBP1_mGluR_groupIII, Ligand-binding domai | 4e-22 | |
| pfam01094 | 343 | pfam01094, ANF_receptor, Receptor family ligand bi | 7e-22 | |
| cd06363 | 410 | cd06363, PBP1_Taste_receptor, Ligand-binding domai | 5e-19 | |
| cd06366 | 350 | cd06366, PBP1_GABAb_receptor, Ligand-binding domai | 9e-19 | |
| cd06361 | 403 | cd06361, PBP1_GPC6A_like, Ligand-binding domain of | 2e-18 | |
| cd04509 | 299 | cd04509, PBP1_ABC_transporter_GCPR_C_like, Family | 5e-14 | |
| cd06364 | 510 | cd06364, PBP1_CaSR, Ligand-binding domain of the C | 6e-13 | |
| cd06346 | 312 | cd06346, PBP1_ABC_ligand_binding_like_11, Type I p | 2e-10 | |
| cd06352 | 389 | cd06352, PBP1_NPR_GC_like, Ligand-binding domain o | 1e-08 | |
| cd01391 | 269 | cd01391, Periplasmic_Binding_Protein_Type_1, Type | 1e-08 | |
| cd06365 | 469 | cd06365, PBP1_Pheromone_receptor, Ligand-binding d | 1e-06 | |
| cd06268 | 298 | cd06268, PBP1_ABC_transporter_LIVBP_like, Periplas | 2e-06 | |
| cd06370 | 404 | cd06370, PBP1_Speract_GC_like, Ligand-binding doma | 2e-05 | |
| cd06351 | 328 | cd06351, PBP1_iGluR_N_LIVBP_like, N-terminal leuci | 6e-05 | |
| cd06340 | 347 | cd06340, PBP1_ABC_ligand_binding_like_6, Type I pe | 1e-04 | |
| cd06344 | 332 | cd06344, PBP1_ABC_ligand_binding_like_9, Type I pe | 1e-04 | |
| COG0683 | 366 | COG0683, LivK, ABC-type branched-chain amino acid | 9e-04 |
| >gnl|CDD|107357 cd06362, PBP1_mGluR, Ligand binding domain of the metabotropic glutamate receptors (mGluR) | Back alignment and domain information |
|---|
Score = 156 bits (397), Expect = 1e-46
Identities = 55/110 (50%), Positives = 72/110 (65%), Gaps = 5/110 (4%)
Query: 1 VSFWSTSPELSNKQRFEYFTRTIPSDHHQVKAMVEIVKKLGWSYVSIIYEESNYGVKAFE 60
+S+ STSPELS+K R++YF+RT+P D Q +AMV+IVK W+YVS + E NYG K E
Sbjct: 131 ISYASTSPELSDKTRYDYFSRTVPPDSFQAQAMVDIVKAFNWTYVSTVASEGNYGEKGIE 190
Query: 61 ELEVLLAKYSICIAIKEKLVKDSGVAEETAYDDIVLKLLTKPRARG--LF 108
E L A+ ICIA EK+ A E +D+I+ KLL+KP AR LF
Sbjct: 191 AFEKLAAERGICIAGSEKIPSS---ATEEEFDNIIRKLLSKPNARVVVLF 237
|
Ligand binding domain of the metabotropic glutamate receptors (mGluR), which are members of the family C of G-protein-coupled receptors that transduce extracellular signals into G-protein activation and ultimately into cellular responses. mGluRs bind to glutamate and function as an excitatory neurotransmitter; they are involved in learning, memory, anxiety, and the perception of pain. Eight subtypes of mGluRs have been cloned so far, and are classified into three groups according to their sequence similarities, transduction mechanisms, and pharmacological profiles. Group I is composed of mGlu1R and mGlu5R that both stimulate PLC hydrolysis. Group II includes mGlu2R and mGlu3R, which inhibit adenylyl cyclase, as do mGlu4R, mGlu6R, mGlu7R, and mGlu8R, which form group III. Length = 452 |
| >gnl|CDD|153138 cd06350, PBP1_GPCR_family_C_like, Ligand-binding domain of membrane-bound glutamate receptors that mediate excitatory transmission on the cellular surface through initial binding of glutamate and are categorized into ionotropic glutamate receptors (iGluRs) and metabotropic glutamate receptors (mGluRs) | Back alignment and domain information |
|---|
| >gnl|CDD|107370 cd06375, PBP1_mGluR_groupII, Ligand binding domain of the group II metabotropic glutamate receptor | Back alignment and domain information |
|---|
| >gnl|CDD|107369 cd06374, PBP1_mGluR_groupI, Ligand binding domain of the group I metabotropic glutamate receptor | Back alignment and domain information |
|---|
| >gnl|CDD|153137 cd06269, PBP1_glutamate_receptors_like, Family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein (LIVBP)-like domain of the ionotropic glutamate receptors | Back alignment and domain information |
|---|
| >gnl|CDD|107371 cd06376, PBP1_mGluR_groupIII, Ligand-binding domain of the group III metabotropic glutamate receptor | Back alignment and domain information |
|---|
| >gnl|CDD|216296 pfam01094, ANF_receptor, Receptor family ligand binding region | Back alignment and domain information |
|---|
| >gnl|CDD|107358 cd06363, PBP1_Taste_receptor, Ligand-binding domain of the T1R taste receptor | Back alignment and domain information |
|---|
| >gnl|CDD|107361 cd06366, PBP1_GABAb_receptor, Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA) | Back alignment and domain information |
|---|
| >gnl|CDD|107356 cd06361, PBP1_GPC6A_like, Ligand-binding domain of the promiscuous L-alpha-amino acid receptor GPRC6A which is a broad-spectrum amino acid-sensing receptor | Back alignment and domain information |
|---|
| >gnl|CDD|107261 cd04509, PBP1_ABC_transporter_GCPR_C_like, Family C of G-protein coupled receptors and their close homologs, the type I periplasmic-binding proteins of ATP-binding cassette transporter-like systems | Back alignment and domain information |
|---|
| >gnl|CDD|107359 cd06364, PBP1_CaSR, Ligand-binding domain of the CaSR calcium-sensing receptor, which is a member of the family C receptors within the G-protein coupled receptor superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|107341 cd06346, PBP1_ABC_ligand_binding_like_11, Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >gnl|CDD|107347 cd06352, PBP1_NPR_GC_like, Ligand-binding domain of membrane guanylyl-cyclase receptors | Back alignment and domain information |
|---|
| >gnl|CDD|107248 cd01391, Periplasmic_Binding_Protein_Type_1, Type 1 periplasmic binding fold superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|107360 cd06365, PBP1_Pheromone_receptor, Ligand-binding domain of the V2R phermone receptor, a member of the family C receptors within the G-protein coupled receptor superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|107263 cd06268, PBP1_ABC_transporter_LIVBP_like, Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|107365 cd06370, PBP1_Speract_GC_like, Ligand-binding domain of membrane bound guanylyl cyclases | Back alignment and domain information |
|---|
| >gnl|CDD|107346 cd06351, PBP1_iGluR_N_LIVBP_like, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NMDA, AMPA, and kainate receptor subtypes of ionotropic glutamate receptors (iGluRs) | Back alignment and domain information |
|---|
| >gnl|CDD|107335 cd06340, PBP1_ABC_ligand_binding_like_6, Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >gnl|CDD|107339 cd06344, PBP1_ABC_ligand_binding_like_9, Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >gnl|CDD|223755 COG0683, LivK, ABC-type branched-chain amino acid transport systems, periplasmic component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 144 | |||
| cd06375 | 458 | PBP1_mGluR_groupII Ligand binding domain of the gr | 99.9 | |
| cd06365 | 469 | PBP1_Pheromone_receptor Ligand-binding domain of t | 99.9 | |
| cd06361 | 403 | PBP1_GPC6A_like Ligand-binding domain of the promi | 99.9 | |
| KOG1056|consensus | 878 | 99.88 | ||
| cd06364 | 510 | PBP1_CaSR Ligand-binding domain of the CaSR calciu | 99.87 | |
| cd06374 | 472 | PBP1_mGluR_groupI Ligand binding domain of the gro | 99.86 | |
| cd06379 | 377 | PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/ | 99.84 | |
| cd06362 | 452 | PBP1_mGluR Ligand binding domain of the metabotrop | 99.84 | |
| cd06376 | 463 | PBP1_mGluR_groupIII Ligand-binding domain of the g | 99.83 | |
| cd06367 | 362 | PBP1_iGluR_NMDA N-terminal leucine/isoleucine/vali | 99.81 | |
| cd06350 | 348 | PBP1_GPCR_family_C_like Ligand-binding domain of m | 99.79 | |
| cd06371 | 382 | PBP1_sensory_GC_DEF_like Ligand-binding domain of | 99.77 | |
| cd06363 | 410 | PBP1_Taste_receptor Ligand-binding domain of the T | 99.77 | |
| cd06386 | 387 | PBP1_NPR_C_like Ligand-binding domain of type C na | 99.77 | |
| cd06366 | 350 | PBP1_GABAb_receptor Ligand-binding domain of GABAb | 99.75 | |
| cd06370 | 404 | PBP1_Speract_GC_like Ligand-binding domain of memb | 99.72 | |
| cd06269 | 298 | PBP1_glutamate_receptors_like Family C G-protein c | 99.72 | |
| cd06385 | 405 | PBP1_NPR_A Ligand-binding domain of type A natriur | 99.71 | |
| cd06378 | 362 | PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/ | 99.69 | |
| PF01094 | 348 | ANF_receptor: Receptor family ligand binding regio | 99.68 | |
| cd06373 | 396 | PBP1_NPR_like Ligand binding domain of natriuretic | 99.66 | |
| cd06384 | 399 | PBP1_NPR_B Ligand-binding domain of type B natriur | 99.66 | |
| cd06346 | 312 | PBP1_ABC_ligand_binding_like_11 Type I periplasmic | 99.66 | |
| cd06352 | 389 | PBP1_NPR_GC_like Ligand-binding domain of membrane | 99.63 | |
| cd06372 | 391 | PBP1_GC_G_like Ligand-binding domain of membrane g | 99.59 | |
| cd06338 | 345 | PBP1_ABC_ligand_binding_like_5 Type I periplasmic | 99.55 | |
| cd06345 | 344 | PBP1_ABC_ligand_binding_like_10 Type I periplasmic | 99.52 | |
| cd06393 | 384 | PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isol | 99.51 | |
| cd06342 | 334 | PBP1_ABC_LIVBP_like Type I periplasmic ligand-bind | 99.47 | |
| cd06343 | 362 | PBP1_ABC_ligand_binding_like_8 Type I periplasmic | 99.46 | |
| cd06380 | 382 | PBP1_iGluR_AMPA N-terminal leucine/isoleucine/vali | 99.46 | |
| cd06340 | 347 | PBP1_ABC_ligand_binding_like_6 Type I periplasmic | 99.45 | |
| cd06336 | 347 | PBP1_ABC_ligand_binding_like_3 Type I periplasmic | 99.45 | |
| cd06382 | 327 | PBP1_iGluR_Kainate N-terminal leucine/isoleucine/v | 99.44 | |
| cd06390 | 364 | PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucin | 99.42 | |
| cd06329 | 342 | PBP1_SBP_like_3 Periplasmic solute-binding domain | 99.41 | |
| cd06335 | 347 | PBP1_ABC_ligand_binding_like_2 Type I periplasmic | 99.4 | |
| cd06334 | 351 | PBP1_ABC_ligand_binding_like_1 Type I periplasmic | 99.4 | |
| cd06368 | 324 | PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleu | 99.4 | |
| PRK15404 | 369 | leucine ABC transporter subunit substrate-binding | 99.39 | |
| cd06383 | 368 | PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine | 99.39 | |
| cd04509 | 299 | PBP1_ABC_transporter_GCPR_C_like Family C of G-pro | 99.39 | |
| cd06349 | 340 | PBP1_ABC_ligand_binding_like_14 Type I periplasmic | 99.39 | |
| cd06351 | 328 | PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleuc | 99.39 | |
| cd06327 | 334 | PBP1_SBP_like_1 Periplasmic solute-binding domain | 99.38 | |
| cd06360 | 336 | PBP1_alkylbenzenes_like Type I periplasmic binding | 99.37 | |
| cd06344 | 332 | PBP1_ABC_ligand_binding_like_9 Type I periplasmic | 99.36 | |
| COG0683 | 366 | LivK ABC-type branched-chain amino acid transport | 99.33 | |
| cd06347 | 334 | PBP1_ABC_ligand_binding_like_12 Type I periplasmic | 99.32 | |
| cd06328 | 333 | PBP1_SBP_like_2 Periplasmic solute-binding domain | 99.31 | |
| cd06330 | 346 | PBP1_Arsenic_SBP_like Periplasmic solute-binding d | 99.31 | |
| KOG1055|consensus | 865 | 99.3 | ||
| cd06391 | 400 | PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/v | 99.3 | |
| cd06348 | 344 | PBP1_ABC_ligand_binding_like_13 Type I periplasmic | 99.29 | |
| cd06389 | 370 | PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucin | 99.22 | |
| cd06359 | 333 | PBP1_Nba_like Type I periplasmic binding component | 99.16 | |
| cd06332 | 333 | PBP1_aromatic_compounds_like Type I periplasmic bi | 99.14 | |
| cd06268 | 298 | PBP1_ABC_transporter_LIVBP_like Periplasmic bindin | 99.13 | |
| TIGR03863 | 347 | PQQ_ABC_bind ABC transporter, substrate binding pr | 99.13 | |
| cd06339 | 336 | PBP1_YraM_LppC_lipoprotein_like Periplasmic bindin | 99.13 | |
| cd06333 | 312 | PBP1_ABC-type_HAAT_like Type I periplasmic binding | 99.11 | |
| cd06355 | 348 | PBP1_FmdD_like Periplasmic component (FmdD) of an | 99.11 | |
| cd06331 | 333 | PBP1_AmiC_like Type I periplasmic components of am | 99.09 | |
| cd06326 | 336 | PBP1_STKc_like Type I periplasmic binding domain o | 99.07 | |
| cd06394 | 333 | PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleu | 99.06 | |
| cd06358 | 333 | PBP1_NHase Type I periplasmic-binding protein of t | 99.04 | |
| TIGR03407 | 359 | urea_ABC_UrtA urea ABC transporter, urea binding p | 99.03 | |
| KOG4440|consensus | 993 | 99.02 | ||
| TIGR03669 | 374 | urea_ABC_arch urea ABC transporter, substrate-bind | 98.99 | |
| cd06337 | 357 | PBP1_ABC_ligand_binding_like_4 Type I periplasmic | 98.98 | |
| cd06388 | 371 | PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucin | 98.98 | |
| cd06356 | 334 | PBP1_Amide_Urea_BP_like Periplasmic component (Fmd | 98.97 | |
| PF13458 | 343 | Peripla_BP_6: Periplasmic binding protein; PDB: 4E | 98.96 | |
| cd06387 | 372 | PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucin | 98.89 | |
| cd06392 | 400 | PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/v | 98.79 | |
| cd06341 | 341 | PBP1_ABC_ligand_binding_like_7 Type I periplasmic | 98.68 | |
| cd06357 | 360 | PBP1_AmiC Periplasmic binding domain of amidase (A | 98.64 | |
| cd06381 | 363 | PBP1_iGluR_delta_like N-terminal leucine/isoleucin | 98.59 | |
| cd06377 | 382 | PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/ | 98.51 | |
| cd01391 | 269 | Periplasmic_Binding_Protein_Type_1 Type 1 periplas | 98.51 | |
| PF13433 | 363 | Peripla_BP_5: Periplasmic binding protein domain; | 98.06 | |
| KOG1053|consensus | 1258 | 97.78 | ||
| cd06369 | 380 | PBP1_GC_C_enterotoxin_receptor Ligand-binding doma | 97.42 | |
| KOG1054|consensus | 897 | 97.04 | ||
| TIGR02990 | 239 | ectoine_eutA ectoine utilization protein EutA. Mem | 96.55 | |
| PF04348 | 536 | LppC: LppC putative lipoprotein; InterPro: IPR0074 | 95.14 | |
| cd01537 | 264 | PBP1_Repressors_Sugar_Binding_like Ligand-binding | 95.14 | |
| cd01536 | 267 | PBP1_ABC_sugar_binding_like Periplasmic sugar-bind | 94.86 | |
| PRK09860 | 383 | putative alcohol dehydrogenase; Provisional | 94.74 | |
| cd08192 | 370 | Fe-ADH7 Iron-containing alcohol dehydrogenases-lik | 94.43 | |
| COG1454 | 377 | EutG Alcohol dehydrogenase, class IV [Energy produ | 94.42 | |
| cd08190 | 414 | HOT Hydroxyacid-oxoacid transhydrogenase (HOT) inv | 94.11 | |
| cd08551 | 370 | Fe-ADH iron-containing alcohol dehydrogenases (Fe- | 94.1 | |
| PRK15454 | 395 | ethanol dehydrogenase EutG; Provisional | 93.99 | |
| PRK10624 | 382 | L-1,2-propanediol oxidoreductase; Provisional | 93.9 | |
| cd06325 | 281 | PBP1_ABC_uncharacterized_transporter Type I peripl | 93.66 | |
| cd08193 | 376 | HVD 5-hydroxyvalerate dehydrogenase (HVD) catalyze | 93.65 | |
| PF00465 | 366 | Fe-ADH: Iron-containing alcohol dehydrogenase ; In | 93.46 | |
| cd08189 | 374 | Fe-ADH5 Iron-containing alcohol dehydrogenases-lik | 93.36 | |
| cd06267 | 264 | PBP1_LacI_sugar_binding_like Ligand binding domain | 93.31 | |
| cd08194 | 375 | Fe-ADH6 Iron-containing alcohol dehydrogenases-lik | 93.13 | |
| cd06282 | 266 | PBP1_GntR_like_2 Ligand-binding domain of putative | 92.88 | |
| cd08185 | 380 | Fe-ADH1 Iron-containing alcohol dehydrogenases-lik | 92.66 | |
| TIGR02638 | 379 | lactal_redase lactaldehyde reductase. This clade o | 92.64 | |
| cd08188 | 377 | Fe-ADH4 Iron-containing alcohol dehydrogenases-lik | 92.14 | |
| KOG3857|consensus | 465 | 91.99 | ||
| cd08176 | 377 | LPO Lactadehyde:propanediol oxidoreductase (LPO) c | 91.23 | |
| cd08191 | 386 | HHD 6-hydroxyhexanoate dehydrogenase (HHD) catalyz | 91.11 | |
| cd06300 | 272 | PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-bi | 90.96 | |
| cd08181 | 357 | PPD-like 1,3-propanediol dehydrogenase-like (PPD). | 90.91 | |
| cd08182 | 367 | HEPD Hydroxyethylphosphoate dehydrogenase (HEPD) c | 90.83 | |
| cd08170 | 351 | GlyDH Glycerol dehydrogenases (GlyDH) catalyzes ox | 90.32 | |
| cd08187 | 382 | BDH Butanol dehydrogenase catalyzes the conversion | 90.1 | |
| cd08171 | 345 | GlyDH-like2 Glycerol dehydrogenase-like. Glycerol | 89.36 | |
| PF13685 | 250 | Fe-ADH_2: Iron-containing alcohol dehydrogenase; P | 89.08 | |
| cd07766 | 332 | DHQ_Fe-ADH Dehydroquinate synthase-like (DHQ-like) | 88.77 | |
| cd08186 | 383 | Fe-ADH8 Iron-containing alcohol dehydrogenase. Typ | 88.68 | |
| cd06273 | 268 | PBP1_GntR_like_1 This group includes the ligand-bi | 88.44 | |
| PRK09423 | 366 | gldA glycerol dehydrogenase; Provisional | 87.41 | |
| cd08550 | 349 | GlyDH-like Glycerol_dehydrogenase-like. Families o | 87.01 | |
| cd08183 | 374 | Fe-ADH2 Iron-containing alcohol dehydrogenases-lik | 85.32 | |
| TIGR02667 | 163 | moaB_proteo molybdenum cofactor biosynthesis prote | 85.04 | |
| cd06320 | 275 | PBP1_allose_binding Periplasmic allose-binding dom | 84.8 | |
| cd03364 | 79 | TOPRIM_DnaG_primases TOPRIM_DnaG_primases: The top | 84.5 | |
| cd08179 | 375 | NADPH_BDH NADPH-dependent butanol dehydrogenase in | 84.4 | |
| cd06323 | 268 | PBP1_ribose_binding Periplasmic sugar-binding doma | 84.28 | |
| cd08178 | 398 | AAD_C C-terminal alcohol dehydrogenase domain of t | 83.98 | |
| cd06278 | 266 | PBP1_LacI_like_2 Ligand-binding domain of uncharac | 82.51 | |
| COG2984 | 322 | ABC-type uncharacterized transport system, peripla | 82.48 | |
| cd06353 | 258 | PBP1_BmpA_Med_like Periplasmic binding domain of t | 82.31 | |
| cd08175 | 348 | G1PDH Glycerol-1-phosphate dehydrogenase (G1PDH) c | 82.01 | |
| TIGR01481 | 329 | ccpA catabolite control protein A. Catabolite cont | 81.77 | |
| cd06301 | 272 | PBP1_rhizopine_binding_like Periplasmic binding pr | 81.69 | |
| cd08180 | 332 | PDD 1,3-propanediol dehydrogenase (PPD) catalyzes | 81.41 | |
| cd00886 | 152 | MogA_MoaB MogA_MoaB family. Members of this family | 81.35 | |
| PF13407 | 257 | Peripla_BP_4: Periplasmic binding protein domain; | 80.93 | |
| cd06310 | 273 | PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-bi | 80.7 | |
| PF13607 | 138 | Succ_CoA_lig: Succinyl-CoA ligase like flavodoxin | 80.67 | |
| cd06284 | 267 | PBP1_LacI_like_6 Ligand-binding domain of an uncha | 80.44 |
| >cd06375 PBP1_mGluR_groupII Ligand binding domain of the group II metabotropic glutamate receptor | Back alignment and domain information |
|---|
Probab=99.90 E-value=2.1e-23 Score=168.71 Aligned_cols=138 Identities=34% Similarity=0.551 Sum_probs=118.4
Q ss_pred CcccCCCCCCcCCCCCCceEEecCCchHHHHHHHHHHHhCCCcEEEEEEEeCCcchHHHHHHHHHhhhCceEEEEEeccc
Q psy12591 1 VSFWSTSPELSNKQRFEYFTRTIPSDHHQVKAMVEIVKKLGWSYVSIIYEESNYGVKAFEELEVLLAKYSICIAIKEKLV 80 (144)
Q Consensus 1 Is~~at~~~ls~~~~~p~ffRt~p~d~~~~~a~~~ll~~f~W~~Vaii~~~~~~g~~~~~~~~~~l~~~Gi~V~~~~~~~ 80 (144)
||++++++.|+++.+|||||||.|+|..|+.++++++++|+|+||++|+++++||...++.|.+.+++.|+||+..+.++
T Consensus 133 Is~~sts~~Ls~~~~~~~ffRt~psd~~qa~ai~~ll~~~~W~~Vaii~~~~~yG~~~~~~~~~~~~~~gi~i~~~~~i~ 212 (458)
T cd06375 133 ISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNICIATSEKVG 212 (458)
T ss_pred eeeccCChhhcccccCCCeEEecCCcHHHHHHHHHHHHHCCCeEEEEEEeCchHHHHHHHHHHHHHHHCCeeEEEEEEec
Confidence 68899999999988899999999999999999999999999999999999999999999999999999999999999897
Q ss_pred CCCCCcchhhHHHHHHHHhcCCCceEEEEee-------------------EEeeeCCcchhh-h----hHHHHHHHhcCc
Q psy12591 81 KDSGVAEETAYDDIVLKLLTKPRARGLFKRL-------------------KLVKDSGVAEET-A----YDDIVLKLLTKP 136 (144)
Q Consensus 81 ~~~~~~~~~~~~~~l~~lk~~~~arvii~~~-------------------~~~~~~g~~~~~-~----~~~~~~~~~~~~ 136 (144)
..+ .+.++..+|++|++.+++||||++. .|+..+||.... . -+.++|.+++.|
T Consensus 213 ~~~---~~~d~~~~l~~l~~~~~a~vVvl~~~~~~~~~ll~~a~~~g~~~~wigs~~~~~~~~~~~~~~~~~~G~i~~~~ 289 (458)
T cd06375 213 RSA---DRKSYDSVIRKLLQKPNARVVVLFTRSEDARELLAAAKRLNASFTWVASDGWGAQESIVKGSEDVAEGAITIEL 289 (458)
T ss_pred CCC---CHHHHHHHHHHHhccCCCEEEEEecChHHHHHHHHHHHHcCCcEEEEEeccccccchhhhccchhhceEEEEEe
Confidence 654 3689999999998457899999874 468888886542 2 236777777777
Q ss_pred ccccc
Q psy12591 137 RARAV 141 (144)
Q Consensus 137 ~~~~~ 141 (144)
+..-+
T Consensus 290 ~~~~i 294 (458)
T cd06375 290 ASHPI 294 (458)
T ss_pred ccccc
Confidence 66443
|
Ligand binding domain of the group II metabotropic glutamate receptor, a family that contains mGlu2R and mGlu3R, all of which inhibit adenylyl cyclase. The metabotropic glutamate receptor is a member of the family C of G-protein-coupled receptors that transduce extracellular signals into G-protein activation and ultimately into intracellular responses. The mGluRs are classified into three groups which comprise eight subtypes |
| >cd06365 PBP1_Pheromone_receptor Ligand-binding domain of the V2R phermone receptor, a member of the family C receptors within the G-protein coupled receptor superfamily | Back alignment and domain information |
|---|
| >cd06361 PBP1_GPC6A_like Ligand-binding domain of the promiscuous L-alpha-amino acid receptor GPRC6A which is a broad-spectrum amino acid-sensing receptor | Back alignment and domain information |
|---|
| >KOG1056|consensus | Back alignment and domain information |
|---|
| >cd06364 PBP1_CaSR Ligand-binding domain of the CaSR calcium-sensing receptor, which is a member of the family C receptors within the G-protein coupled receptor superfamily | Back alignment and domain information |
|---|
| >cd06374 PBP1_mGluR_groupI Ligand binding domain of the group I metabotropic glutamate receptor | Back alignment and domain information |
|---|
| >cd06379 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR1, an essential channel-forming subunit of the NMDA receptor | Back alignment and domain information |
|---|
| >cd06362 PBP1_mGluR Ligand binding domain of the metabotropic glutamate receptors (mGluR) | Back alignment and domain information |
|---|
| >cd06376 PBP1_mGluR_groupIII Ligand-binding domain of the group III metabotropic glutamate receptor | Back alignment and domain information |
|---|
| >cd06367 PBP1_iGluR_NMDA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the ionotropic N-methyl-d-asparate (NMDA) subtype of glutamate receptors | Back alignment and domain information |
|---|
| >cd06350 PBP1_GPCR_family_C_like Ligand-binding domain of membrane-bound glutamate receptors that mediate excitatory transmission on the cellular surface through initial binding of glutamate and are categorized into ionotropic glutamate receptors (iGluRs) and metabotropic glutamate receptors (mGluRs) | Back alignment and domain information |
|---|
| >cd06371 PBP1_sensory_GC_DEF_like Ligand-binding domain of membrane guanylyl cyclases (GC-D, GC-E, and GC-F) that are specifically expressed in sensory tissues | Back alignment and domain information |
|---|
| >cd06363 PBP1_Taste_receptor Ligand-binding domain of the T1R taste receptor | Back alignment and domain information |
|---|
| >cd06386 PBP1_NPR_C_like Ligand-binding domain of type C natriuretic peptide receptor | Back alignment and domain information |
|---|
| >cd06366 PBP1_GABAb_receptor Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA) | Back alignment and domain information |
|---|
| >cd06370 PBP1_Speract_GC_like Ligand-binding domain of membrane bound guanylyl cyclases | Back alignment and domain information |
|---|
| >cd06269 PBP1_glutamate_receptors_like Family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein (LIVBP)-like domain of the ionotropic glutamate receptors | Back alignment and domain information |
|---|
| >cd06385 PBP1_NPR_A Ligand-binding domain of type A natriuretic peptide receptor | Back alignment and domain information |
|---|
| >cd06378 PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR2 subunit of NMDA receptor family | Back alignment and domain information |
|---|
| >PF01094 ANF_receptor: Receptor family ligand binding region The Prosite family is a sub-family of the Pfam family; InterPro: IPR001828 This describes a ligand binding domain and includes extracellular ligand binding domains of a wide range of receptors, as well as the bacterial amino acid binding proteins of known structure [] | Back alignment and domain information |
|---|
| >cd06373 PBP1_NPR_like Ligand binding domain of natriuretic peptide receptor (NPR) family | Back alignment and domain information |
|---|
| >cd06384 PBP1_NPR_B Ligand-binding domain of type B natriuretic peptide receptor | Back alignment and domain information |
|---|
| >cd06346 PBP1_ABC_ligand_binding_like_11 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >cd06352 PBP1_NPR_GC_like Ligand-binding domain of membrane guanylyl-cyclase receptors | Back alignment and domain information |
|---|
| >cd06372 PBP1_GC_G_like Ligand-binding domain of membrane guanylyl cyclase G | Back alignment and domain information |
|---|
| >cd06338 PBP1_ABC_ligand_binding_like_5 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >cd06345 PBP1_ABC_ligand_binding_like_10 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >cd06393 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR5-7 subunits of Kainate receptor | Back alignment and domain information |
|---|
| >cd06342 PBP1_ABC_LIVBP_like Type I periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems that are involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine) | Back alignment and domain information |
|---|
| >cd06343 PBP1_ABC_ligand_binding_like_8 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >cd06380 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the AMPA receptor | Back alignment and domain information |
|---|
| >cd06340 PBP1_ABC_ligand_binding_like_6 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >cd06336 PBP1_ABC_ligand_binding_like_3 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >cd06382 PBP1_iGluR_Kainate N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors | Back alignment and domain information |
|---|
| >cd06390 PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR1 subunit of the AMPA receptor | Back alignment and domain information |
|---|
| >cd06329 PBP1_SBP_like_3 Periplasmic solute-binding domain of active transport proteins | Back alignment and domain information |
|---|
| >cd06335 PBP1_ABC_ligand_binding_like_2 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >cd06334 PBP1_ABC_ligand_binding_like_1 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >cd06368 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors | Back alignment and domain information |
|---|
| >PRK15404 leucine ABC transporter subunit substrate-binding protein LivK; Provisional | Back alignment and domain information |
|---|
| >cd06383 PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors | Back alignment and domain information |
|---|
| >cd04509 PBP1_ABC_transporter_GCPR_C_like Family C of G-protein coupled receptors and their close homologs, the type I periplasmic-binding proteins of ATP-binding cassette transporter-like systems | Back alignment and domain information |
|---|
| >cd06349 PBP1_ABC_ligand_binding_like_14 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems | Back alignment and domain information |
|---|
| >cd06351 PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NMDA, AMPA, and kainate receptor subtypes of ionotropic glutamate receptors (iGluRs) | Back alignment and domain information |
|---|
| >cd06327 PBP1_SBP_like_1 Periplasmic solute-binding domain of active transport proteins that belong to the type I periplasmic binding fold protein family | Back alignment and domain information |
|---|
| >cd06360 PBP1_alkylbenzenes_like Type I periplasmic binding component of active transport systems that are predicted be involved in anaerobic biodegradation of alkylbenzenes such as toluene and ethylbenzene | Back alignment and domain information |
|---|
| >cd06344 PBP1_ABC_ligand_binding_like_9 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >COG0683 LivK ABC-type branched-chain amino acid transport systems, periplasmic component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd06347 PBP1_ABC_ligand_binding_like_12 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >cd06328 PBP1_SBP_like_2 Periplasmic solute-binding domain of active transport proteins found in gram-negative and gram-positive bacteria | Back alignment and domain information |
|---|
| >cd06330 PBP1_Arsenic_SBP_like Periplasmic solute-binding domain of active transport proteins | Back alignment and domain information |
|---|
| >KOG1055|consensus | Back alignment and domain information |
|---|
| >cd06391 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta2 receptor of an orphan glutamate receptor family | Back alignment and domain information |
|---|
| >cd06348 PBP1_ABC_ligand_binding_like_13 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >cd06389 PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR2 subunit of the AMPA receptor | Back alignment and domain information |
|---|
| >cd06359 PBP1_Nba_like Type I periplasmic binding component of active transport systems that are predicted to be involved in 2-nitrobenzoic acid degradation pathway | Back alignment and domain information |
|---|
| >cd06332 PBP1_aromatic_compounds_like Type I periplasmic binding proteins of active transport systems that are predicted to be involved in transport of aromatic compounds such as 2-nitrobenzoic acid and alkylbenzenes | Back alignment and domain information |
|---|
| >cd06268 PBP1_ABC_transporter_LIVBP_like Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily | Back alignment and domain information |
|---|
| >TIGR03863 PQQ_ABC_bind ABC transporter, substrate binding protein, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >cd06339 PBP1_YraM_LppC_lipoprotein_like Periplasmic binding component of lipoprotein LppC, an immunodominant antigen | Back alignment and domain information |
|---|
| >cd06333 PBP1_ABC-type_HAAT_like Type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids | Back alignment and domain information |
|---|
| >cd06355 PBP1_FmdD_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF) | Back alignment and domain information |
|---|
| >cd06331 PBP1_AmiC_like Type I periplasmic components of amide-binding protein (AmiC) and the active transport system for short-chain and urea (FmdDEF) | Back alignment and domain information |
|---|
| >cd06326 PBP1_STKc_like Type I periplasmic binding domain of uncharacterized extracellular ligand-binding proteins | Back alignment and domain information |
|---|
| >cd06394 PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the KA1 and KA2 subunits of Kainate receptor | Back alignment and domain information |
|---|
| >cd06358 PBP1_NHase Type I periplasmic-binding protein of the nitrile hydratase (NHase) system that selectively converts nitriles to corresponding amides | Back alignment and domain information |
|---|
| >TIGR03407 urea_ABC_UrtA urea ABC transporter, urea binding protein | Back alignment and domain information |
|---|
| >KOG4440|consensus | Back alignment and domain information |
|---|
| >TIGR03669 urea_ABC_arch urea ABC transporter, substrate-binding protein, archaeal type | Back alignment and domain information |
|---|
| >cd06337 PBP1_ABC_ligand_binding_like_4 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >cd06388 PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR4 subunit of the AMPA receptor | Back alignment and domain information |
|---|
| >cd06356 PBP1_Amide_Urea_BP_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF) | Back alignment and domain information |
|---|
| >PF13458 Peripla_BP_6: Periplasmic binding protein; PDB: 4EVS_A 4EY3_A 4EYG_B 4EYK_A 3H5L_B 3TD9_A 3EAF_A 1Z18_A 1Z17_A 2LIV_A | Back alignment and domain information |
|---|
| >cd06387 PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR3 subunit of the AMPA receptor | Back alignment and domain information |
|---|
| >cd06392 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta1 receptor of an orphan glutamate receptor family | Back alignment and domain information |
|---|
| >cd06341 PBP1_ABC_ligand_binding_like_7 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >cd06357 PBP1_AmiC Periplasmic binding domain of amidase (AmiC) that belongs to the type I periplasmic binding fold protein family | Back alignment and domain information |
|---|
| >cd06381 PBP1_iGluR_delta_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of an orphan family of delta receptors, GluRdelta1 and GluRdelta2 | Back alignment and domain information |
|---|
| >cd06377 PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR3 subunit of NMDA receptor family | Back alignment and domain information |
|---|
| >cd01391 Periplasmic_Binding_Protein_Type_1 Type 1 periplasmic binding fold superfamily | Back alignment and domain information |
|---|
| >PF13433 Peripla_BP_5: Periplasmic binding protein domain; PDB: 1QNL_A 1QO0_A 1PEA_A | Back alignment and domain information |
|---|
| >KOG1053|consensus | Back alignment and domain information |
|---|
| >cd06369 PBP1_GC_C_enterotoxin_receptor Ligand-binding domain of the membrane guanylyl cyclase C | Back alignment and domain information |
|---|
| >KOG1054|consensus | Back alignment and domain information |
|---|
| >TIGR02990 ectoine_eutA ectoine utilization protein EutA | Back alignment and domain information |
|---|
| >PF04348 LppC: LppC putative lipoprotein; InterPro: IPR007443 This entry includes several bacterial outer membrane antigens, whose molecular function is unknown | Back alignment and domain information |
|---|
| >cd01537 PBP1_Repressors_Sugar_Binding_like Ligand-binding domain of the LacI-GalR family of transcription regulators and the sugar-binding domain of ABC-type transport systems | Back alignment and domain information |
|---|
| >cd01536 PBP1_ABC_sugar_binding_like Periplasmic sugar-binding domain of active transport systems that are members of the type I periplasmic binding protein (PBP1) superfamily | Back alignment and domain information |
|---|
| >PRK09860 putative alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08192 Fe-ADH7 Iron-containing alcohol dehydrogenases-like, involved in the linear alkylbenzenesulfonate (LAS) degradation pathway | Back alignment and domain information |
|---|
| >COG1454 EutG Alcohol dehydrogenase, class IV [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd08190 HOT Hydroxyacid-oxoacid transhydrogenase (HOT) involved in gamma-hydroxybutyrate metabolism | Back alignment and domain information |
|---|
| >cd08551 Fe-ADH iron-containing alcohol dehydrogenases (Fe-ADH)-like | Back alignment and domain information |
|---|
| >PRK15454 ethanol dehydrogenase EutG; Provisional | Back alignment and domain information |
|---|
| >PRK10624 L-1,2-propanediol oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >cd06325 PBP1_ABC_uncharacterized_transporter Type I periplasmic ligand-binding domain of uncharacterized ABC-type transport systems that are predicted to be involved in the uptake of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >cd08193 HVD 5-hydroxyvalerate dehydrogenase (HVD) catalyzes the oxidation of 5-hydroxyvalerate to 5-oxovalerate with NAD+ as cofactor | Back alignment and domain information |
|---|
| >PF00465 Fe-ADH: Iron-containing alcohol dehydrogenase ; InterPro: IPR001670 Alcohol dehydrogenase (1 | Back alignment and domain information |
|---|
| >cd08189 Fe-ADH5 Iron-containing alcohol dehydrogenases-like | Back alignment and domain information |
|---|
| >cd06267 PBP1_LacI_sugar_binding_like Ligand binding domain of the LacI tanscriptional regulator family belonging to the type I periplasmic-binding fold protein superfamily | Back alignment and domain information |
|---|
| >cd08194 Fe-ADH6 Iron-containing alcohol dehydrogenases-like | Back alignment and domain information |
|---|
| >cd06282 PBP1_GntR_like_2 Ligand-binding domain of putative DNA transcription repressors highly similar to that of the repressor specific for gluconate (GntR) which is a member of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >cd08185 Fe-ADH1 Iron-containing alcohol dehydrogenases-like | Back alignment and domain information |
|---|
| >TIGR02638 lactal_redase lactaldehyde reductase | Back alignment and domain information |
|---|
| >cd08188 Fe-ADH4 Iron-containing alcohol dehydrogenases-like | Back alignment and domain information |
|---|
| >KOG3857|consensus | Back alignment and domain information |
|---|
| >cd08176 LPO Lactadehyde:propanediol oxidoreductase (LPO) catalyzes the interconversion between L-lactaldehyde and L-1,2-propanediol in Escherichia coli and other enterobacteria | Back alignment and domain information |
|---|
| >cd08191 HHD 6-hydroxyhexanoate dehydrogenase (HHD) catalyzes the oxidation of 6-hydroxyhexanoate to 6-oxohexanoate | Back alignment and domain information |
|---|
| >cd06300 PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-binding component of uncharacterized ABC-type transport systems that are members of the pentose/hexose sugar-binding protein family of the type I periplasmic binding protein superfamily | Back alignment and domain information |
|---|
| >cd08181 PPD-like 1,3-propanediol dehydrogenase-like (PPD) | Back alignment and domain information |
|---|
| >cd08182 HEPD Hydroxyethylphosphoate dehydrogenase (HEPD) catalyzes the reduction of phosphonoacetaldehyde (PnAA) to hydroxyethylphosphoate (HEP) | Back alignment and domain information |
|---|
| >cd08170 GlyDH Glycerol dehydrogenases (GlyDH) catalyzes oxidation of glycerol to dihydroxyacetone in glycerol dissmilation | Back alignment and domain information |
|---|
| >cd08187 BDH Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process | Back alignment and domain information |
|---|
| >cd08171 GlyDH-like2 Glycerol dehydrogenase-like | Back alignment and domain information |
|---|
| >PF13685 Fe-ADH_2: Iron-containing alcohol dehydrogenase; PDB: 3CE9_C | Back alignment and domain information |
|---|
| >cd07766 DHQ_Fe-ADH Dehydroquinate synthase-like (DHQ-like) and iron-containing alcohol dehydrogenases (Fe-ADH) | Back alignment and domain information |
|---|
| >cd08186 Fe-ADH8 Iron-containing alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd06273 PBP1_GntR_like_1 This group includes the ligand-binding domain of putative DNA transcription repressors which are highly similar to that of the repressor specific for gluconate (GntR), a member of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >PRK09423 gldA glycerol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08550 GlyDH-like Glycerol_dehydrogenase-like | Back alignment and domain information |
|---|
| >cd08183 Fe-ADH2 Iron-containing alcohol dehydrogenases-like | Back alignment and domain information |
|---|
| >TIGR02667 moaB_proteo molybdenum cofactor biosynthesis protein B, proteobacterial | Back alignment and domain information |
|---|
| >cd06320 PBP1_allose_binding Periplasmic allose-binding domain of bacterial transport systems that function as a primary receptor of active transport and chemotaxis | Back alignment and domain information |
|---|
| >cd03364 TOPRIM_DnaG_primases TOPRIM_DnaG_primases: The topoisomerase-primase (TORPIM) nucleotidyl transferase/hydrolase domain found in the active site regions of proteins similar to Escherichia coli DnaG | Back alignment and domain information |
|---|
| >cd08179 NADPH_BDH NADPH-dependent butanol dehydrogenase involved in the butanol and ethanol formation pathway in bacteria | Back alignment and domain information |
|---|
| >cd06323 PBP1_ribose_binding Periplasmic sugar-binding domain of the thermophilic Thermoanaerobacter tengcongensis ribose binding protein (ttRBP) and its mesophilic homologs | Back alignment and domain information |
|---|
| >cd08178 AAD_C C-terminal alcohol dehydrogenase domain of the acetaldehyde dehydrogenase-alcohol dehydrogenase bifunctional two-domain protein (AAD) | Back alignment and domain information |
|---|
| >cd06278 PBP1_LacI_like_2 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors | Back alignment and domain information |
|---|
| >COG2984 ABC-type uncharacterized transport system, periplasmic component [General function prediction only] | Back alignment and domain information |
|---|
| >cd06353 PBP1_BmpA_Med_like Periplasmic binding domain of the basic membrane lipoprotein Med in Bacillus and its close homologs from other bacteria and Archaea | Back alignment and domain information |
|---|
| >cd08175 G1PDH Glycerol-1-phosphate dehydrogenase (G1PDH) catalyzes the reversible reduction of dihydroxyacetone phosphate (DHAP) to glycerol-1-phosphate (G1P) in an NADH-dependent manner | Back alignment and domain information |
|---|
| >TIGR01481 ccpA catabolite control protein A | Back alignment and domain information |
|---|
| >cd06301 PBP1_rhizopine_binding_like Periplasmic binding proteins specific to rhizopines | Back alignment and domain information |
|---|
| >cd08180 PDD 1,3-propanediol dehydrogenase (PPD) catalyzes the reduction of 3-hydroxypropionaldehyde (3-HPA) to 1,3-propanediol in glycerol metabolism | Back alignment and domain information |
|---|
| >cd00886 MogA_MoaB MogA_MoaB family | Back alignment and domain information |
|---|
| >PF13407 Peripla_BP_4: Periplasmic binding protein domain; PDB: 3BRS_B 3GBP_A 3GA5_A 1GCG_A 1GCA_A 3H75_A 3D02_A 3L49_B 3EJW_B 3T95_A | Back alignment and domain information |
|---|
| >cd06310 PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >PF13607 Succ_CoA_lig: Succinyl-CoA ligase like flavodoxin domain; PDB: 2CSU_A | Back alignment and domain information |
|---|
| >cd06284 PBP1_LacI_like_6 Ligand-binding domain of an uncharacterized transcription regulator from Actinobacillus succinogenes and its close homologs from other bacteria | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 144 | ||||
| 2e4u_A | 555 | Crystal Structure Of The Extracellular Region Of Th | 6e-19 | ||
| 3lmk_A | 492 | Ligand Binding Domain Of Metabotropoc Glutamate Rec | 2e-17 | ||
| 3sm9_A | 479 | Crystal Structure Of Metabotropic Glutamate Recepto | 3e-17 | ||
| 2e4z_A | 501 | Crystal Structure Of The Ligand-Binding Region Of T | 3e-16 | ||
| 3mq4_A | 481 | Metabotropic Glutamate Receptor Mglur7 Complexed Wi | 1e-15 | ||
| 1ewk_A | 490 | Crystal Structure Of Metabotropic Glutamate Recepto | 3e-15 | ||
| 3ks9_A | 496 | Metabotropic Glutamate Receptor Mglur1 Complexed Wi | 4e-14 | ||
| 4f11_A | 433 | Crystal Structure Of The Extracellular Domain Of Hu | 3e-05 |
| >pdb|2E4U|A Chain A, Crystal Structure Of The Extracellular Region Of The Group Ii Metabotropic Glutamate Receptor Complexed With L-glutamate Length = 555 | Back alignment and structure |
|
| >pdb|3LMK|A Chain A, Ligand Binding Domain Of Metabotropoc Glutamate Receptor Mglur5 Complexed With Glutamate Length = 492 | Back alignment and structure |
| >pdb|3SM9|A Chain A, Crystal Structure Of Metabotropic Glutamate Receptor 3 Precursor In Presence Of Ly341495 Antagonist Length = 479 | Back alignment and structure |
| >pdb|2E4Z|A Chain A, Crystal Structure Of The Ligand-Binding Region Of The Group Iii Metabotropic Glutamate Receptor Length = 501 | Back alignment and structure |
| >pdb|3MQ4|A Chain A, Metabotropic Glutamate Receptor Mglur7 Complexed With Ly3414 Antagonist Length = 481 | Back alignment and structure |
| >pdb|1EWK|A Chain A, Crystal Structure Of Metabotropic Glutamate Receptor Subtype 1 Complexed With Glutamate Length = 490 | Back alignment and structure |
| >pdb|3KS9|A Chain A, Metabotropic Glutamate Receptor Mglur1 Complexed With Ly341495 Antagonist Length = 496 | Back alignment and structure |
| >pdb|4F11|A Chain A, Crystal Structure Of The Extracellular Domain Of Human Gaba(B) Receptor Gbr2 Length = 433 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 144 | |||
| 2e4u_A | 555 | Metabotropic glutamate receptor 3; G-protein-coupl | 1e-34 | |
| 3sm9_A | 479 | Mglur3, metabotropic glutamate receptor 3; structu | 2e-33 | |
| 3ks9_A | 496 | Mglur1, metabotropic glutamate receptor 1; glutama | 1e-31 | |
| 3mq4_A | 481 | Mglur7, metabotropic glutamate receptor 7; glutama | 1e-30 | |
| 4f11_A | 433 | Gamma-aminobutyric acid type B receptor subunit 2; | 1e-28 | |
| 3qek_A | 384 | NMDA glutamate receptor subunit; amino terminal do | 2e-25 | |
| 3qel_B | 364 | Glutamate [NMDA] receptor subunit epsilon-2; ION c | 7e-22 | |
| 1jdp_A | 441 | NPR-C, atrial natriuretic peptide clearance recept | 2e-19 | |
| 1dp4_A | 435 | Atrial natriuretic peptide receptor A; periplasmic | 2e-19 | |
| 3h6g_A | 395 | Glutamate receptor, ionotropic kainate 2; membrane | 3e-18 | |
| 3om0_A | 393 | Glutamate receptor, ionotropic kainate 5; membrane | 1e-10 | |
| 3hsy_A | 376 | Glutamate receptor 2; ligand-gated ION channel, sy | 4e-09 | |
| 3saj_A | 384 | Glutamate receptor 1; rossman fold, ION channel, m | 5e-08 | |
| 3o21_A | 389 | Glutamate receptor 3; periplasmatic binding protei | 1e-07 | |
| 3sg0_A | 386 | Extracellular ligand-binding receptor; structural | 2e-07 | |
| 3lkb_A | 392 | Probable branched-chain amino acid ABC transporter | 7e-07 | |
| 3ipc_A | 356 | ABC transporter, substrate binding protein (amino; | 1e-06 | |
| 1usg_A | 346 | Leucine-specific binding protein; leucine-binding | 3e-06 | |
| 3hut_A | 358 | Putative branched-chain amino acid ABC transporter | 4e-06 | |
| 3lop_A | 364 | Substrate binding periplasmic protein; protein str | 4e-06 | |
| 3snr_A | 362 | Extracellular ligand-binding receptor; structural | 4e-06 | |
| 4evq_A | 375 | Putative ABC transporter subunit, substrate-bindi | 4e-05 | |
| 3kg2_A | 823 | Glutamate receptor 2; ION channel, membrane protei | 4e-05 | |
| 3i45_A | 387 | Twin-arginine translocation pathway signal protei; | 9e-05 |
| >2e4u_A Metabotropic glutamate receptor 3; G-protein-coupled receptor, neuron, central nerve system, SI protein; HET: NAG GLU; 2.35A {Rattus norvegicus} PDB: 2e4v_A* 2e4w_A* 2e4x_A* 2e4y_A* Length = 555 | Back alignment and structure |
|---|
Score = 125 bits (315), Expect = 1e-34
Identities = 43/105 (40%), Positives = 64/105 (60%), Gaps = 3/105 (2%)
Query: 1 VSFWSTSPELSNKQRFEYFTRTIPSDHHQVKAMVEIVKKLGWSYVSIIYEESNYGVKAFE 60
+S+ STS +LS+K R++YF RT+P D +Q KAM EI++ W+YVS + E +YG E
Sbjct: 145 ISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIE 204
Query: 61 ELEVLLAKYSICIAIKEKLVKDSGVAEETAYDDIVLKLLTKPRAR 105
E +ICIA EK+ + + +YD ++ +LL KP AR
Sbjct: 205 AFEQEARLRNICIATAEKVGRSN---IRKSYDSVIRELLQKPNAR 246
|
| >3sm9_A Mglur3, metabotropic glutamate receptor 3; structural genomics, structural genomics consortium, SGC, CE membrane, G-protein coupled receptor; HET: Z99; 2.26A {Homo sapiens} Length = 479 | Back alignment and structure |
|---|
| >3ks9_A Mglur1, metabotropic glutamate receptor 1; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99 NAG; 1.90A {Homo sapiens} PDB: 1ewk_A* 1ewt_A* 1ewv_A 1isr_A* 1iss_A* 3lmk_A* Length = 496 | Back alignment and structure |
|---|
| >3mq4_A Mglur7, metabotropic glutamate receptor 7; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99; 2.80A {Homo sapiens} PDB: 2e4z_A* Length = 481 | Back alignment and structure |
|---|
| >4f11_A Gamma-aminobutyric acid type B receptor subunit 2; venus flytrap module, G-protein coupled receptor, signaling; 2.38A {Homo sapiens} PDB: 4f12_A* Length = 433 | Back alignment and structure |
|---|
| >3qek_A NMDA glutamate receptor subunit; amino terminal domain, ION channel, NMDA receptor, allosteri modulation, phenylethanolamine, polyamine; HET: NAG BMA; 2.00A {Xenopus laevis} PDB: 3qel_A* 3qem_A* 3q41_A* Length = 384 | Back alignment and structure |
|---|
| >3qel_B Glutamate [NMDA] receptor subunit epsilon-2; ION channel, allosteric modulation, phenylethanolamine, N-glycosylation, extracellular; HET: NAG BMA MAN FUC QEL; 2.60A {Rattus norvegicus} PDB: 3qem_B* 3jpw_A* 3jpy_A* Length = 364 | Back alignment and structure |
|---|
| >1jdp_A NPR-C, atrial natriuretic peptide clearance receptor; hormone-receptor complex, natriuretic peptide receptor, ALLO activation, signaling protein; HET: NDG NAG; 2.00A {Homo sapiens} SCOP: c.93.1.1 PDB: 1jdn_A* 1yk0_A* 1yk1_A* Length = 441 | Back alignment and structure |
|---|
| >1dp4_A Atrial natriuretic peptide receptor A; periplasmic binding protein fold, dimer, hormone/growth FACT receptor, lyase complex; HET: NAG; 2.00A {Rattus norvegicus} SCOP: c.93.1.1 PDB: 1t34_A* 3a3k_A* Length = 435 | Back alignment and structure |
|---|
| >3h6g_A Glutamate receptor, ionotropic kainate 2; membrane protein glycoprotein, cell junction, cell membrane, glycoprotein, ION transport; HET: NAG TLA; 2.70A {Rattus norvegicus} PDB: 3h6h_A* 3qlv_C 3qlu_C* 3qlt_A* 3olz_A* Length = 395 | Back alignment and structure |
|---|
| >3om0_A Glutamate receptor, ionotropic kainate 5; membrane protein, ION channel; HET: NAG BMA GOL; 1.40A {Rattus norvegicus} PDB: 3om1_A* 3qlu_A* 3qlv_A Length = 393 | Back alignment and structure |
|---|
| >3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, cell CELL membrane, endoplasmic reticulum, glycoprotein, ION TRA ionic channel; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 3o2j_A* 2wjw_A* 2wjx_A 3n6v_A Length = 376 | Back alignment and structure |
|---|
| >3saj_A Glutamate receptor 1; rossman fold, ION channel, membrane, transport protein; HET: NAG BMA MAN; 2.50A {Rattus norvegicus} Length = 384 | Back alignment and structure |
|---|
| >3o21_A Glutamate receptor 3; periplasmatic binding protein, oligomerization, membrane, TR protein; HET: NAG; 2.20A {Rattus norvegicus} PDB: 3p3w_A Length = 389 | Back alignment and structure |
|---|
| >3sg0_A Extracellular ligand-binding receptor; structural genomics, PSI-biology; HET: 173; 1.20A {Rhodopseudomonas palustris} PDB: 4dqd_A* Length = 386 | Back alignment and structure |
|---|
| >3lkb_A Probable branched-chain amino acid ABC transporter, amino acid binding protein; branched amino acid, PSI-II, NYSGXRC, structural genomics; 2.40A {Thermus thermophilus} Length = 392 | Back alignment and structure |
|---|
| >3ipc_A ABC transporter, substrate binding protein (amino; venus flytrap domain, transport protein; 1.30A {Agrobacterium tumefaciens} PDB: 3ip5_A 3ip6_A 3ip7_A 3ip9_A 3ipa_A Length = 356 | Back alignment and structure |
|---|
| >1usg_A Leucine-specific binding protein; leucine-binding protein, X-RAY crystallography, protein structure, ABC transport systems, transport protein; 1.53A {Escherichia coli} SCOP: c.93.1.1 PDB: 1usi_A* 1usk_A 2lbp_A 1z15_A 1z16_A 1z17_A 1z18_A 2liv_A Length = 346 | Back alignment and structure |
|---|
| >3hut_A Putative branched-chain amino acid ABC transporter; extracellular ligand-binding receptor,transport protein; 1.93A {Rhodospirillum rubrum atcc 11170} Length = 358 | Back alignment and structure |
|---|
| >3lop_A Substrate binding periplasmic protein; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.55A {Ralstonia solanacearum} Length = 364 | Back alignment and structure |
|---|
| >4evq_A Putative ABC transporter subunit, substrate-bindi component; structural genomics, PSI-biology, midwest center for structu genomics; HET: MSE PHB; 1.40A {Rhodopseudomonas palustris} PDB: 4evr_A Length = 375 | Back alignment and structure |
|---|
| >3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Length = 823 | Back alignment and structure |
|---|
| >3i45_A Twin-arginine translocation pathway signal protei; structural genomics; 1.36A {Rhodospirillum rubrum} Length = 387 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 144 | |||
| 3ks9_A | 496 | Mglur1, metabotropic glutamate receptor 1; glutama | 99.87 | |
| 3sm9_A | 479 | Mglur3, metabotropic glutamate receptor 3; structu | 99.87 | |
| 2e4u_A | 555 | Metabotropic glutamate receptor 3; G-protein-coupl | 99.87 | |
| 3mq4_A | 481 | Mglur7, metabotropic glutamate receptor 7; glutama | 99.82 | |
| 3qel_B | 364 | Glutamate [NMDA] receptor subunit epsilon-2; ION c | 99.82 | |
| 1jdp_A | 441 | NPR-C, atrial natriuretic peptide clearance recept | 99.82 | |
| 3qek_A | 384 | NMDA glutamate receptor subunit; amino terminal do | 99.81 | |
| 4f11_A | 433 | Gamma-aminobutyric acid type B receptor subunit 2; | 99.78 | |
| 1dp4_A | 435 | Atrial natriuretic peptide receptor A; periplasmic | 99.77 | |
| 3h6g_A | 395 | Glutamate receptor, ionotropic kainate 2; membrane | 99.72 | |
| 3om0_A | 393 | Glutamate receptor, ionotropic kainate 5; membrane | 99.63 | |
| 3hsy_A | 376 | Glutamate receptor 2; ligand-gated ION channel, sy | 99.6 | |
| 3o21_A | 389 | Glutamate receptor 3; periplasmatic binding protei | 99.58 | |
| 3kg2_A | 823 | Glutamate receptor 2; ION channel, membrane protei | 99.57 | |
| 3saj_A | 384 | Glutamate receptor 1; rossman fold, ION channel, m | 99.56 | |
| 4gpa_A | 389 | Glutamate receptor 4; PBP fold, ligand-gated ION c | 99.56 | |
| 3n0w_A | 379 | ABC branched chain amino acid family transporter, | 99.53 | |
| 4f06_A | 371 | Extracellular ligand-binding receptor; PSI-biology | 99.53 | |
| 3i09_A | 375 | Periplasmic branched-chain amino acid-binding Pro; | 99.53 | |
| 3i45_A | 387 | Twin-arginine translocation pathway signal protei; | 99.52 | |
| 3h5l_A | 419 | Putative branched-chain amino acid ABC transporter | 99.47 | |
| 3n0x_A | 374 | Possible substrate binding protein of ABC transpo | 99.46 | |
| 4eyg_A | 368 | Twin-arginine translocation pathway signal; PSI-bi | 99.46 | |
| 4evq_A | 375 | Putative ABC transporter subunit, substrate-bindi | 99.43 | |
| 3ipc_A | 356 | ABC transporter, substrate binding protein (amino; | 99.39 | |
| 3lop_A | 364 | Substrate binding periplasmic protein; protein str | 99.37 | |
| 3td9_A | 366 | Branched chain amino acid ABC transporter, peripl | 99.37 | |
| 3eaf_A | 391 | ABC transporter, substrate binding protein; PSI2, | 99.35 | |
| 3sg0_A | 386 | Extracellular ligand-binding receptor; structural | 99.34 | |
| 1usg_A | 346 | Leucine-specific binding protein; leucine-binding | 99.34 | |
| 3lkb_A | 392 | Probable branched-chain amino acid ABC transporter | 99.33 | |
| 3hut_A | 358 | Putative branched-chain amino acid ABC transporter | 99.3 | |
| 3snr_A | 362 | Extracellular ligand-binding receptor; structural | 99.25 | |
| 4gnr_A | 353 | ABC transporter substrate-binding protein-branche | 99.09 | |
| 1pea_A | 385 | Amidase operon; gene regulator, receptor, binding | 98.99 | |
| 3ckm_A | 327 | YRAM (HI1655), LPOA; periplasmic-binding protein, | 98.82 | |
| 2h4a_A | 325 | YRAM (HI1655); perplasmic binding protein, lipopro | 98.78 | |
| 3ixl_A | 240 | Amdase, arylmalonate decarboxylase; enantioselecti | 95.13 | |
| 3bfj_A | 387 | 1,3-propanediol oxidoreductase; opportunistic path | 94.06 | |
| 3ox4_A | 383 | Alcohol dehydrogenase 2; iron, NAD, oxidoreductase | 93.95 | |
| 1vlj_A | 407 | NADH-dependent butanol dehydrogenase; TM0820, stru | 92.38 | |
| 2xed_A | 273 | Putative maleate isomerase; nicotinic acid catabol | 92.29 | |
| 1rrm_A | 386 | Lactaldehyde reductase; structural genomics, dehyd | 92.18 | |
| 2qh8_A | 302 | Uncharacterized protein; conserved domain protein, | 91.61 | |
| 3lft_A | 295 | Uncharacterized protein; ABC, ATPase, cassette, L- | 91.23 | |
| 1o2d_A | 371 | Alcohol dehydrogenase, iron-containing; TM0920, st | 91.05 | |
| 2dgd_A | 223 | 223AA long hypothetical arylmalonate decarboxylas; | 90.31 | |
| 2h3h_A | 313 | Sugar ABC transporter, periplasmic sugar-binding p | 89.88 | |
| 3uhj_A | 387 | Probable glycerol dehydrogenase; structural genomi | 89.02 | |
| 1mkz_A | 172 | Molybdenum cofactor biosynthesis protein B; MAD, W | 88.96 | |
| 3ce9_A | 354 | Glycerol dehydrogenase; NP_348253.1, 3-dehydroquin | 88.56 | |
| 3iwt_A | 178 | 178AA long hypothetical molybdenum cofactor biosy | 85.71 | |
| 1jq5_A | 370 | Glycerol dehydrogenase; oxidoreductase, NAD, glyce | 85.6 | |
| 3brq_A | 296 | HTH-type transcriptional regulator ASCG; transcrip | 85.09 | |
| 2pjk_A | 178 | 178AA long hypothetical molybdenum cofactor biosyn | 83.69 | |
| 3ksm_A | 276 | ABC-type sugar transport system, periplasmic COMP; | 83.59 | |
| 2fvy_A | 309 | D-galactose-binding periplasmic protein; periplasm | 83.34 | |
| 1y5e_A | 169 | Molybdenum cofactor biosynthesis protein B; struct | 83.33 | |
| 3d8u_A | 275 | PURR transcriptional regulator; APC91343.1, vibrio | 83.28 | |
| 3hl0_A | 353 | Maleylacetate reductase; structur genomics, PSI-2, | 83.07 | |
| 3gv0_A | 288 | Transcriptional regulator, LACI family; transcript | 83.02 | |
| 2qu7_A | 288 | Putative transcriptional regulator; structural gen | 82.18 | |
| 1dbq_A | 289 | Purine repressor; transcription regulation, DNA-bi | 82.1 | |
| 3rot_A | 297 | ABC sugar transporter, periplasmic sugar binding; | 82.07 | |
| 3gyb_A | 280 | Transcriptional regulators (LACI-family transcript | 81.8 | |
| 2h0a_A | 276 | TTHA0807, transcriptional regulator; repressor, st | 81.44 | |
| 1xvl_A | 321 | Mn transporter, MNTC protein; manganese, ABC-type | 81.14 | |
| 2rjo_A | 332 | Twin-arginine translocation pathway signal protei; | 80.77 | |
| 3brs_A | 289 | Periplasmic binding protein/LACI transcriptional; | 80.29 | |
| 3gbv_A | 304 | Putative LACI-family transcriptional regulator; NY | 80.14 | |
| 3m9w_A | 313 | D-xylose-binding periplasmic protein; xylose bindi | 80.06 |
| >3ks9_A Mglur1, metabotropic glutamate receptor 1; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99 NAG; 1.90A {Homo sapiens} SCOP: c.93.1.1 PDB: 1ewk_A* 1ewt_A* 1ewv_A 1isr_A* 1iss_A* 3lmk_A* | Back alignment and structure |
|---|
Probab=99.87 E-value=6.7e-22 Score=159.80 Aligned_cols=135 Identities=30% Similarity=0.520 Sum_probs=113.9
Q ss_pred CcccCCCCCCcCCCCCCceEEecCCchHHHHHHHHHHHhCCCcEEEEEEEeCCcchHHHHHHHHHhhhCceEEEEEeccc
Q psy12591 1 VSFWSTSPELSNKQRFEYFTRTIPSDHHQVKAMVEIVKKLGWSYVSIIYEESNYGVKAFEELEVLLAKYSICIAIKEKLV 80 (144)
Q Consensus 1 Is~~at~~~ls~~~~~p~ffRt~p~d~~~~~a~~~ll~~f~W~~Vaii~~~~~~g~~~~~~~~~~l~~~Gi~V~~~~~~~ 80 (144)
|||+++++.|+++.+||+||||.|++..|+.++++++++|||+||++|++|++||....+.|++++++.|+||++.+.++
T Consensus 156 Is~~a~~~~lsd~~~~p~~frt~psd~~~~~ai~~ll~~fgw~~V~li~~dd~~G~~~~~~~~~~~~~~Gi~v~~~~~i~ 235 (496)
T 3ks9_A 156 IAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKELAAQEGLSIAHSDKIY 235 (496)
T ss_dssp EESSCCCGGGGCTTTCTTEEESSCCTHHHHHHHHHHHHHTTCCEEEEEEESSHHHHHHHHHHHHHHHHTTCEEEEEEEEC
T ss_pred ECCCcCCccccCccCCCceEEecCChHHHHHHHHHHHHHcCCcEEEEEEeccHHHHHHHHHHHHHHHHcCceEEEEEEEC
Confidence 58899999999998899999999999999999999999999999999999999999999999999999999999999887
Q ss_pred CCCCCcchhhHHHHHHHHhcC-CCceEEEEeeE---------------------EeeeCCcchhh-----hhHHHHHHHh
Q psy12591 81 KDSGVAEETAYDDIVLKLLTK-PRARGLFKRLK---------------------LVKDSGVAEET-----AYDDIVLKLL 133 (144)
Q Consensus 81 ~~~~~~~~~~~~~~l~~lk~~-~~arvii~~~~---------------------~~~~~g~~~~~-----~~~~~~~~~~ 133 (144)
... .+.+++.++++|++. ++++|||++.. ++..+||+... ....++|.++
T Consensus 236 ~~~---~~~d~~~~l~~i~~~~~~a~vii~~~~~~~~~~l~~~~~~~g~~~k~~~i~s~~w~~~~~~~~~~~~~~~G~l~ 312 (496)
T 3ks9_A 236 SNA---GEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLLSAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGIT 312 (496)
T ss_dssp TTC---CHHHHHHHHHHHHTTTTTTCEEEEECCHHHHHHHHHHHHHHTCCSCCEEEECTTTTTCHHHHTTCHHHHTTCEE
T ss_pred CCC---CHHHHHHHHHHHHhccCceEEEEEecChHHHHHHHHHHHHhCCCCcEEEEEechhccccccccccccccCceEE
Confidence 543 378999999999952 68999998742 46677776532 2234566666
Q ss_pred cCccc
Q psy12591 134 TKPRA 138 (144)
Q Consensus 134 ~~~~~ 138 (144)
+.++.
T Consensus 313 ~~~~~ 317 (496)
T 3ks9_A 313 IKLQS 317 (496)
T ss_dssp EEECC
T ss_pred EeccC
Confidence 55544
|
| >3sm9_A Mglur3, metabotropic glutamate receptor 3; structural genomics, structural genomics consortium, SGC, CE membrane, G-protein coupled receptor; HET: Z99; 2.26A {Homo sapiens} | Back alignment and structure |
|---|
| >2e4u_A Metabotropic glutamate receptor 3; G-protein-coupled receptor, neuron, central nerve system, SI protein; HET: NAG GLU; 2.35A {Rattus norvegicus} PDB: 2e4v_A* 2e4w_A* 2e4x_A* 2e4y_A* | Back alignment and structure |
|---|
| >3mq4_A Mglur7, metabotropic glutamate receptor 7; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99; 2.80A {Homo sapiens} SCOP: c.93.1.0 PDB: 2e4z_A* | Back alignment and structure |
|---|
| >3qel_B Glutamate [NMDA] receptor subunit epsilon-2; ION channel, allosteric modulation, phenylethanolamine, N-glycosylation, extracellular; HET: NAG BMA MAN FUC QEL; 2.60A {Rattus norvegicus} PDB: 3qem_B* 3jpw_A* 3jpy_A* | Back alignment and structure |
|---|
| >1jdp_A NPR-C, atrial natriuretic peptide clearance receptor; hormone-receptor complex, natriuretic peptide receptor, ALLO activation, signaling protein; HET: NDG NAG; 2.00A {Homo sapiens} SCOP: c.93.1.1 PDB: 1jdn_A* 1yk0_A* 1yk1_A* | Back alignment and structure |
|---|
| >3qek_A NMDA glutamate receptor subunit; amino terminal domain, ION channel, NMDA receptor, allosteri modulation, phenylethanolamine, polyamine; HET: NAG BMA; 2.00A {Xenopus laevis} PDB: 3qel_A* 3qem_A* 3q41_A* | Back alignment and structure |
|---|
| >4f11_A Gamma-aminobutyric acid type B receptor subunit 2; venus flytrap module, G-protein coupled receptor, signaling; 2.38A {Homo sapiens} PDB: 4f12_A* | Back alignment and structure |
|---|
| >1dp4_A Atrial natriuretic peptide receptor A; periplasmic binding protein fold, dimer, hormone/growth FACT receptor, lyase complex; HET: NAG; 2.00A {Rattus norvegicus} SCOP: c.93.1.1 PDB: 1t34_A* 3a3k_A* | Back alignment and structure |
|---|
| >3h6g_A Glutamate receptor, ionotropic kainate 2; membrane protein glycoprotein, cell junction, cell membrane, glycoprotein, ION transport; HET: NAG TLA; 2.70A {Rattus norvegicus} PDB: 3h6h_A* 3qlv_C 3qlu_C* 3qlt_A* 3olz_A* | Back alignment and structure |
|---|
| >3om0_A Glutamate receptor, ionotropic kainate 5; membrane protein, ION channel; HET: NAG BMA GOL; 1.40A {Rattus norvegicus} PDB: 3om1_A* 3qlu_A* 3qlv_A | Back alignment and structure |
|---|
| >3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, cell CELL membrane, endoplasmic reticulum, glycoprotein, ION TRA ionic channel; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 3o2j_A* 2wjw_A* 2wjx_A 3n6v_A | Back alignment and structure |
|---|
| >3o21_A Glutamate receptor 3; periplasmatic binding protein, oligomerization, membrane, TR protein; HET: NAG; 2.20A {Rattus norvegicus} PDB: 3p3w_A | Back alignment and structure |
|---|
| >3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3saj_A Glutamate receptor 1; rossman fold, ION channel, membrane, transport protein; HET: NAG BMA MAN; 2.50A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4gpa_A Glutamate receptor 4; PBP fold, ligand-gated ION channel, ION transport, transmembrane AMPA receptor regulating proteins, cornichons, ckamp44; HET: NAG; 2.25A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3n0w_A ABC branched chain amino acid family transporter, periplasmic ligand binding protein...; receptor family ligand binding region; HET: MSE; 1.88A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >4f06_A Extracellular ligand-binding receptor; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: MSE PHB; 1.30A {Rhodopseudomonas palustris} PDB: 4evs_A* | Back alignment and structure |
|---|
| >3i09_A Periplasmic branched-chain amino acid-binding Pro; type I periplasmic binding protein, structural genomics, JOI for structural genomics; HET: MSE CIT; 1.80A {Burkholderia mallei} | Back alignment and structure |
|---|
| >3i45_A Twin-arginine translocation pathway signal protei; structural genomics; 1.36A {Rhodospirillum rubrum} | Back alignment and structure |
|---|
| >3h5l_A Putative branched-chain amino acid ABC transporter; structural genomics, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3n0x_A Possible substrate binding protein of ABC transpo system; receptor family ligand binding region, structural genomics; HET: MSE; 1.50A {Rhodopseudomonas palustris} PDB: 3nnd_B | Back alignment and structure |
|---|
| >4eyg_A Twin-arginine translocation pathway signal; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: VNL; 1.86A {Rhodopseudomonas palustris} PDB: 4ey3_A* 3t0n_A* 4eyk_A* | Back alignment and structure |
|---|
| >4evq_A Putative ABC transporter subunit, substrate-bindi component; structural genomics, PSI-biology, midwest center for structu genomics; HET: MSE PHB; 1.40A {Rhodopseudomonas palustris} PDB: 4evr_A | Back alignment and structure |
|---|
| >3ipc_A ABC transporter, substrate binding protein (amino; venus flytrap domain, transport protein; 1.30A {Agrobacterium tumefaciens} PDB: 3ip5_A 3ip6_A 3ip7_A 3ip9_A 3ipa_A | Back alignment and structure |
|---|
| >3lop_A Substrate binding periplasmic protein; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.55A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3td9_A Branched chain amino acid ABC transporter, peripl amino acid-binding protein; leucine binding, structural genomics; HET: MSE PHE; 1.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3eaf_A ABC transporter, substrate binding protein; PSI2, NYSGXRC, substrate binding P structural genomics, protein structure initiative; 2.00A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3sg0_A Extracellular ligand-binding receptor; structural genomics, PSI-biology; HET: 173; 1.20A {Rhodopseudomonas palustris} PDB: 4dqd_A* | Back alignment and structure |
|---|
| >1usg_A Leucine-specific binding protein; leucine-binding protein, X-RAY crystallography, protein structure, ABC transport systems, transport protein; 1.53A {Escherichia coli} SCOP: c.93.1.1 PDB: 1usi_A* 1usk_A 2lbp_A 1z15_A 1z16_A 1z17_A 1z18_A 2liv_A | Back alignment and structure |
|---|
| >3lkb_A Probable branched-chain amino acid ABC transporter, amino acid binding protein; branched amino acid, PSI-II, NYSGXRC, structural genomics; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3hut_A Putative branched-chain amino acid ABC transporter; extracellular ligand-binding receptor,transport protein; 1.93A {Rhodospirillum rubrum atcc 11170} | Back alignment and structure |
|---|
| >4gnr_A ABC transporter substrate-binding protein-branche amino acid transport; amino acid-binding protein, surface-exposed protein; HET: MLY; 1.00A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1pea_A Amidase operon; gene regulator, receptor, binding protein; 2.10A {Pseudomonas aeruginosa} SCOP: c.93.1.1 PDB: 1qo0_A 1qnl_A | Back alignment and structure |
|---|
| >3ckm_A YRAM (HI1655), LPOA; periplasmic-binding protein, lipoprotein, unliganded, biosynthetic protein; 1.35A {Haemophilus influenzae} SCOP: c.93.1.1 | Back alignment and structure |
|---|
| >3ixl_A Amdase, arylmalonate decarboxylase; enantioselective decarboxylation, lyase; HET: CME PAC; 1.45A {Bordetella bronchiseptica} PDB: 3ixm_A 2vlb_A 3dg9_A 3ip8_A* 3dtv_A* 3eis_A* | Back alignment and structure |
|---|
| >3bfj_A 1,3-propanediol oxidoreductase; opportunistic pathogens, decamer, structural genomics,struct proteomics in europe, spine; 2.70A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >3ox4_A Alcohol dehydrogenase 2; iron, NAD, oxidoreductase; HET: NAD; 2.00A {Zymomonas mobilis} PDB: 3owo_A* | Back alignment and structure |
|---|
| >1vlj_A NADH-dependent butanol dehydrogenase; TM0820, structural G JCSG, protein structure initiative, PSI, joint center for S genomics; HET: NAP; 1.78A {Thermotoga maritima} SCOP: e.22.1.2 | Back alignment and structure |
|---|
| >2xed_A Putative maleate isomerase; nicotinic acid catabolism, cofactor-independent CIS-trans isomerase; 1.95A {Nocardia farcinica} PDB: 2xec_A | Back alignment and structure |
|---|
| >1rrm_A Lactaldehyde reductase; structural genomics, dehydrogenase, PSI, protein structure initiative; HET: APR; 1.60A {Escherichia coli} SCOP: e.22.1.2 PDB: 2bi4_A* 2bl4_A* | Back alignment and structure |
|---|
| >3lft_A Uncharacterized protein; ABC, ATPase, cassette, L-Trp, PSI, MCSG, structural genomics center for structural genomics; HET: MSE TRP; 1.35A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1o2d_A Alcohol dehydrogenase, iron-containing; TM0920, structural genomics, JCSG, PSI, protein structure initiative; HET: MSE NAP TRS; 1.30A {Thermotoga maritima} SCOP: e.22.1.2 PDB: 1vhd_A* | Back alignment and structure |
|---|
| >2dgd_A 223AA long hypothetical arylmalonate decarboxylas; octamer, alpha/beta structure, lyase; 2.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2h3h_A Sugar ABC transporter, periplasmic sugar-binding protein; glucose binding protein, periplasmic binding protein, GBP; HET: BGC; 1.70A {Thermotoga maritima} PDB: 2qvc_A* 3c6q_B* | Back alignment and structure |
|---|
| >3uhj_A Probable glycerol dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.34A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1mkz_A Molybdenum cofactor biosynthesis protein B; MAD, WEAK anomalous signal, molybdopterin synthesis, structural genomics, PSI; HET: MSE; 1.60A {Escherichia coli} SCOP: c.57.1.1 PDB: 1r2k_B | Back alignment and structure |
|---|
| >3ce9_A Glycerol dehydrogenase; NP_348253.1, 3-dehydroquinate syntha structural genomics, joint center for structural genomics; HET: MSE; 2.37A {Clostridium acetobutylicum atcc 824} | Back alignment and structure |
|---|
| >3iwt_A 178AA long hypothetical molybdenum cofactor biosy protein B; biosynthesis, structural genomics, UNKN function, NPPSFA; HET: PEG; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1jq5_A Glycerol dehydrogenase; oxidoreductase, NAD, glycerol metabolism; HET: NAD; 1.70A {Geobacillus stearothermophilus} SCOP: e.22.1.2 PDB: 1jpu_A* 1jqa_A* | Back alignment and structure |
|---|
| >3brq_A HTH-type transcriptional regulator ASCG; transcriptional repressor structure escherichia coli, struct genomics, PSI-2; HET: FRU; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >3ksm_A ABC-type sugar transport system, periplasmic COMP; periplasmic component, PSI- 11023L, structural genomics, protein structure initiative; HET: BDR; 1.90A {Hahella chejuensis} | Back alignment and structure |
|---|
| >2fvy_A D-galactose-binding periplasmic protein; periplasmic binding protien, hinge, chemotaxis, transport,; HET: BGC; 0.92A {Escherichia coli} SCOP: c.93.1.1 PDB: 1glg_A* 2fw0_A* 2gbp_A* 2qw1_A* 2hph_A* 2ipn_A* 2ipm_A* 2ipl_A* 1gca_A* 1gcg_A 3ga5_A* 3gbp_A* | Back alignment and structure |
|---|
| >1y5e_A Molybdenum cofactor biosynthesis protein B; structural genomics, protein structure initiative, PSI, MCSG, midwest center for structural genomics; 1.90A {Bacillus cereus} SCOP: c.57.1.1 | Back alignment and structure |
|---|
| >3d8u_A PURR transcriptional regulator; APC91343.1, vibrio parahaem RIMD 2210633, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.88A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3hl0_A Maleylacetate reductase; structur genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE NAD EPE; 1.60A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3gv0_A Transcriptional regulator, LACI family; transcription regulator, PSI-II, structural genomics structure initiative; 2.35A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2qu7_A Putative transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 2.30A {Staphylococcus saprophyticus subsp} | Back alignment and structure |
|---|
| >1dbq_A Purine repressor; transcription regulation, DNA-binding regulatory protein; 2.20A {Escherichia coli} SCOP: c.93.1.1 PDB: 1jhz_A | Back alignment and structure |
|---|
| >3rot_A ABC sugar transporter, periplasmic sugar binding; nysgrc, PSI-biology, structural genomics; 1.91A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3gyb_A Transcriptional regulators (LACI-family transcriptional regulatory protein); protein structure initiative II(PSI II), nysgxrc; 1.60A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2h0a_A TTHA0807, transcriptional regulator; repressor, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1xvl_A Mn transporter, MNTC protein; manganese, ABC-type transport systems, photosynthesis, cyanobacteria, disulfide bond, metal transport; 2.90A {Synechocystis SP} SCOP: c.92.2.2 | Back alignment and structure |
|---|
| >2rjo_A Twin-arginine translocation pathway signal protei; PSI-2, NYSGXRC, twin arginine translocation pathway signal P structural genomics; HET: GAL; 2.05A {Burkholderia phytofirmans} | Back alignment and structure |
|---|
| >3brs_A Periplasmic binding protein/LACI transcriptional; structural genomics, protein structure initiative; 2.00A {Clostridium phytofermentans} | Back alignment and structure |
|---|
| >3gbv_A Putative LACI-family transcriptional regulator; NYSGXRC, PSI-II, 11231J, structur genomics, protein structure initiative; 2.20A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3m9w_A D-xylose-binding periplasmic protein; xylose binding protein, conformational changes, SUGA protein; 2.15A {Escherichia coli} PDB: 3m9x_A* 3ma0_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 144 | ||||
| d1ewka_ | 477 | c.93.1.1 (A:) Metabotropic glutamate receptor subt | 5e-19 |
| >d1ewka_ c.93.1.1 (A:) Metabotropic glutamate receptor subtype 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 477 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Periplasmic binding protein-like I superfamily: Periplasmic binding protein-like I family: L-arabinose binding protein-like domain: Metabotropic glutamate receptor subtype 1 species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 80.0 bits (196), Expect = 5e-19
Identities = 32/84 (38%), Positives = 56/84 (66%)
Query: 1 VSFWSTSPELSNKQRFEYFTRTIPSDHHQVKAMVEIVKKLGWSYVSIIYEESNYGVKAFE 60
+++ +TS +LS+K ++YF R +PSD Q +AM++IVK+ W+YVS ++ E NYG +
Sbjct: 148 IAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMD 207
Query: 61 ELEVLLAKYSICIAIKEKLVKDSG 84
+ L A+ +CIA +K+ ++G
Sbjct: 208 AFKELAAQEGLCIAHSDKIYSNAG 231
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 144 | |||
| d1ewka_ | 477 | Metabotropic glutamate receptor subtype 1 {Rat (Ra | 99.9 | |
| d1dp4a_ | 425 | Hormone binding domain of the atrial natriuretic p | 99.56 | |
| d1jdpa_ | 401 | Hormone binding domain of the atrial natriuretic p | 99.45 | |
| d1usga_ | 346 | Leucine-binding protein {Escherichia coli [TaxId: | 99.3 | |
| d1qo0a_ | 373 | Amide receptor/negative regulator of the amidase o | 99.26 | |
| d3ckma1 | 317 | YraM C-terminal domain {Haemophilus influenzae [Ta | 98.85 | |
| d1vlja_ | 398 | NADH-dependent butanol dehydrogenase A (TM0820) {T | 95.59 | |
| d1rrma_ | 385 | Lactaldehyde reductase FucO {Escherichia coli [Tax | 94.98 | |
| d1o2da_ | 359 | Alcohol dehydrogenase TM0920 {Thermotoga maritima | 94.26 | |
| d1y5ea1 | 155 | MoaB {Bacillus cereus [TaxId: 1396]} | 91.87 | |
| d1jq5a_ | 366 | Glycerol dehydrogenase {Bacillus stearothermophilu | 89.72 | |
| d1mkza_ | 170 | MoaB {Escherichia coli [TaxId: 562]} | 87.55 | |
| d1guda_ | 288 | D-allose-binding protein {Escherichia coli [TaxId: | 86.26 | |
| d1tjya_ | 316 | AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370 | 84.94 | |
| d1dbqa_ | 282 | Purine repressor (PurR), C-terminal domain {Escher | 84.82 | |
| d1uuya_ | 161 | Plant CNX1 G domain {Mouse-ear cress (Arabidopsis | 83.14 | |
| d1byka_ | 255 | Trehalose repressor, C-terminal domain {Escherichi | 81.24 |
| >d1ewka_ c.93.1.1 (A:) Metabotropic glutamate receptor subtype 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Periplasmic binding protein-like I superfamily: Periplasmic binding protein-like I family: L-arabinose binding protein-like domain: Metabotropic glutamate receptor subtype 1 species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.90 E-value=7.4e-24 Score=167.95 Aligned_cols=128 Identities=30% Similarity=0.552 Sum_probs=108.5
Q ss_pred CcccCCCCCCcCCCCCCceEEecCCchHHHHHHHHHHHhCCCcEEEEEEEeCCcchHHHHHHHHHhhhCceEEEEEeccc
Q psy12591 1 VSFWSTSPELSNKQRFEYFTRTIPSDHHQVKAMVEIVKKLGWSYVSIIYEESNYGVKAFEELEVLLAKYSICIAIKEKLV 80 (144)
Q Consensus 1 Is~~at~~~ls~~~~~p~ffRt~p~d~~~~~a~~~ll~~f~W~~Vaii~~~~~~g~~~~~~~~~~l~~~Gi~V~~~~~~~ 80 (144)
|||+++++.|+++..||+||||.|++..|++++++|+++|||++|++|+++++||....+.|++.++++|+||+..+.++
T Consensus 148 IS~~ats~~lsd~~~yp~f~Rt~psd~~~~~ai~~ll~~f~W~~V~vi~~~d~~g~~~~~~l~~~~~~~~i~v~~~~~i~ 227 (477)
T d1ewka_ 148 IAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKELAAQEGLCIAHSDKIY 227 (477)
T ss_dssp EESSCCCGGGGCTTTCTTEEESSCCHHHHHHHHHHHHHHTTCCEEEEEEESSHHHHHHHHHHHHHHHHHTCEEEEEEEEC
T ss_pred eccccCCccccccccCCceEEecccchhhHHHHHHHHHHcCCcEEEEEEecchhHHHHHHHHHHHHHHcCcEEEEEeecc
Confidence 68999999999999999999999999999999999999999999999999999999999999999999999999999997
Q ss_pred CCCCCcchhhHHHHHHHHhcC-CCceEEEEeeEEeeeCCcchhhhhHHHHHHHhcCc
Q psy12591 81 KDSGVAEETAYDDIVLKLLTK-PRARGLFKRLKLVKDSGVAEETAYDDIVLKLLTKP 136 (144)
Q Consensus 81 ~~~~~~~~~~~~~~l~~lk~~-~~arvii~~~~~~~~~g~~~~~~~~~~~~~~~~~~ 136 (144)
... .+.++..++++||.+ .++||||+++. .-....++.++.....++.
T Consensus 228 ~~~---~~~~~~~~l~~l~~~~~~~rVIv~~~~-----~~~~~~ll~~a~~~g~~g~ 276 (477)
T d1ewka_ 228 SNA---GEKSFDRLLRKLRERLPKARVVVCFCE-----GMTVRGLLSAMRRLGVVGE 276 (477)
T ss_dssp TTC---CHHHHHHHHHHHHTTTTTCCEEEEECC-----HHHHHHHHHHHHHHTCCSC
T ss_pred CCC---chhhHHHHHHHHhhhccCceEEEEecC-----HHHHHHHHHHHHHcCccCC
Confidence 765 378999999999842 47999999864 2222334444444444443
|
| >d1dp4a_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jdpa_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1usga_ c.93.1.1 (A:) Leucine-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qo0a_ c.93.1.1 (A:) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d3ckma1 c.93.1.1 (A:257-573) YraM C-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1vlja_ e.22.1.2 (A:) NADH-dependent butanol dehydrogenase A (TM0820) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1rrma_ e.22.1.2 (A:) Lactaldehyde reductase FucO {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1o2da_ e.22.1.2 (A:) Alcohol dehydrogenase TM0920 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1y5ea1 c.57.1.1 (A:12-166) MoaB {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1jq5a_ e.22.1.2 (A:) Glycerol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1mkza_ c.57.1.1 (A:) MoaB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1guda_ c.93.1.1 (A:) D-allose-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tjya_ c.93.1.1 (A:) AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370]} | Back information, alignment and structure |
|---|
| >d1dbqa_ c.93.1.1 (A:) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uuya_ c.57.1.1 (A:) Plant CNX1 G domain {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1byka_ c.93.1.1 (A:) Trehalose repressor, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|