Psyllid ID: psy12591


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140----
VSFWSTSPELSNKQRFEYFTRTIPSDHHQVKAMVEIVKKLGWSYVSIIYEESNYGVKAFEELEVLLAKYSICIAIKEKLVKDSGVAEETAYDDIVLKLLTKPRARGLFKRLKLVKDSGVAEETAYDDIVLKLLTKPRARAVSEI
cccccccccccccccccccEEcccccHHHHHHHHHHHHHcccEEEEEEEEcccHHHHHHHHHHHHHHHccEEEEEEEEcccccccHHHHHHHHHHHHHHcccccEEEEEEEEccccHHHHHHHHHccccccEEEEEcccccccc
cccccccHHcccccccccHEEccccHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHcccEEEEEEEccccccHHHHHHHHHHHHHHHHccccEEEEEEEcccccHHHHHHHHHHHHHHccccccHHHccccc
vsfwstspelsnkqRFEYftrtipsdhHQVKAMVEIVKKLGWSYVSIIYEESNYGVKAFEELEVLLAKYSICIAIKEKlvkdsgvaeetAYDDIVLKLLTKPRARGLFKRLKLVkdsgvaeetaYDDIVLKLLTKPRARAVSEI
vsfwstspelsnkqrFEYFTrtipsdhhqVKAMVEIVKKLGWSYVSIIYEESNYGVKAFEELEVLLAKYSICIAIKEklvkdsgvaeeTAYDDIVLKLltkprarglfkrlklvkdsgvaeetayddivlklltkpraravsei
VSFWSTSPELSNKQRFEYFTRTIPSDHHQVKAMVEIVKKLGWSYVSIIYEESNYGVKAFEELEVLLAKYSICIAIKEKLVKDSGVAEETAYDDIVLKLLTKPRARGLFKRLKLVKDSGVAEETAYDDIVLKLLTKPRARAVSEI
***************FEYFTRTIPSDHHQVKAMVEIVKKLGWSYVSIIYEESNYGVKAFEELEVLLAKYSICIAIKEKLVKDSGVAEETAYDDIVLKLLTKPRARGLFKRLKLVKDSGVAEETAYDDIVLKLLT**********
VSFWSTSPELSNKQRFEYFTRTIPSDHHQVKAMVEIVKKLGWSYVSIIYEESNYGVKAFEELEVLLAKYSICIAIKEKLVKDSGVAEETAYDDIVLKLLTKPRARGLFKRLKLVKDSGVAEETAYDDIVLKLLTKPRARAVS**
*********LSNKQRFEYFTRTIPSDHHQVKAMVEIVKKLGWSYVSIIYEESNYGVKAFEELEVLLAKYSICIAIKEKLVKDSGVAEETAYDDIVLKLLTKPRARGLFKRLKLVKDSGVAEETAYDDIVLKLLTKPRARAVSEI
*SFWSTSPELSNKQRFEYFTRTIPSDHHQVKAMVEIVKKLGWSYVSIIYEESNYGVKAFEELEVLLAKYSICIAIKEKLVKDSGVAEETAYDDIVLKLLTKPRARGLFKRLKLVKDSGVAEETAYDDIVLKLLTKP**R*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VSFWSTSPELSNKQRFEYFTRTIPSDHHQVKAMVEIVKKLGWSYVSIIYEESNYGVKAFEELEVLLAKYSICIAIKEKLVKDSGVAEETAYDDIVLKLLTKPRARGLFKRLKLVKDSGVAEETAYDDIVLKLLTKPRARAVSEI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query144 2.2.26 [Sep-21-2011]
Q9QYS2 879 Metabotropic glutamate re yes N/A 0.708 0.116 0.409 3e-18
P31422 879 Metabotropic glutamate re yes N/A 0.708 0.116 0.409 4e-18
Q14832 879 Metabotropic glutamate re yes N/A 0.708 0.116 0.409 4e-18
Q5RAL3 879 Metabotropic glutamate re yes N/A 0.708 0.116 0.409 4e-18
Q1ZZH1 879 Metabotropic glutamate re N/A N/A 0.708 0.116 0.409 4e-18
P31421 872 Metabotropic glutamate re no N/A 0.708 0.116 0.4 1e-17
Q14BI2 872 Metabotropic glutamate re no N/A 0.708 0.116 0.4 1e-17
Q14416 872 Metabotropic glutamate re no N/A 0.708 0.116 0.4 1e-17
P91685 976 Metabotropic glutamate re no N/A 0.743 0.109 0.428 1e-17
P31424 1203 Metabotropic glutamate re no N/A 0.708 0.084 0.405 2e-17
>sp|Q9QYS2|GRM3_MOUSE Metabotropic glutamate receptor 3 OS=Mus musculus GN=Grm3 PE=2 SV=1 Back     alignment and function desciption
 Score = 90.5 bits (223), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 43/105 (40%), Positives = 64/105 (60%), Gaps = 3/105 (2%)

Query: 1   VSFWSTSPELSNKQRFEYFTRTIPSDHHQVKAMVEIVKKLGWSYVSIIYEESNYGVKAFE 60
           +S+ STS +LS+K R++YF RT+P D +Q KAM EI++   W+YVS +  E +YG    E
Sbjct: 169 ISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRYFNWTYVSTVASEGDYGETGIE 228

Query: 61  ELEVLLAKYSICIAIKEKLVKDSGVAEETAYDDIVLKLLTKPRAR 105
             E      +ICIA  EK+ + +      +YD ++ +LL KP AR
Sbjct: 229 AFEQEARLRNICIATAEKVGRSN---IRKSYDSVIRELLQKPNAR 270




Receptor for glutamate. The activity of this receptor is mediated by a G-protein that inhibits adenylate cyclase activity.
Mus musculus (taxid: 10090)
>sp|P31422|GRM3_RAT Metabotropic glutamate receptor 3 OS=Rattus norvegicus GN=Grm3 PE=1 SV=1 Back     alignment and function description
>sp|Q14832|GRM3_HUMAN Metabotropic glutamate receptor 3 OS=Homo sapiens GN=GRM3 PE=1 SV=2 Back     alignment and function description
>sp|Q5RAL3|GRM3_PONAB Metabotropic glutamate receptor 3 OS=Pongo abelii GN=GRM3 PE=2 SV=1 Back     alignment and function description
>sp|Q1ZZH1|GRM3_MACFA Metabotropic glutamate receptor 3 OS=Macaca fascicularis GN=GRM3 PE=2 SV=1 Back     alignment and function description
>sp|P31421|GRM2_RAT Metabotropic glutamate receptor 2 OS=Rattus norvegicus GN=Grm2 PE=1 SV=1 Back     alignment and function description
>sp|Q14BI2|GRM2_MOUSE Metabotropic glutamate receptor 2 OS=Mus musculus GN=Grm2 PE=2 SV=2 Back     alignment and function description
>sp|Q14416|GRM2_HUMAN Metabotropic glutamate receptor 2 OS=Homo sapiens GN=GRM2 PE=2 SV=2 Back     alignment and function description
>sp|P91685|GRM_DROME Metabotropic glutamate receptor OS=Drosophila melanogaster GN=mGluRA PE=1 SV=2 Back     alignment and function description
>sp|P31424|GRM5_RAT Metabotropic glutamate receptor 5 OS=Rattus norvegicus GN=Grm5 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query144
383855430 2033 PREDICTED: uncharacterized protein LOC10 0.736 0.052 0.886 5e-49
442622906 1472 mangetout, isoform G [Drosophila melanog 0.736 0.072 0.858 1e-48
221330059 1248 mangetout, isoform F [Drosophila melanog 0.736 0.084 0.858 1e-48
221330057 1095 mangetout, isoform E [Drosophila melanog 0.736 0.096 0.858 1e-48
221330055 1415 mangetout, isoform D [Drosophila melanog 0.736 0.074 0.858 1e-48
195332500 1292 GM20683 [Drosophila sechellia] gi|194124 0.736 0.082 0.858 1e-48
194863463 1259 GG10638 [Drosophila erecta] gi|190662320 0.736 0.084 0.858 1e-48
42538965 1073 metabotropic X receptor [Drosophila mela 0.736 0.098 0.858 1e-48
195474735 1306 GE22975 [Drosophila yakuba] gi|194175746 0.736 0.081 0.858 2e-48
194753055 1293 GF12584 [Drosophila ananassae] gi|190620 0.736 0.081 0.858 2e-48
>gi|383855430|ref|XP_003703215.1| PREDICTED: uncharacterized protein LOC100881789 [Megachile rotundata] Back     alignment and taxonomy information
 Score =  198 bits (504), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 94/106 (88%), Positives = 102/106 (96%)

Query: 1    VSFWSTSPELSNKQRFEYFTRTIPSDHHQVKAMVEIVKKLGWSYVSIIYEESNYGVKAFE 60
            VSF+STSPELSNKQRFEYFTRTIPSDH+QVKAM++IV K+GWSYVSIIYEESNYG+KAFE
Sbjct: 1225 VSFFSTSPELSNKQRFEYFTRTIPSDHYQVKAMIDIVLKMGWSYVSIIYEESNYGIKAFE 1284

Query: 61   ELEVLLAKYSICIAIKEKLVKDSGVAEETAYDDIVLKLLTKPRARG 106
            ELE LL K+ ICIAIKEKLVKDSGVAEETAYD+IVLKLLTKPRARG
Sbjct: 1285 ELEELLGKHDICIAIKEKLVKDSGVAEETAYDNIVLKLLTKPRARG 1330




Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|442622906|ref|NP_001260806.1| mangetout, isoform G [Drosophila melanogaster] gi|440214203|gb|AGB93339.1| mangetout, isoform G [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|221330059|ref|NP_724683.2| mangetout, isoform F [Drosophila melanogaster] gi|220902130|gb|AAF59082.3| mangetout, isoform F [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|221330057|ref|NP_610386.2| mangetout, isoform E [Drosophila melanogaster] gi|220902129|gb|AAF59081.3| mangetout, isoform E [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|221330055|ref|NP_001137619.1| mangetout, isoform D [Drosophila melanogaster] gi|220902128|gb|ACL83073.1| mangetout, isoform D [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195332500|ref|XP_002032935.1| GM20683 [Drosophila sechellia] gi|194124905|gb|EDW46948.1| GM20683 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|194863463|ref|XP_001970453.1| GG10638 [Drosophila erecta] gi|190662320|gb|EDV59512.1| GG10638 [Drosophila erecta] Back     alignment and taxonomy information
>gi|42538965|emb|CAE46392.1| metabotropic X receptor [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195474735|ref|XP_002089645.1| GE22975 [Drosophila yakuba] gi|194175746|gb|EDW89357.1| GE22975 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|194753055|ref|XP_001958834.1| GF12584 [Drosophila ananassae] gi|190620132|gb|EDV35656.1| GF12584 [Drosophila ananassae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query144
FB|FBgn0050361 1415 mtt "mangetout" [Drosophila me 0.736 0.074 0.858 1e-43
UNIPROTKB|Q2PNZ6 535 GRM3 "Metabotropic glutamate r 0.708 0.190 0.419 2.8e-18
UNIPROTKB|G5E9K2 537 GRM3 "Glutamate receptor, meta 0.708 0.189 0.419 2.9e-18
UNIPROTKB|F5GYZ2 751 GRM3 "Metabotropic glutamate r 0.708 0.135 0.419 7.8e-18
UNIPROTKB|C9J2I2171 GRM3 "Metabotropic glutamate r 0.708 0.596 0.419 9.5e-18
UNIPROTKB|E1BUE5 879 GRM3 "Uncharacterized protein" 0.708 0.116 0.419 1e-17
MGI|MGI:1351340 879 Grm3 "glutamate receptor, meta 0.708 0.116 0.419 1.3e-17
UNIPROTKB|Q14832 879 GRM3 "Metabotropic glutamate r 0.708 0.116 0.419 1.3e-17
UNIPROTKB|A5D7D8 879 GRM3 "GRM3 protein" [Bos tauru 0.708 0.116 0.419 1.6e-17
RGD|2744 879 Grm3 "glutamate receptor, meta 0.708 0.116 0.419 1.6e-17
FB|FBgn0050361 mtt "mangetout" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 474 (171.9 bits), Expect = 1.0e-43, P = 1.0e-43
 Identities = 91/106 (85%), Positives = 103/106 (97%)

Query:     1 VSFWSTSPELSNKQRFEYFTRTIPSDHHQVKAMVEIVKKLGWSYVSIIYEESNYGVKAFE 60
             VS++STSPELSNKQRFEYF+RTIPSDH+QVKAMVEIVK++GWSYVSIIYEESNYG+KAFE
Sbjct:   517 VSYFSTSPELSNKQRFEYFSRTIPSDHYQVKAMVEIVKRMGWSYVSIIYEESNYGIKAFE 576

Query:    61 ELEVLLAKYSICIAIKEKLVKDSGVAEETAYDDIVLKLLTKPRARG 106
             ELE LLA+++ICIAIKEKLVKDSGVAE+ AYD+IV KLLTKPRARG
Sbjct:   577 ELEELLARHNICIAIKEKLVKDSGVAEDIAYDNIVQKLLTKPRARG 622


GO:0016021 "integral to membrane" evidence=ISS
GO:0016595 "glutamate binding" evidence=ISS;IDA
GO:0007200 "phospholipase C-activating G-protein coupled receptor signaling pathway" evidence=IDA
GO:0004930 "G-protein coupled receptor activity" evidence=IDA
GO:0008066 "glutamate receptor activity" evidence=IDA
GO:0030425 "dendrite" evidence=IDA
GO:0017085 "response to insecticide" evidence=IMP;IDA
GO:0008343 "adult feeding behavior" evidence=IMP
UNIPROTKB|Q2PNZ6 GRM3 "Metabotropic glutamate receptor 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G5E9K2 GRM3 "Glutamate receptor, metabotropic 3, isoform CRA_a" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F5GYZ2 GRM3 "Metabotropic glutamate receptor 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|C9J2I2 GRM3 "Metabotropic glutamate receptor 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BUE5 GRM3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1351340 Grm3 "glutamate receptor, metabotropic 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q14832 GRM3 "Metabotropic glutamate receptor 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A5D7D8 GRM3 "GRM3 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|2744 Grm3 "glutamate receptor, metabotropic 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query144
cd06362 452 cd06362, PBP1_mGluR, Ligand binding domain of the 1e-46
cd06350348 cd06350, PBP1_GPCR_family_C_like, Ligand-binding d 7e-29
cd06375 458 cd06375, PBP1_mGluR_groupII, Ligand binding domain 9e-28
cd06374 472 cd06374, PBP1_mGluR_groupI, Ligand binding domain 1e-26
cd06269298 cd06269, PBP1_glutamate_receptors_like, Family C G 6e-23
cd06376 463 cd06376, PBP1_mGluR_groupIII, Ligand-binding domai 4e-22
pfam01094 343 pfam01094, ANF_receptor, Receptor family ligand bi 7e-22
cd06363 410 cd06363, PBP1_Taste_receptor, Ligand-binding domai 5e-19
cd06366 350 cd06366, PBP1_GABAb_receptor, Ligand-binding domai 9e-19
cd06361 403 cd06361, PBP1_GPC6A_like, Ligand-binding domain of 2e-18
cd04509299 cd04509, PBP1_ABC_transporter_GCPR_C_like, Family 5e-14
cd06364 510 cd06364, PBP1_CaSR, Ligand-binding domain of the C 6e-13
cd06346312 cd06346, PBP1_ABC_ligand_binding_like_11, Type I p 2e-10
cd06352 389 cd06352, PBP1_NPR_GC_like, Ligand-binding domain o 1e-08
cd01391269 cd01391, Periplasmic_Binding_Protein_Type_1, Type 1e-08
cd06365 469 cd06365, PBP1_Pheromone_receptor, Ligand-binding d 1e-06
cd06268298 cd06268, PBP1_ABC_transporter_LIVBP_like, Periplas 2e-06
cd06370 404 cd06370, PBP1_Speract_GC_like, Ligand-binding doma 2e-05
cd06351328 cd06351, PBP1_iGluR_N_LIVBP_like, N-terminal leuci 6e-05
cd06340 347 cd06340, PBP1_ABC_ligand_binding_like_6, Type I pe 1e-04
cd06344332 cd06344, PBP1_ABC_ligand_binding_like_9, Type I pe 1e-04
COG0683 366 COG0683, LivK, ABC-type branched-chain amino acid 9e-04
>gnl|CDD|107357 cd06362, PBP1_mGluR, Ligand binding domain of the metabotropic glutamate receptors (mGluR) Back     alignment and domain information
 Score =  156 bits (397), Expect = 1e-46
 Identities = 55/110 (50%), Positives = 72/110 (65%), Gaps = 5/110 (4%)

Query: 1   VSFWSTSPELSNKQRFEYFTRTIPSDHHQVKAMVEIVKKLGWSYVSIIYEESNYGVKAFE 60
           +S+ STSPELS+K R++YF+RT+P D  Q +AMV+IVK   W+YVS +  E NYG K  E
Sbjct: 131 ISYASTSPELSDKTRYDYFSRTVPPDSFQAQAMVDIVKAFNWTYVSTVASEGNYGEKGIE 190

Query: 61  ELEVLLAKYSICIAIKEKLVKDSGVAEETAYDDIVLKLLTKPRARG--LF 108
             E L A+  ICIA  EK+      A E  +D+I+ KLL+KP AR   LF
Sbjct: 191 AFEKLAAERGICIAGSEKIPSS---ATEEEFDNIIRKLLSKPNARVVVLF 237


Ligand binding domain of the metabotropic glutamate receptors (mGluR), which are members of the family C of G-protein-coupled receptors that transduce extracellular signals into G-protein activation and ultimately into cellular responses. mGluRs bind to glutamate and function as an excitatory neurotransmitter; they are involved in learning, memory, anxiety, and the perception of pain. Eight subtypes of mGluRs have been cloned so far, and are classified into three groups according to their sequence similarities, transduction mechanisms, and pharmacological profiles. Group I is composed of mGlu1R and mGlu5R that both stimulate PLC hydrolysis. Group II includes mGlu2R and mGlu3R, which inhibit adenylyl cyclase, as do mGlu4R, mGlu6R, mGlu7R, and mGlu8R, which form group III. Length = 452

>gnl|CDD|153138 cd06350, PBP1_GPCR_family_C_like, Ligand-binding domain of membrane-bound glutamate receptors that mediate excitatory transmission on the cellular surface through initial binding of glutamate and are categorized into ionotropic glutamate receptors (iGluRs) and metabotropic glutamate receptors (mGluRs) Back     alignment and domain information
>gnl|CDD|107370 cd06375, PBP1_mGluR_groupII, Ligand binding domain of the group II metabotropic glutamate receptor Back     alignment and domain information
>gnl|CDD|107369 cd06374, PBP1_mGluR_groupI, Ligand binding domain of the group I metabotropic glutamate receptor Back     alignment and domain information
>gnl|CDD|153137 cd06269, PBP1_glutamate_receptors_like, Family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein (LIVBP)-like domain of the ionotropic glutamate receptors Back     alignment and domain information
>gnl|CDD|107371 cd06376, PBP1_mGluR_groupIII, Ligand-binding domain of the group III metabotropic glutamate receptor Back     alignment and domain information
>gnl|CDD|216296 pfam01094, ANF_receptor, Receptor family ligand binding region Back     alignment and domain information
>gnl|CDD|107358 cd06363, PBP1_Taste_receptor, Ligand-binding domain of the T1R taste receptor Back     alignment and domain information
>gnl|CDD|107361 cd06366, PBP1_GABAb_receptor, Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA) Back     alignment and domain information
>gnl|CDD|107356 cd06361, PBP1_GPC6A_like, Ligand-binding domain of the promiscuous L-alpha-amino acid receptor GPRC6A which is a broad-spectrum amino acid-sensing receptor Back     alignment and domain information
>gnl|CDD|107261 cd04509, PBP1_ABC_transporter_GCPR_C_like, Family C of G-protein coupled receptors and their close homologs, the type I periplasmic-binding proteins of ATP-binding cassette transporter-like systems Back     alignment and domain information
>gnl|CDD|107359 cd06364, PBP1_CaSR, Ligand-binding domain of the CaSR calcium-sensing receptor, which is a member of the family C receptors within the G-protein coupled receptor superfamily Back     alignment and domain information
>gnl|CDD|107341 cd06346, PBP1_ABC_ligand_binding_like_11, Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>gnl|CDD|107347 cd06352, PBP1_NPR_GC_like, Ligand-binding domain of membrane guanylyl-cyclase receptors Back     alignment and domain information
>gnl|CDD|107248 cd01391, Periplasmic_Binding_Protein_Type_1, Type 1 periplasmic binding fold superfamily Back     alignment and domain information
>gnl|CDD|107360 cd06365, PBP1_Pheromone_receptor, Ligand-binding domain of the V2R phermone receptor, a member of the family C receptors within the G-protein coupled receptor superfamily Back     alignment and domain information
>gnl|CDD|107263 cd06268, PBP1_ABC_transporter_LIVBP_like, Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily Back     alignment and domain information
>gnl|CDD|107365 cd06370, PBP1_Speract_GC_like, Ligand-binding domain of membrane bound guanylyl cyclases Back     alignment and domain information
>gnl|CDD|107346 cd06351, PBP1_iGluR_N_LIVBP_like, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NMDA, AMPA, and kainate receptor subtypes of ionotropic glutamate receptors (iGluRs) Back     alignment and domain information
>gnl|CDD|107335 cd06340, PBP1_ABC_ligand_binding_like_6, Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>gnl|CDD|107339 cd06344, PBP1_ABC_ligand_binding_like_9, Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>gnl|CDD|223755 COG0683, LivK, ABC-type branched-chain amino acid transport systems, periplasmic component [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 144
cd06375 458 PBP1_mGluR_groupII Ligand binding domain of the gr 99.9
cd06365 469 PBP1_Pheromone_receptor Ligand-binding domain of t 99.9
cd06361 403 PBP1_GPC6A_like Ligand-binding domain of the promi 99.9
KOG1056|consensus 878 99.88
cd06364 510 PBP1_CaSR Ligand-binding domain of the CaSR calciu 99.87
cd06374 472 PBP1_mGluR_groupI Ligand binding domain of the gro 99.86
cd06379 377 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/ 99.84
cd06362 452 PBP1_mGluR Ligand binding domain of the metabotrop 99.84
cd06376 463 PBP1_mGluR_groupIII Ligand-binding domain of the g 99.83
cd06367 362 PBP1_iGluR_NMDA N-terminal leucine/isoleucine/vali 99.81
cd06350348 PBP1_GPCR_family_C_like Ligand-binding domain of m 99.79
cd06371 382 PBP1_sensory_GC_DEF_like Ligand-binding domain of 99.77
cd06363 410 PBP1_Taste_receptor Ligand-binding domain of the T 99.77
cd06386 387 PBP1_NPR_C_like Ligand-binding domain of type C na 99.77
cd06366 350 PBP1_GABAb_receptor Ligand-binding domain of GABAb 99.75
cd06370 404 PBP1_Speract_GC_like Ligand-binding domain of memb 99.72
cd06269298 PBP1_glutamate_receptors_like Family C G-protein c 99.72
cd06385 405 PBP1_NPR_A Ligand-binding domain of type A natriur 99.71
cd06378 362 PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/ 99.69
PF01094 348 ANF_receptor: Receptor family ligand binding regio 99.68
cd06373 396 PBP1_NPR_like Ligand binding domain of natriuretic 99.66
cd06384 399 PBP1_NPR_B Ligand-binding domain of type B natriur 99.66
cd06346312 PBP1_ABC_ligand_binding_like_11 Type I periplasmic 99.66
cd06352 389 PBP1_NPR_GC_like Ligand-binding domain of membrane 99.63
cd06372 391 PBP1_GC_G_like Ligand-binding domain of membrane g 99.59
cd06338 345 PBP1_ABC_ligand_binding_like_5 Type I periplasmic 99.55
cd06345 344 PBP1_ABC_ligand_binding_like_10 Type I periplasmic 99.52
cd06393 384 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isol 99.51
cd06342 334 PBP1_ABC_LIVBP_like Type I periplasmic ligand-bind 99.47
cd06343 362 PBP1_ABC_ligand_binding_like_8 Type I periplasmic 99.46
cd06380 382 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/vali 99.46
cd06340 347 PBP1_ABC_ligand_binding_like_6 Type I periplasmic 99.45
cd06336 347 PBP1_ABC_ligand_binding_like_3 Type I periplasmic 99.45
cd06382 327 PBP1_iGluR_Kainate N-terminal leucine/isoleucine/v 99.44
cd06390 364 PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucin 99.42
cd06329342 PBP1_SBP_like_3 Periplasmic solute-binding domain 99.41
cd06335 347 PBP1_ABC_ligand_binding_like_2 Type I periplasmic 99.4
cd06334 351 PBP1_ABC_ligand_binding_like_1 Type I periplasmic 99.4
cd06368 324 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleu 99.4
PRK15404 369 leucine ABC transporter subunit substrate-binding 99.39
cd06383 368 PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine 99.39
cd04509299 PBP1_ABC_transporter_GCPR_C_like Family C of G-pro 99.39
cd06349 340 PBP1_ABC_ligand_binding_like_14 Type I periplasmic 99.39
cd06351 328 PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleuc 99.39
cd06327 334 PBP1_SBP_like_1 Periplasmic solute-binding domain 99.38
cd06360 336 PBP1_alkylbenzenes_like Type I periplasmic binding 99.37
cd06344332 PBP1_ABC_ligand_binding_like_9 Type I periplasmic 99.36
COG0683 366 LivK ABC-type branched-chain amino acid transport 99.33
cd06347 334 PBP1_ABC_ligand_binding_like_12 Type I periplasmic 99.32
cd06328 333 PBP1_SBP_like_2 Periplasmic solute-binding domain 99.31
cd06330 346 PBP1_Arsenic_SBP_like Periplasmic solute-binding d 99.31
KOG1055|consensus 865 99.3
cd06391 400 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/v 99.3
cd06348 344 PBP1_ABC_ligand_binding_like_13 Type I periplasmic 99.29
cd06389 370 PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucin 99.22
cd06359 333 PBP1_Nba_like Type I periplasmic binding component 99.16
cd06332 333 PBP1_aromatic_compounds_like Type I periplasmic bi 99.14
cd06268298 PBP1_ABC_transporter_LIVBP_like Periplasmic bindin 99.13
TIGR03863 347 PQQ_ABC_bind ABC transporter, substrate binding pr 99.13
cd06339 336 PBP1_YraM_LppC_lipoprotein_like Periplasmic bindin 99.13
cd06333312 PBP1_ABC-type_HAAT_like Type I periplasmic binding 99.11
cd06355 348 PBP1_FmdD_like Periplasmic component (FmdD) of an 99.11
cd06331 333 PBP1_AmiC_like Type I periplasmic components of am 99.09
cd06326 336 PBP1_STKc_like Type I periplasmic binding domain o 99.07
cd06394 333 PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleu 99.06
cd06358 333 PBP1_NHase Type I periplasmic-binding protein of t 99.04
TIGR03407 359 urea_ABC_UrtA urea ABC transporter, urea binding p 99.03
KOG4440|consensus 993 99.02
TIGR03669 374 urea_ABC_arch urea ABC transporter, substrate-bind 98.99
cd06337 357 PBP1_ABC_ligand_binding_like_4 Type I periplasmic 98.98
cd06388 371 PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucin 98.98
cd06356 334 PBP1_Amide_Urea_BP_like Periplasmic component (Fmd 98.97
PF13458 343 Peripla_BP_6: Periplasmic binding protein; PDB: 4E 98.96
cd06387 372 PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucin 98.89
cd06392 400 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/v 98.79
cd06341 341 PBP1_ABC_ligand_binding_like_7 Type I periplasmic 98.68
cd06357 360 PBP1_AmiC Periplasmic binding domain of amidase (A 98.64
cd06381 363 PBP1_iGluR_delta_like N-terminal leucine/isoleucin 98.59
cd06377 382 PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/ 98.51
cd01391269 Periplasmic_Binding_Protein_Type_1 Type 1 periplas 98.51
PF13433 363 Peripla_BP_5: Periplasmic binding protein domain; 98.06
KOG1053|consensus 1258 97.78
cd06369 380 PBP1_GC_C_enterotoxin_receptor Ligand-binding doma 97.42
KOG1054|consensus 897 97.04
TIGR02990239 ectoine_eutA ectoine utilization protein EutA. Mem 96.55
PF04348536 LppC: LppC putative lipoprotein; InterPro: IPR0074 95.14
cd01537264 PBP1_Repressors_Sugar_Binding_like Ligand-binding 95.14
cd01536267 PBP1_ABC_sugar_binding_like Periplasmic sugar-bind 94.86
PRK09860 383 putative alcohol dehydrogenase; Provisional 94.74
cd08192 370 Fe-ADH7 Iron-containing alcohol dehydrogenases-lik 94.43
COG1454 377 EutG Alcohol dehydrogenase, class IV [Energy produ 94.42
cd08190 414 HOT Hydroxyacid-oxoacid transhydrogenase (HOT) inv 94.11
cd08551 370 Fe-ADH iron-containing alcohol dehydrogenases (Fe- 94.1
PRK15454 395 ethanol dehydrogenase EutG; Provisional 93.99
PRK10624 382 L-1,2-propanediol oxidoreductase; Provisional 93.9
cd06325281 PBP1_ABC_uncharacterized_transporter Type I peripl 93.66
cd08193 376 HVD 5-hydroxyvalerate dehydrogenase (HVD) catalyze 93.65
PF00465 366 Fe-ADH: Iron-containing alcohol dehydrogenase ; In 93.46
cd08189 374 Fe-ADH5 Iron-containing alcohol dehydrogenases-lik 93.36
cd06267264 PBP1_LacI_sugar_binding_like Ligand binding domain 93.31
cd08194 375 Fe-ADH6 Iron-containing alcohol dehydrogenases-lik 93.13
cd06282266 PBP1_GntR_like_2 Ligand-binding domain of putative 92.88
cd08185 380 Fe-ADH1 Iron-containing alcohol dehydrogenases-lik 92.66
TIGR02638 379 lactal_redase lactaldehyde reductase. This clade o 92.64
cd08188 377 Fe-ADH4 Iron-containing alcohol dehydrogenases-lik 92.14
KOG3857|consensus 465 91.99
cd08176 377 LPO Lactadehyde:propanediol oxidoreductase (LPO) c 91.23
cd08191 386 HHD 6-hydroxyhexanoate dehydrogenase (HHD) catalyz 91.11
cd06300272 PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-bi 90.96
cd08181 357 PPD-like 1,3-propanediol dehydrogenase-like (PPD). 90.91
cd08182 367 HEPD Hydroxyethylphosphoate dehydrogenase (HEPD) c 90.83
cd08170 351 GlyDH Glycerol dehydrogenases (GlyDH) catalyzes ox 90.32
cd08187 382 BDH Butanol dehydrogenase catalyzes the conversion 90.1
cd08171 345 GlyDH-like2 Glycerol dehydrogenase-like. Glycerol 89.36
PF13685 250 Fe-ADH_2: Iron-containing alcohol dehydrogenase; P 89.08
cd07766 332 DHQ_Fe-ADH Dehydroquinate synthase-like (DHQ-like) 88.77
cd08186 383 Fe-ADH8 Iron-containing alcohol dehydrogenase. Typ 88.68
cd06273268 PBP1_GntR_like_1 This group includes the ligand-bi 88.44
PRK09423 366 gldA glycerol dehydrogenase; Provisional 87.41
cd08550 349 GlyDH-like Glycerol_dehydrogenase-like. Families o 87.01
cd08183 374 Fe-ADH2 Iron-containing alcohol dehydrogenases-lik 85.32
TIGR02667163 moaB_proteo molybdenum cofactor biosynthesis prote 85.04
cd06320275 PBP1_allose_binding Periplasmic allose-binding dom 84.8
cd0336479 TOPRIM_DnaG_primases TOPRIM_DnaG_primases: The top 84.5
cd08179 375 NADPH_BDH NADPH-dependent butanol dehydrogenase in 84.4
cd06323268 PBP1_ribose_binding Periplasmic sugar-binding doma 84.28
cd08178 398 AAD_C C-terminal alcohol dehydrogenase domain of t 83.98
cd06278266 PBP1_LacI_like_2 Ligand-binding domain of uncharac 82.51
COG2984322 ABC-type uncharacterized transport system, peripla 82.48
cd06353 258 PBP1_BmpA_Med_like Periplasmic binding domain of t 82.31
cd08175 348 G1PDH Glycerol-1-phosphate dehydrogenase (G1PDH) c 82.01
TIGR01481329 ccpA catabolite control protein A. Catabolite cont 81.77
cd06301 272 PBP1_rhizopine_binding_like Periplasmic binding pr 81.69
cd08180 332 PDD 1,3-propanediol dehydrogenase (PPD) catalyzes 81.41
cd00886152 MogA_MoaB MogA_MoaB family. Members of this family 81.35
PF13407 257 Peripla_BP_4: Periplasmic binding protein domain; 80.93
cd06310 273 PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-bi 80.7
PF13607138 Succ_CoA_lig: Succinyl-CoA ligase like flavodoxin 80.67
cd06284267 PBP1_LacI_like_6 Ligand-binding domain of an uncha 80.44
>cd06375 PBP1_mGluR_groupII Ligand binding domain of the group II metabotropic glutamate receptor Back     alignment and domain information
Probab=99.90  E-value=2.1e-23  Score=168.71  Aligned_cols=138  Identities=34%  Similarity=0.551  Sum_probs=118.4

Q ss_pred             CcccCCCCCCcCCCCCCceEEecCCchHHHHHHHHHHHhCCCcEEEEEEEeCCcchHHHHHHHHHhhhCceEEEEEeccc
Q psy12591          1 VSFWSTSPELSNKQRFEYFTRTIPSDHHQVKAMVEIVKKLGWSYVSIIYEESNYGVKAFEELEVLLAKYSICIAIKEKLV   80 (144)
Q Consensus         1 Is~~at~~~ls~~~~~p~ffRt~p~d~~~~~a~~~ll~~f~W~~Vaii~~~~~~g~~~~~~~~~~l~~~Gi~V~~~~~~~   80 (144)
                      ||++++++.|+++.+|||||||.|+|..|+.++++++++|+|+||++|+++++||...++.|.+.+++.|+||+..+.++
T Consensus       133 Is~~sts~~Ls~~~~~~~ffRt~psd~~qa~ai~~ll~~~~W~~Vaii~~~~~yG~~~~~~~~~~~~~~gi~i~~~~~i~  212 (458)
T cd06375         133 ISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNICIATSEKVG  212 (458)
T ss_pred             eeeccCChhhcccccCCCeEEecCCcHHHHHHHHHHHHHCCCeEEEEEEeCchHHHHHHHHHHHHHHHCCeeEEEEEEec
Confidence            68899999999988899999999999999999999999999999999999999999999999999999999999999897


Q ss_pred             CCCCCcchhhHHHHHHHHhcCCCceEEEEee-------------------EEeeeCCcchhh-h----hHHHHHHHhcCc
Q psy12591         81 KDSGVAEETAYDDIVLKLLTKPRARGLFKRL-------------------KLVKDSGVAEET-A----YDDIVLKLLTKP  136 (144)
Q Consensus        81 ~~~~~~~~~~~~~~l~~lk~~~~arvii~~~-------------------~~~~~~g~~~~~-~----~~~~~~~~~~~~  136 (144)
                      ..+   .+.++..+|++|++.+++||||++.                   .|+..+||.... .    -+.++|.+++.|
T Consensus       213 ~~~---~~~d~~~~l~~l~~~~~a~vVvl~~~~~~~~~ll~~a~~~g~~~~wigs~~~~~~~~~~~~~~~~~~G~i~~~~  289 (458)
T cd06375         213 RSA---DRKSYDSVIRKLLQKPNARVVVLFTRSEDARELLAAAKRLNASFTWVASDGWGAQESIVKGSEDVAEGAITIEL  289 (458)
T ss_pred             CCC---CHHHHHHHHHHHhccCCCEEEEEecChHHHHHHHHHHHHcCCcEEEEEeccccccchhhhccchhhceEEEEEe
Confidence            654   3689999999998457899999874                   468888886542 2    236777777777


Q ss_pred             ccccc
Q psy12591        137 RARAV  141 (144)
Q Consensus       137 ~~~~~  141 (144)
                      +..-+
T Consensus       290 ~~~~i  294 (458)
T cd06375         290 ASHPI  294 (458)
T ss_pred             ccccc
Confidence            66443



Ligand binding domain of the group II metabotropic glutamate receptor, a family that contains mGlu2R and mGlu3R, all of which inhibit adenylyl cyclase. The metabotropic glutamate receptor is a member of the family C of G-protein-coupled receptors that transduce extracellular signals into G-protein activation and ultimately into intracellular responses. The mGluRs are classified into three groups which comprise eight subtypes

>cd06365 PBP1_Pheromone_receptor Ligand-binding domain of the V2R phermone receptor, a member of the family C receptors within the G-protein coupled receptor superfamily Back     alignment and domain information
>cd06361 PBP1_GPC6A_like Ligand-binding domain of the promiscuous L-alpha-amino acid receptor GPRC6A which is a broad-spectrum amino acid-sensing receptor Back     alignment and domain information
>KOG1056|consensus Back     alignment and domain information
>cd06364 PBP1_CaSR Ligand-binding domain of the CaSR calcium-sensing receptor, which is a member of the family C receptors within the G-protein coupled receptor superfamily Back     alignment and domain information
>cd06374 PBP1_mGluR_groupI Ligand binding domain of the group I metabotropic glutamate receptor Back     alignment and domain information
>cd06379 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR1, an essential channel-forming subunit of the NMDA receptor Back     alignment and domain information
>cd06362 PBP1_mGluR Ligand binding domain of the metabotropic glutamate receptors (mGluR) Back     alignment and domain information
>cd06376 PBP1_mGluR_groupIII Ligand-binding domain of the group III metabotropic glutamate receptor Back     alignment and domain information
>cd06367 PBP1_iGluR_NMDA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the ionotropic N-methyl-d-asparate (NMDA) subtype of glutamate receptors Back     alignment and domain information
>cd06350 PBP1_GPCR_family_C_like Ligand-binding domain of membrane-bound glutamate receptors that mediate excitatory transmission on the cellular surface through initial binding of glutamate and are categorized into ionotropic glutamate receptors (iGluRs) and metabotropic glutamate receptors (mGluRs) Back     alignment and domain information
>cd06371 PBP1_sensory_GC_DEF_like Ligand-binding domain of membrane guanylyl cyclases (GC-D, GC-E, and GC-F) that are specifically expressed in sensory tissues Back     alignment and domain information
>cd06363 PBP1_Taste_receptor Ligand-binding domain of the T1R taste receptor Back     alignment and domain information
>cd06386 PBP1_NPR_C_like Ligand-binding domain of type C natriuretic peptide receptor Back     alignment and domain information
>cd06366 PBP1_GABAb_receptor Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA) Back     alignment and domain information
>cd06370 PBP1_Speract_GC_like Ligand-binding domain of membrane bound guanylyl cyclases Back     alignment and domain information
>cd06269 PBP1_glutamate_receptors_like Family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein (LIVBP)-like domain of the ionotropic glutamate receptors Back     alignment and domain information
>cd06385 PBP1_NPR_A Ligand-binding domain of type A natriuretic peptide receptor Back     alignment and domain information
>cd06378 PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR2 subunit of NMDA receptor family Back     alignment and domain information
>PF01094 ANF_receptor: Receptor family ligand binding region The Prosite family is a sub-family of the Pfam family; InterPro: IPR001828 This describes a ligand binding domain and includes extracellular ligand binding domains of a wide range of receptors, as well as the bacterial amino acid binding proteins of known structure [] Back     alignment and domain information
>cd06373 PBP1_NPR_like Ligand binding domain of natriuretic peptide receptor (NPR) family Back     alignment and domain information
>cd06384 PBP1_NPR_B Ligand-binding domain of type B natriuretic peptide receptor Back     alignment and domain information
>cd06346 PBP1_ABC_ligand_binding_like_11 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06352 PBP1_NPR_GC_like Ligand-binding domain of membrane guanylyl-cyclase receptors Back     alignment and domain information
>cd06372 PBP1_GC_G_like Ligand-binding domain of membrane guanylyl cyclase G Back     alignment and domain information
>cd06338 PBP1_ABC_ligand_binding_like_5 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06345 PBP1_ABC_ligand_binding_like_10 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06393 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR5-7 subunits of Kainate receptor Back     alignment and domain information
>cd06342 PBP1_ABC_LIVBP_like Type I periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems that are involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine) Back     alignment and domain information
>cd06343 PBP1_ABC_ligand_binding_like_8 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06380 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the AMPA receptor Back     alignment and domain information
>cd06340 PBP1_ABC_ligand_binding_like_6 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06336 PBP1_ABC_ligand_binding_like_3 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06382 PBP1_iGluR_Kainate N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors Back     alignment and domain information
>cd06390 PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR1 subunit of the AMPA receptor Back     alignment and domain information
>cd06329 PBP1_SBP_like_3 Periplasmic solute-binding domain of active transport proteins Back     alignment and domain information
>cd06335 PBP1_ABC_ligand_binding_like_2 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06334 PBP1_ABC_ligand_binding_like_1 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06368 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors Back     alignment and domain information
>PRK15404 leucine ABC transporter subunit substrate-binding protein LivK; Provisional Back     alignment and domain information
>cd06383 PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors Back     alignment and domain information
>cd04509 PBP1_ABC_transporter_GCPR_C_like Family C of G-protein coupled receptors and their close homologs, the type I periplasmic-binding proteins of ATP-binding cassette transporter-like systems Back     alignment and domain information
>cd06349 PBP1_ABC_ligand_binding_like_14 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems Back     alignment and domain information
>cd06351 PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NMDA, AMPA, and kainate receptor subtypes of ionotropic glutamate receptors (iGluRs) Back     alignment and domain information
>cd06327 PBP1_SBP_like_1 Periplasmic solute-binding domain of active transport proteins that belong to the type I periplasmic binding fold protein family Back     alignment and domain information
>cd06360 PBP1_alkylbenzenes_like Type I periplasmic binding component of active transport systems that are predicted be involved in anaerobic biodegradation of alkylbenzenes such as toluene and ethylbenzene Back     alignment and domain information
>cd06344 PBP1_ABC_ligand_binding_like_9 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>COG0683 LivK ABC-type branched-chain amino acid transport systems, periplasmic component [Amino acid transport and metabolism] Back     alignment and domain information
>cd06347 PBP1_ABC_ligand_binding_like_12 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06328 PBP1_SBP_like_2 Periplasmic solute-binding domain of active transport proteins found in gram-negative and gram-positive bacteria Back     alignment and domain information
>cd06330 PBP1_Arsenic_SBP_like Periplasmic solute-binding domain of active transport proteins Back     alignment and domain information
>KOG1055|consensus Back     alignment and domain information
>cd06391 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta2 receptor of an orphan glutamate receptor family Back     alignment and domain information
>cd06348 PBP1_ABC_ligand_binding_like_13 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06389 PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR2 subunit of the AMPA receptor Back     alignment and domain information
>cd06359 PBP1_Nba_like Type I periplasmic binding component of active transport systems that are predicted to be involved in 2-nitrobenzoic acid degradation pathway Back     alignment and domain information
>cd06332 PBP1_aromatic_compounds_like Type I periplasmic binding proteins of active transport systems that are predicted to be involved in transport of aromatic compounds such as 2-nitrobenzoic acid and alkylbenzenes Back     alignment and domain information
>cd06268 PBP1_ABC_transporter_LIVBP_like Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily Back     alignment and domain information
>TIGR03863 PQQ_ABC_bind ABC transporter, substrate binding protein, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd06339 PBP1_YraM_LppC_lipoprotein_like Periplasmic binding component of lipoprotein LppC, an immunodominant antigen Back     alignment and domain information
>cd06333 PBP1_ABC-type_HAAT_like Type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids Back     alignment and domain information
>cd06355 PBP1_FmdD_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF) Back     alignment and domain information
>cd06331 PBP1_AmiC_like Type I periplasmic components of amide-binding protein (AmiC) and the active transport system for short-chain and urea (FmdDEF) Back     alignment and domain information
>cd06326 PBP1_STKc_like Type I periplasmic binding domain of uncharacterized extracellular ligand-binding proteins Back     alignment and domain information
>cd06394 PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the KA1 and KA2 subunits of Kainate receptor Back     alignment and domain information
>cd06358 PBP1_NHase Type I periplasmic-binding protein of the nitrile hydratase (NHase) system that selectively converts nitriles to corresponding amides Back     alignment and domain information
>TIGR03407 urea_ABC_UrtA urea ABC transporter, urea binding protein Back     alignment and domain information
>KOG4440|consensus Back     alignment and domain information
>TIGR03669 urea_ABC_arch urea ABC transporter, substrate-binding protein, archaeal type Back     alignment and domain information
>cd06337 PBP1_ABC_ligand_binding_like_4 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06388 PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR4 subunit of the AMPA receptor Back     alignment and domain information
>cd06356 PBP1_Amide_Urea_BP_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF) Back     alignment and domain information
>PF13458 Peripla_BP_6: Periplasmic binding protein; PDB: 4EVS_A 4EY3_A 4EYG_B 4EYK_A 3H5L_B 3TD9_A 3EAF_A 1Z18_A 1Z17_A 2LIV_A Back     alignment and domain information
>cd06387 PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR3 subunit of the AMPA receptor Back     alignment and domain information
>cd06392 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta1 receptor of an orphan glutamate receptor family Back     alignment and domain information
>cd06341 PBP1_ABC_ligand_binding_like_7 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06357 PBP1_AmiC Periplasmic binding domain of amidase (AmiC) that belongs to the type I periplasmic binding fold protein family Back     alignment and domain information
>cd06381 PBP1_iGluR_delta_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of an orphan family of delta receptors, GluRdelta1 and GluRdelta2 Back     alignment and domain information
>cd06377 PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR3 subunit of NMDA receptor family Back     alignment and domain information
>cd01391 Periplasmic_Binding_Protein_Type_1 Type 1 periplasmic binding fold superfamily Back     alignment and domain information
>PF13433 Peripla_BP_5: Periplasmic binding protein domain; PDB: 1QNL_A 1QO0_A 1PEA_A Back     alignment and domain information
>KOG1053|consensus Back     alignment and domain information
>cd06369 PBP1_GC_C_enterotoxin_receptor Ligand-binding domain of the membrane guanylyl cyclase C Back     alignment and domain information
>KOG1054|consensus Back     alignment and domain information
>TIGR02990 ectoine_eutA ectoine utilization protein EutA Back     alignment and domain information
>PF04348 LppC: LppC putative lipoprotein; InterPro: IPR007443 This entry includes several bacterial outer membrane antigens, whose molecular function is unknown Back     alignment and domain information
>cd01537 PBP1_Repressors_Sugar_Binding_like Ligand-binding domain of the LacI-GalR family of transcription regulators and the sugar-binding domain of ABC-type transport systems Back     alignment and domain information
>cd01536 PBP1_ABC_sugar_binding_like Periplasmic sugar-binding domain of active transport systems that are members of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>PRK09860 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08192 Fe-ADH7 Iron-containing alcohol dehydrogenases-like, involved in the linear alkylbenzenesulfonate (LAS) degradation pathway Back     alignment and domain information
>COG1454 EutG Alcohol dehydrogenase, class IV [Energy production and conversion] Back     alignment and domain information
>cd08190 HOT Hydroxyacid-oxoacid transhydrogenase (HOT) involved in gamma-hydroxybutyrate metabolism Back     alignment and domain information
>cd08551 Fe-ADH iron-containing alcohol dehydrogenases (Fe-ADH)-like Back     alignment and domain information
>PRK15454 ethanol dehydrogenase EutG; Provisional Back     alignment and domain information
>PRK10624 L-1,2-propanediol oxidoreductase; Provisional Back     alignment and domain information
>cd06325 PBP1_ABC_uncharacterized_transporter Type I periplasmic ligand-binding domain of uncharacterized ABC-type transport systems that are predicted to be involved in the uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd08193 HVD 5-hydroxyvalerate dehydrogenase (HVD) catalyzes the oxidation of 5-hydroxyvalerate to 5-oxovalerate with NAD+ as cofactor Back     alignment and domain information
>PF00465 Fe-ADH: Iron-containing alcohol dehydrogenase ; InterPro: IPR001670 Alcohol dehydrogenase (1 Back     alignment and domain information
>cd08189 Fe-ADH5 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>cd06267 PBP1_LacI_sugar_binding_like Ligand binding domain of the LacI tanscriptional regulator family belonging to the type I periplasmic-binding fold protein superfamily Back     alignment and domain information
>cd08194 Fe-ADH6 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>cd06282 PBP1_GntR_like_2 Ligand-binding domain of putative DNA transcription repressors highly similar to that of the repressor specific for gluconate (GntR) which is a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd08185 Fe-ADH1 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>TIGR02638 lactal_redase lactaldehyde reductase Back     alignment and domain information
>cd08188 Fe-ADH4 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>KOG3857|consensus Back     alignment and domain information
>cd08176 LPO Lactadehyde:propanediol oxidoreductase (LPO) catalyzes the interconversion between L-lactaldehyde and L-1,2-propanediol in Escherichia coli and other enterobacteria Back     alignment and domain information
>cd08191 HHD 6-hydroxyhexanoate dehydrogenase (HHD) catalyzes the oxidation of 6-hydroxyhexanoate to 6-oxohexanoate Back     alignment and domain information
>cd06300 PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-binding component of uncharacterized ABC-type transport systems that are members of the pentose/hexose sugar-binding protein family of the type I periplasmic binding protein superfamily Back     alignment and domain information
>cd08181 PPD-like 1,3-propanediol dehydrogenase-like (PPD) Back     alignment and domain information
>cd08182 HEPD Hydroxyethylphosphoate dehydrogenase (HEPD) catalyzes the reduction of phosphonoacetaldehyde (PnAA) to hydroxyethylphosphoate (HEP) Back     alignment and domain information
>cd08170 GlyDH Glycerol dehydrogenases (GlyDH) catalyzes oxidation of glycerol to dihydroxyacetone in glycerol dissmilation Back     alignment and domain information
>cd08187 BDH Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process Back     alignment and domain information
>cd08171 GlyDH-like2 Glycerol dehydrogenase-like Back     alignment and domain information
>PF13685 Fe-ADH_2: Iron-containing alcohol dehydrogenase; PDB: 3CE9_C Back     alignment and domain information
>cd07766 DHQ_Fe-ADH Dehydroquinate synthase-like (DHQ-like) and iron-containing alcohol dehydrogenases (Fe-ADH) Back     alignment and domain information
>cd08186 Fe-ADH8 Iron-containing alcohol dehydrogenase Back     alignment and domain information
>cd06273 PBP1_GntR_like_1 This group includes the ligand-binding domain of putative DNA transcription repressors which are highly similar to that of the repressor specific for gluconate (GntR), a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>PRK09423 gldA glycerol dehydrogenase; Provisional Back     alignment and domain information
>cd08550 GlyDH-like Glycerol_dehydrogenase-like Back     alignment and domain information
>cd08183 Fe-ADH2 Iron-containing alcohol dehydrogenases-like Back     alignment and domain information
>TIGR02667 moaB_proteo molybdenum cofactor biosynthesis protein B, proteobacterial Back     alignment and domain information
>cd06320 PBP1_allose_binding Periplasmic allose-binding domain of bacterial transport systems that function as a primary receptor of active transport and chemotaxis Back     alignment and domain information
>cd03364 TOPRIM_DnaG_primases TOPRIM_DnaG_primases: The topoisomerase-primase (TORPIM) nucleotidyl transferase/hydrolase domain found in the active site regions of proteins similar to Escherichia coli DnaG Back     alignment and domain information
>cd08179 NADPH_BDH NADPH-dependent butanol dehydrogenase involved in the butanol and ethanol formation pathway in bacteria Back     alignment and domain information
>cd06323 PBP1_ribose_binding Periplasmic sugar-binding domain of the thermophilic Thermoanaerobacter tengcongensis ribose binding protein (ttRBP) and its mesophilic homologs Back     alignment and domain information
>cd08178 AAD_C C-terminal alcohol dehydrogenase domain of the acetaldehyde dehydrogenase-alcohol dehydrogenase bifunctional two-domain protein (AAD) Back     alignment and domain information
>cd06278 PBP1_LacI_like_2 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>COG2984 ABC-type uncharacterized transport system, periplasmic component [General function prediction only] Back     alignment and domain information
>cd06353 PBP1_BmpA_Med_like Periplasmic binding domain of the basic membrane lipoprotein Med in Bacillus and its close homologs from other bacteria and Archaea Back     alignment and domain information
>cd08175 G1PDH Glycerol-1-phosphate dehydrogenase (G1PDH) catalyzes the reversible reduction of dihydroxyacetone phosphate (DHAP) to glycerol-1-phosphate (G1P) in an NADH-dependent manner Back     alignment and domain information
>TIGR01481 ccpA catabolite control protein A Back     alignment and domain information
>cd06301 PBP1_rhizopine_binding_like Periplasmic binding proteins specific to rhizopines Back     alignment and domain information
>cd08180 PDD 1,3-propanediol dehydrogenase (PPD) catalyzes the reduction of 3-hydroxypropionaldehyde (3-HPA) to 1,3-propanediol in glycerol metabolism Back     alignment and domain information
>cd00886 MogA_MoaB MogA_MoaB family Back     alignment and domain information
>PF13407 Peripla_BP_4: Periplasmic binding protein domain; PDB: 3BRS_B 3GBP_A 3GA5_A 1GCG_A 1GCA_A 3H75_A 3D02_A 3L49_B 3EJW_B 3T95_A Back     alignment and domain information
>cd06310 PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>PF13607 Succ_CoA_lig: Succinyl-CoA ligase like flavodoxin domain; PDB: 2CSU_A Back     alignment and domain information
>cd06284 PBP1_LacI_like_6 Ligand-binding domain of an uncharacterized transcription regulator from Actinobacillus succinogenes and its close homologs from other bacteria Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query144
2e4u_A 555 Crystal Structure Of The Extracellular Region Of Th 6e-19
3lmk_A 492 Ligand Binding Domain Of Metabotropoc Glutamate Rec 2e-17
3sm9_A 479 Crystal Structure Of Metabotropic Glutamate Recepto 3e-17
2e4z_A 501 Crystal Structure Of The Ligand-Binding Region Of T 3e-16
3mq4_A 481 Metabotropic Glutamate Receptor Mglur7 Complexed Wi 1e-15
1ewk_A 490 Crystal Structure Of Metabotropic Glutamate Recepto 3e-15
3ks9_A 496 Metabotropic Glutamate Receptor Mglur1 Complexed Wi 4e-14
4f11_A 433 Crystal Structure Of The Extracellular Domain Of Hu 3e-05
>pdb|2E4U|A Chain A, Crystal Structure Of The Extracellular Region Of The Group Ii Metabotropic Glutamate Receptor Complexed With L-glutamate Length = 555 Back     alignment and structure

Iteration: 1

Score = 89.4 bits (220), Expect = 6e-19, Method: Composition-based stats. Identities = 43/105 (40%), Positives = 64/105 (60%), Gaps = 3/105 (2%) Query: 1 VSFWSTSPELSNKQRFEYFTRTIPSDHHQVKAMVEIVKKLGWSYVSIIYEESNYGVKAFE 60 +S+ STS +LS+K R++YF RT+P D +Q KAM EI++ W+YVS + E +YG E Sbjct: 145 ISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIE 204 Query: 61 ELEVLLAKYSICIAIKEKLVKDSGVAEETAYDDIVLKLLTKPRAR 105 E +ICIA EK+ + + +YD ++ +LL KP AR Sbjct: 205 AFEQEARLRNICIATAEKVGRSN---IRKSYDSVIRELLQKPNAR 246
>pdb|3LMK|A Chain A, Ligand Binding Domain Of Metabotropoc Glutamate Receptor Mglur5 Complexed With Glutamate Length = 492 Back     alignment and structure
>pdb|3SM9|A Chain A, Crystal Structure Of Metabotropic Glutamate Receptor 3 Precursor In Presence Of Ly341495 Antagonist Length = 479 Back     alignment and structure
>pdb|2E4Z|A Chain A, Crystal Structure Of The Ligand-Binding Region Of The Group Iii Metabotropic Glutamate Receptor Length = 501 Back     alignment and structure
>pdb|3MQ4|A Chain A, Metabotropic Glutamate Receptor Mglur7 Complexed With Ly3414 Antagonist Length = 481 Back     alignment and structure
>pdb|1EWK|A Chain A, Crystal Structure Of Metabotropic Glutamate Receptor Subtype 1 Complexed With Glutamate Length = 490 Back     alignment and structure
>pdb|3KS9|A Chain A, Metabotropic Glutamate Receptor Mglur1 Complexed With Ly341495 Antagonist Length = 496 Back     alignment and structure
>pdb|4F11|A Chain A, Crystal Structure Of The Extracellular Domain Of Human Gaba(B) Receptor Gbr2 Length = 433 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query144
2e4u_A 555 Metabotropic glutamate receptor 3; G-protein-coupl 1e-34
3sm9_A 479 Mglur3, metabotropic glutamate receptor 3; structu 2e-33
3ks9_A 496 Mglur1, metabotropic glutamate receptor 1; glutama 1e-31
3mq4_A 481 Mglur7, metabotropic glutamate receptor 7; glutama 1e-30
4f11_A 433 Gamma-aminobutyric acid type B receptor subunit 2; 1e-28
3qek_A 384 NMDA glutamate receptor subunit; amino terminal do 2e-25
3qel_B 364 Glutamate [NMDA] receptor subunit epsilon-2; ION c 7e-22
1jdp_A 441 NPR-C, atrial natriuretic peptide clearance recept 2e-19
1dp4_A 435 Atrial natriuretic peptide receptor A; periplasmic 2e-19
3h6g_A 395 Glutamate receptor, ionotropic kainate 2; membrane 3e-18
3om0_A 393 Glutamate receptor, ionotropic kainate 5; membrane 1e-10
3hsy_A 376 Glutamate receptor 2; ligand-gated ION channel, sy 4e-09
3saj_A 384 Glutamate receptor 1; rossman fold, ION channel, m 5e-08
3o21_A 389 Glutamate receptor 3; periplasmatic binding protei 1e-07
3sg0_A 386 Extracellular ligand-binding receptor; structural 2e-07
3lkb_A 392 Probable branched-chain amino acid ABC transporter 7e-07
3ipc_A 356 ABC transporter, substrate binding protein (amino; 1e-06
1usg_A 346 Leucine-specific binding protein; leucine-binding 3e-06
3hut_A 358 Putative branched-chain amino acid ABC transporter 4e-06
3lop_A 364 Substrate binding periplasmic protein; protein str 4e-06
3snr_A 362 Extracellular ligand-binding receptor; structural 4e-06
4evq_A 375 Putative ABC transporter subunit, substrate-bindi 4e-05
3kg2_A 823 Glutamate receptor 2; ION channel, membrane protei 4e-05
3i45_A 387 Twin-arginine translocation pathway signal protei; 9e-05
>2e4u_A Metabotropic glutamate receptor 3; G-protein-coupled receptor, neuron, central nerve system, SI protein; HET: NAG GLU; 2.35A {Rattus norvegicus} PDB: 2e4v_A* 2e4w_A* 2e4x_A* 2e4y_A* Length = 555 Back     alignment and structure
 Score =  125 bits (315), Expect = 1e-34
 Identities = 43/105 (40%), Positives = 64/105 (60%), Gaps = 3/105 (2%)

Query: 1   VSFWSTSPELSNKQRFEYFTRTIPSDHHQVKAMVEIVKKLGWSYVSIIYEESNYGVKAFE 60
           +S+ STS +LS+K R++YF RT+P D +Q KAM EI++   W+YVS +  E +YG    E
Sbjct: 145 ISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIE 204

Query: 61  ELEVLLAKYSICIAIKEKLVKDSGVAEETAYDDIVLKLLTKPRAR 105
             E      +ICIA  EK+ + +      +YD ++ +LL KP AR
Sbjct: 205 AFEQEARLRNICIATAEKVGRSN---IRKSYDSVIRELLQKPNAR 246


>3sm9_A Mglur3, metabotropic glutamate receptor 3; structural genomics, structural genomics consortium, SGC, CE membrane, G-protein coupled receptor; HET: Z99; 2.26A {Homo sapiens} Length = 479 Back     alignment and structure
>3ks9_A Mglur1, metabotropic glutamate receptor 1; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99 NAG; 1.90A {Homo sapiens} PDB: 1ewk_A* 1ewt_A* 1ewv_A 1isr_A* 1iss_A* 3lmk_A* Length = 496 Back     alignment and structure
>3mq4_A Mglur7, metabotropic glutamate receptor 7; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99; 2.80A {Homo sapiens} PDB: 2e4z_A* Length = 481 Back     alignment and structure
>4f11_A Gamma-aminobutyric acid type B receptor subunit 2; venus flytrap module, G-protein coupled receptor, signaling; 2.38A {Homo sapiens} PDB: 4f12_A* Length = 433 Back     alignment and structure
>3qek_A NMDA glutamate receptor subunit; amino terminal domain, ION channel, NMDA receptor, allosteri modulation, phenylethanolamine, polyamine; HET: NAG BMA; 2.00A {Xenopus laevis} PDB: 3qel_A* 3qem_A* 3q41_A* Length = 384 Back     alignment and structure
>3qel_B Glutamate [NMDA] receptor subunit epsilon-2; ION channel, allosteric modulation, phenylethanolamine, N-glycosylation, extracellular; HET: NAG BMA MAN FUC QEL; 2.60A {Rattus norvegicus} PDB: 3qem_B* 3jpw_A* 3jpy_A* Length = 364 Back     alignment and structure
>1jdp_A NPR-C, atrial natriuretic peptide clearance receptor; hormone-receptor complex, natriuretic peptide receptor, ALLO activation, signaling protein; HET: NDG NAG; 2.00A {Homo sapiens} SCOP: c.93.1.1 PDB: 1jdn_A* 1yk0_A* 1yk1_A* Length = 441 Back     alignment and structure
>1dp4_A Atrial natriuretic peptide receptor A; periplasmic binding protein fold, dimer, hormone/growth FACT receptor, lyase complex; HET: NAG; 2.00A {Rattus norvegicus} SCOP: c.93.1.1 PDB: 1t34_A* 3a3k_A* Length = 435 Back     alignment and structure
>3h6g_A Glutamate receptor, ionotropic kainate 2; membrane protein glycoprotein, cell junction, cell membrane, glycoprotein, ION transport; HET: NAG TLA; 2.70A {Rattus norvegicus} PDB: 3h6h_A* 3qlv_C 3qlu_C* 3qlt_A* 3olz_A* Length = 395 Back     alignment and structure
>3om0_A Glutamate receptor, ionotropic kainate 5; membrane protein, ION channel; HET: NAG BMA GOL; 1.40A {Rattus norvegicus} PDB: 3om1_A* 3qlu_A* 3qlv_A Length = 393 Back     alignment and structure
>3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, cell CELL membrane, endoplasmic reticulum, glycoprotein, ION TRA ionic channel; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 3o2j_A* 2wjw_A* 2wjx_A 3n6v_A Length = 376 Back     alignment and structure
>3saj_A Glutamate receptor 1; rossman fold, ION channel, membrane, transport protein; HET: NAG BMA MAN; 2.50A {Rattus norvegicus} Length = 384 Back     alignment and structure
>3o21_A Glutamate receptor 3; periplasmatic binding protein, oligomerization, membrane, TR protein; HET: NAG; 2.20A {Rattus norvegicus} PDB: 3p3w_A Length = 389 Back     alignment and structure
>3sg0_A Extracellular ligand-binding receptor; structural genomics, PSI-biology; HET: 173; 1.20A {Rhodopseudomonas palustris} PDB: 4dqd_A* Length = 386 Back     alignment and structure
>3lkb_A Probable branched-chain amino acid ABC transporter, amino acid binding protein; branched amino acid, PSI-II, NYSGXRC, structural genomics; 2.40A {Thermus thermophilus} Length = 392 Back     alignment and structure
>3ipc_A ABC transporter, substrate binding protein (amino; venus flytrap domain, transport protein; 1.30A {Agrobacterium tumefaciens} PDB: 3ip5_A 3ip6_A 3ip7_A 3ip9_A 3ipa_A Length = 356 Back     alignment and structure
>1usg_A Leucine-specific binding protein; leucine-binding protein, X-RAY crystallography, protein structure, ABC transport systems, transport protein; 1.53A {Escherichia coli} SCOP: c.93.1.1 PDB: 1usi_A* 1usk_A 2lbp_A 1z15_A 1z16_A 1z17_A 1z18_A 2liv_A Length = 346 Back     alignment and structure
>3hut_A Putative branched-chain amino acid ABC transporter; extracellular ligand-binding receptor,transport protein; 1.93A {Rhodospirillum rubrum atcc 11170} Length = 358 Back     alignment and structure
>3lop_A Substrate binding periplasmic protein; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.55A {Ralstonia solanacearum} Length = 364 Back     alignment and structure
>4evq_A Putative ABC transporter subunit, substrate-bindi component; structural genomics, PSI-biology, midwest center for structu genomics; HET: MSE PHB; 1.40A {Rhodopseudomonas palustris} PDB: 4evr_A Length = 375 Back     alignment and structure
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Length = 823 Back     alignment and structure
>3i45_A Twin-arginine translocation pathway signal protei; structural genomics; 1.36A {Rhodospirillum rubrum} Length = 387 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query144
3ks9_A 496 Mglur1, metabotropic glutamate receptor 1; glutama 99.87
3sm9_A 479 Mglur3, metabotropic glutamate receptor 3; structu 99.87
2e4u_A 555 Metabotropic glutamate receptor 3; G-protein-coupl 99.87
3mq4_A 481 Mglur7, metabotropic glutamate receptor 7; glutama 99.82
3qel_B 364 Glutamate [NMDA] receptor subunit epsilon-2; ION c 99.82
1jdp_A 441 NPR-C, atrial natriuretic peptide clearance recept 99.82
3qek_A 384 NMDA glutamate receptor subunit; amino terminal do 99.81
4f11_A 433 Gamma-aminobutyric acid type B receptor subunit 2; 99.78
1dp4_A 435 Atrial natriuretic peptide receptor A; periplasmic 99.77
3h6g_A 395 Glutamate receptor, ionotropic kainate 2; membrane 99.72
3om0_A 393 Glutamate receptor, ionotropic kainate 5; membrane 99.63
3hsy_A 376 Glutamate receptor 2; ligand-gated ION channel, sy 99.6
3o21_A 389 Glutamate receptor 3; periplasmatic binding protei 99.58
3kg2_A 823 Glutamate receptor 2; ION channel, membrane protei 99.57
3saj_A 384 Glutamate receptor 1; rossman fold, ION channel, m 99.56
4gpa_A 389 Glutamate receptor 4; PBP fold, ligand-gated ION c 99.56
3n0w_A 379 ABC branched chain amino acid family transporter, 99.53
4f06_A 371 Extracellular ligand-binding receptor; PSI-biology 99.53
3i09_A 375 Periplasmic branched-chain amino acid-binding Pro; 99.53
3i45_A 387 Twin-arginine translocation pathway signal protei; 99.52
3h5l_A 419 Putative branched-chain amino acid ABC transporter 99.47
3n0x_A 374 Possible substrate binding protein of ABC transpo 99.46
4eyg_A 368 Twin-arginine translocation pathway signal; PSI-bi 99.46
4evq_A 375 Putative ABC transporter subunit, substrate-bindi 99.43
3ipc_A 356 ABC transporter, substrate binding protein (amino; 99.39
3lop_A 364 Substrate binding periplasmic protein; protein str 99.37
3td9_A 366 Branched chain amino acid ABC transporter, peripl 99.37
3eaf_A 391 ABC transporter, substrate binding protein; PSI2, 99.35
3sg0_A 386 Extracellular ligand-binding receptor; structural 99.34
1usg_A 346 Leucine-specific binding protein; leucine-binding 99.34
3lkb_A 392 Probable branched-chain amino acid ABC transporter 99.33
3hut_A 358 Putative branched-chain amino acid ABC transporter 99.3
3snr_A 362 Extracellular ligand-binding receptor; structural 99.25
4gnr_A 353 ABC transporter substrate-binding protein-branche 99.09
1pea_A 385 Amidase operon; gene regulator, receptor, binding 98.99
3ckm_A 327 YRAM (HI1655), LPOA; periplasmic-binding protein, 98.82
2h4a_A 325 YRAM (HI1655); perplasmic binding protein, lipopro 98.78
3ixl_A240 Amdase, arylmalonate decarboxylase; enantioselecti 95.13
3bfj_A 387 1,3-propanediol oxidoreductase; opportunistic path 94.06
3ox4_A 383 Alcohol dehydrogenase 2; iron, NAD, oxidoreductase 93.95
1vlj_A 407 NADH-dependent butanol dehydrogenase; TM0820, stru 92.38
2xed_A273 Putative maleate isomerase; nicotinic acid catabol 92.29
1rrm_A 386 Lactaldehyde reductase; structural genomics, dehyd 92.18
2qh8_A302 Uncharacterized protein; conserved domain protein, 91.61
3lft_A295 Uncharacterized protein; ABC, ATPase, cassette, L- 91.23
1o2d_A 371 Alcohol dehydrogenase, iron-containing; TM0920, st 91.05
2dgd_A223 223AA long hypothetical arylmalonate decarboxylas; 90.31
2h3h_A313 Sugar ABC transporter, periplasmic sugar-binding p 89.88
3uhj_A 387 Probable glycerol dehydrogenase; structural genomi 89.02
1mkz_A172 Molybdenum cofactor biosynthesis protein B; MAD, W 88.96
3ce9_A 354 Glycerol dehydrogenase; NP_348253.1, 3-dehydroquin 88.56
3iwt_A178 178AA long hypothetical molybdenum cofactor biosy 85.71
1jq5_A 370 Glycerol dehydrogenase; oxidoreductase, NAD, glyce 85.6
3brq_A296 HTH-type transcriptional regulator ASCG; transcrip 85.09
2pjk_A178 178AA long hypothetical molybdenum cofactor biosyn 83.69
3ksm_A276 ABC-type sugar transport system, periplasmic COMP; 83.59
2fvy_A309 D-galactose-binding periplasmic protein; periplasm 83.34
1y5e_A169 Molybdenum cofactor biosynthesis protein B; struct 83.33
3d8u_A275 PURR transcriptional regulator; APC91343.1, vibrio 83.28
3hl0_A 353 Maleylacetate reductase; structur genomics, PSI-2, 83.07
3gv0_A288 Transcriptional regulator, LACI family; transcript 83.02
2qu7_A288 Putative transcriptional regulator; structural gen 82.18
1dbq_A289 Purine repressor; transcription regulation, DNA-bi 82.1
3rot_A297 ABC sugar transporter, periplasmic sugar binding; 82.07
3gyb_A280 Transcriptional regulators (LACI-family transcript 81.8
2h0a_A276 TTHA0807, transcriptional regulator; repressor, st 81.44
1xvl_A321 Mn transporter, MNTC protein; manganese, ABC-type 81.14
2rjo_A332 Twin-arginine translocation pathway signal protei; 80.77
3brs_A289 Periplasmic binding protein/LACI transcriptional; 80.29
3gbv_A304 Putative LACI-family transcriptional regulator; NY 80.14
3m9w_A 313 D-xylose-binding periplasmic protein; xylose bindi 80.06
>3ks9_A Mglur1, metabotropic glutamate receptor 1; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99 NAG; 1.90A {Homo sapiens} SCOP: c.93.1.1 PDB: 1ewk_A* 1ewt_A* 1ewv_A 1isr_A* 1iss_A* 3lmk_A* Back     alignment and structure
Probab=99.87  E-value=6.7e-22  Score=159.80  Aligned_cols=135  Identities=30%  Similarity=0.520  Sum_probs=113.9

Q ss_pred             CcccCCCCCCcCCCCCCceEEecCCchHHHHHHHHHHHhCCCcEEEEEEEeCCcchHHHHHHHHHhhhCceEEEEEeccc
Q psy12591          1 VSFWSTSPELSNKQRFEYFTRTIPSDHHQVKAMVEIVKKLGWSYVSIIYEESNYGVKAFEELEVLLAKYSICIAIKEKLV   80 (144)
Q Consensus         1 Is~~at~~~ls~~~~~p~ffRt~p~d~~~~~a~~~ll~~f~W~~Vaii~~~~~~g~~~~~~~~~~l~~~Gi~V~~~~~~~   80 (144)
                      |||+++++.|+++.+||+||||.|++..|+.++++++++|||+||++|++|++||....+.|++++++.|+||++.+.++
T Consensus       156 Is~~a~~~~lsd~~~~p~~frt~psd~~~~~ai~~ll~~fgw~~V~li~~dd~~G~~~~~~~~~~~~~~Gi~v~~~~~i~  235 (496)
T 3ks9_A          156 IAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKELAAQEGLSIAHSDKIY  235 (496)
T ss_dssp             EESSCCCGGGGCTTTCTTEEESSCCTHHHHHHHHHHHHHTTCCEEEEEEESSHHHHHHHHHHHHHHHHTTCEEEEEEEEC
T ss_pred             ECCCcCCccccCccCCCceEEecCChHHHHHHHHHHHHHcCCcEEEEEEeccHHHHHHHHHHHHHHHHcCceEEEEEEEC
Confidence            58899999999998899999999999999999999999999999999999999999999999999999999999999887


Q ss_pred             CCCCCcchhhHHHHHHHHhcC-CCceEEEEeeE---------------------EeeeCCcchhh-----hhHHHHHHHh
Q psy12591         81 KDSGVAEETAYDDIVLKLLTK-PRARGLFKRLK---------------------LVKDSGVAEET-----AYDDIVLKLL  133 (144)
Q Consensus        81 ~~~~~~~~~~~~~~l~~lk~~-~~arvii~~~~---------------------~~~~~g~~~~~-----~~~~~~~~~~  133 (144)
                      ...   .+.+++.++++|++. ++++|||++..                     ++..+||+...     ....++|.++
T Consensus       236 ~~~---~~~d~~~~l~~i~~~~~~a~vii~~~~~~~~~~l~~~~~~~g~~~k~~~i~s~~w~~~~~~~~~~~~~~~G~l~  312 (496)
T 3ks9_A          236 SNA---GEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLLSAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGIT  312 (496)
T ss_dssp             TTC---CHHHHHHHHHHHHTTTTTTCEEEEECCHHHHHHHHHHHHHHTCCSCCEEEECTTTTTCHHHHTTCHHHHTTCEE
T ss_pred             CCC---CHHHHHHHHHHHHhccCceEEEEEecChHHHHHHHHHHHHhCCCCcEEEEEechhccccccccccccccCceEE
Confidence            543   378999999999952 68999998742                     46677776532     2234566666


Q ss_pred             cCccc
Q psy12591        134 TKPRA  138 (144)
Q Consensus       134 ~~~~~  138 (144)
                      +.++.
T Consensus       313 ~~~~~  317 (496)
T 3ks9_A          313 IKLQS  317 (496)
T ss_dssp             EEECC
T ss_pred             EeccC
Confidence            55544



>3sm9_A Mglur3, metabotropic glutamate receptor 3; structural genomics, structural genomics consortium, SGC, CE membrane, G-protein coupled receptor; HET: Z99; 2.26A {Homo sapiens} Back     alignment and structure
>2e4u_A Metabotropic glutamate receptor 3; G-protein-coupled receptor, neuron, central nerve system, SI protein; HET: NAG GLU; 2.35A {Rattus norvegicus} PDB: 2e4v_A* 2e4w_A* 2e4x_A* 2e4y_A* Back     alignment and structure
>3mq4_A Mglur7, metabotropic glutamate receptor 7; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99; 2.80A {Homo sapiens} SCOP: c.93.1.0 PDB: 2e4z_A* Back     alignment and structure
>3qel_B Glutamate [NMDA] receptor subunit epsilon-2; ION channel, allosteric modulation, phenylethanolamine, N-glycosylation, extracellular; HET: NAG BMA MAN FUC QEL; 2.60A {Rattus norvegicus} PDB: 3qem_B* 3jpw_A* 3jpy_A* Back     alignment and structure
>1jdp_A NPR-C, atrial natriuretic peptide clearance receptor; hormone-receptor complex, natriuretic peptide receptor, ALLO activation, signaling protein; HET: NDG NAG; 2.00A {Homo sapiens} SCOP: c.93.1.1 PDB: 1jdn_A* 1yk0_A* 1yk1_A* Back     alignment and structure
>3qek_A NMDA glutamate receptor subunit; amino terminal domain, ION channel, NMDA receptor, allosteri modulation, phenylethanolamine, polyamine; HET: NAG BMA; 2.00A {Xenopus laevis} PDB: 3qel_A* 3qem_A* 3q41_A* Back     alignment and structure
>4f11_A Gamma-aminobutyric acid type B receptor subunit 2; venus flytrap module, G-protein coupled receptor, signaling; 2.38A {Homo sapiens} PDB: 4f12_A* Back     alignment and structure
>1dp4_A Atrial natriuretic peptide receptor A; periplasmic binding protein fold, dimer, hormone/growth FACT receptor, lyase complex; HET: NAG; 2.00A {Rattus norvegicus} SCOP: c.93.1.1 PDB: 1t34_A* 3a3k_A* Back     alignment and structure
>3h6g_A Glutamate receptor, ionotropic kainate 2; membrane protein glycoprotein, cell junction, cell membrane, glycoprotein, ION transport; HET: NAG TLA; 2.70A {Rattus norvegicus} PDB: 3h6h_A* 3qlv_C 3qlu_C* 3qlt_A* 3olz_A* Back     alignment and structure
>3om0_A Glutamate receptor, ionotropic kainate 5; membrane protein, ION channel; HET: NAG BMA GOL; 1.40A {Rattus norvegicus} PDB: 3om1_A* 3qlu_A* 3qlv_A Back     alignment and structure
>3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, cell CELL membrane, endoplasmic reticulum, glycoprotein, ION TRA ionic channel; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 3o2j_A* 2wjw_A* 2wjx_A 3n6v_A Back     alignment and structure
>3o21_A Glutamate receptor 3; periplasmatic binding protein, oligomerization, membrane, TR protein; HET: NAG; 2.20A {Rattus norvegicus} PDB: 3p3w_A Back     alignment and structure
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Back     alignment and structure
>3saj_A Glutamate receptor 1; rossman fold, ION channel, membrane, transport protein; HET: NAG BMA MAN; 2.50A {Rattus norvegicus} Back     alignment and structure
>4gpa_A Glutamate receptor 4; PBP fold, ligand-gated ION channel, ION transport, transmembrane AMPA receptor regulating proteins, cornichons, ckamp44; HET: NAG; 2.25A {Rattus norvegicus} Back     alignment and structure
>3n0w_A ABC branched chain amino acid family transporter, periplasmic ligand binding protein...; receptor family ligand binding region; HET: MSE; 1.88A {Burkholderia xenovorans} Back     alignment and structure
>4f06_A Extracellular ligand-binding receptor; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: MSE PHB; 1.30A {Rhodopseudomonas palustris} PDB: 4evs_A* Back     alignment and structure
>3i09_A Periplasmic branched-chain amino acid-binding Pro; type I periplasmic binding protein, structural genomics, JOI for structural genomics; HET: MSE CIT; 1.80A {Burkholderia mallei} Back     alignment and structure
>3i45_A Twin-arginine translocation pathway signal protei; structural genomics; 1.36A {Rhodospirillum rubrum} Back     alignment and structure
>3h5l_A Putative branched-chain amino acid ABC transporter; structural genomics, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} Back     alignment and structure
>3n0x_A Possible substrate binding protein of ABC transpo system; receptor family ligand binding region, structural genomics; HET: MSE; 1.50A {Rhodopseudomonas palustris} PDB: 3nnd_B Back     alignment and structure
>4eyg_A Twin-arginine translocation pathway signal; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: VNL; 1.86A {Rhodopseudomonas palustris} PDB: 4ey3_A* 3t0n_A* 4eyk_A* Back     alignment and structure
>4evq_A Putative ABC transporter subunit, substrate-bindi component; structural genomics, PSI-biology, midwest center for structu genomics; HET: MSE PHB; 1.40A {Rhodopseudomonas palustris} PDB: 4evr_A Back     alignment and structure
>3ipc_A ABC transporter, substrate binding protein (amino; venus flytrap domain, transport protein; 1.30A {Agrobacterium tumefaciens} PDB: 3ip5_A 3ip6_A 3ip7_A 3ip9_A 3ipa_A Back     alignment and structure
>3lop_A Substrate binding periplasmic protein; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.55A {Ralstonia solanacearum} Back     alignment and structure
>3td9_A Branched chain amino acid ABC transporter, peripl amino acid-binding protein; leucine binding, structural genomics; HET: MSE PHE; 1.90A {Thermotoga maritima} Back     alignment and structure
>3eaf_A ABC transporter, substrate binding protein; PSI2, NYSGXRC, substrate binding P structural genomics, protein structure initiative; 2.00A {Aeropyrum pernix} Back     alignment and structure
>3sg0_A Extracellular ligand-binding receptor; structural genomics, PSI-biology; HET: 173; 1.20A {Rhodopseudomonas palustris} PDB: 4dqd_A* Back     alignment and structure
>1usg_A Leucine-specific binding protein; leucine-binding protein, X-RAY crystallography, protein structure, ABC transport systems, transport protein; 1.53A {Escherichia coli} SCOP: c.93.1.1 PDB: 1usi_A* 1usk_A 2lbp_A 1z15_A 1z16_A 1z17_A 1z18_A 2liv_A Back     alignment and structure
>3lkb_A Probable branched-chain amino acid ABC transporter, amino acid binding protein; branched amino acid, PSI-II, NYSGXRC, structural genomics; 2.40A {Thermus thermophilus} Back     alignment and structure
>3hut_A Putative branched-chain amino acid ABC transporter; extracellular ligand-binding receptor,transport protein; 1.93A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>4gnr_A ABC transporter substrate-binding protein-branche amino acid transport; amino acid-binding protein, surface-exposed protein; HET: MLY; 1.00A {Streptococcus pneumoniae} Back     alignment and structure
>1pea_A Amidase operon; gene regulator, receptor, binding protein; 2.10A {Pseudomonas aeruginosa} SCOP: c.93.1.1 PDB: 1qo0_A 1qnl_A Back     alignment and structure
>3ckm_A YRAM (HI1655), LPOA; periplasmic-binding protein, lipoprotein, unliganded, biosynthetic protein; 1.35A {Haemophilus influenzae} SCOP: c.93.1.1 Back     alignment and structure
>3ixl_A Amdase, arylmalonate decarboxylase; enantioselective decarboxylation, lyase; HET: CME PAC; 1.45A {Bordetella bronchiseptica} PDB: 3ixm_A 2vlb_A 3dg9_A 3ip8_A* 3dtv_A* 3eis_A* Back     alignment and structure
>3bfj_A 1,3-propanediol oxidoreductase; opportunistic pathogens, decamer, structural genomics,struct proteomics in europe, spine; 2.70A {Klebsiella pneumoniae} Back     alignment and structure
>3ox4_A Alcohol dehydrogenase 2; iron, NAD, oxidoreductase; HET: NAD; 2.00A {Zymomonas mobilis} PDB: 3owo_A* Back     alignment and structure
>1vlj_A NADH-dependent butanol dehydrogenase; TM0820, structural G JCSG, protein structure initiative, PSI, joint center for S genomics; HET: NAP; 1.78A {Thermotoga maritima} SCOP: e.22.1.2 Back     alignment and structure
>2xed_A Putative maleate isomerase; nicotinic acid catabolism, cofactor-independent CIS-trans isomerase; 1.95A {Nocardia farcinica} PDB: 2xec_A Back     alignment and structure
>1rrm_A Lactaldehyde reductase; structural genomics, dehydrogenase, PSI, protein structure initiative; HET: APR; 1.60A {Escherichia coli} SCOP: e.22.1.2 PDB: 2bi4_A* 2bl4_A* Back     alignment and structure
>3lft_A Uncharacterized protein; ABC, ATPase, cassette, L-Trp, PSI, MCSG, structural genomics center for structural genomics; HET: MSE TRP; 1.35A {Streptococcus pneumoniae} Back     alignment and structure
>1o2d_A Alcohol dehydrogenase, iron-containing; TM0920, structural genomics, JCSG, PSI, protein structure initiative; HET: MSE NAP TRS; 1.30A {Thermotoga maritima} SCOP: e.22.1.2 PDB: 1vhd_A* Back     alignment and structure
>2dgd_A 223AA long hypothetical arylmalonate decarboxylas; octamer, alpha/beta structure, lyase; 2.90A {Sulfolobus tokodaii} Back     alignment and structure
>2h3h_A Sugar ABC transporter, periplasmic sugar-binding protein; glucose binding protein, periplasmic binding protein, GBP; HET: BGC; 1.70A {Thermotoga maritima} PDB: 2qvc_A* 3c6q_B* Back     alignment and structure
>3uhj_A Probable glycerol dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>1mkz_A Molybdenum cofactor biosynthesis protein B; MAD, WEAK anomalous signal, molybdopterin synthesis, structural genomics, PSI; HET: MSE; 1.60A {Escherichia coli} SCOP: c.57.1.1 PDB: 1r2k_B Back     alignment and structure
>3ce9_A Glycerol dehydrogenase; NP_348253.1, 3-dehydroquinate syntha structural genomics, joint center for structural genomics; HET: MSE; 2.37A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>3iwt_A 178AA long hypothetical molybdenum cofactor biosy protein B; biosynthesis, structural genomics, UNKN function, NPPSFA; HET: PEG; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1jq5_A Glycerol dehydrogenase; oxidoreductase, NAD, glycerol metabolism; HET: NAD; 1.70A {Geobacillus stearothermophilus} SCOP: e.22.1.2 PDB: 1jpu_A* 1jqa_A* Back     alignment and structure
>3brq_A HTH-type transcriptional regulator ASCG; transcriptional repressor structure escherichia coli, struct genomics, PSI-2; HET: FRU; 2.00A {Escherichia coli} Back     alignment and structure
>3ksm_A ABC-type sugar transport system, periplasmic COMP; periplasmic component, PSI- 11023L, structural genomics, protein structure initiative; HET: BDR; 1.90A {Hahella chejuensis} Back     alignment and structure
>2fvy_A D-galactose-binding periplasmic protein; periplasmic binding protien, hinge, chemotaxis, transport,; HET: BGC; 0.92A {Escherichia coli} SCOP: c.93.1.1 PDB: 1glg_A* 2fw0_A* 2gbp_A* 2qw1_A* 2hph_A* 2ipn_A* 2ipm_A* 2ipl_A* 1gca_A* 1gcg_A 3ga5_A* 3gbp_A* Back     alignment and structure
>1y5e_A Molybdenum cofactor biosynthesis protein B; structural genomics, protein structure initiative, PSI, MCSG, midwest center for structural genomics; 1.90A {Bacillus cereus} SCOP: c.57.1.1 Back     alignment and structure
>3d8u_A PURR transcriptional regulator; APC91343.1, vibrio parahaem RIMD 2210633, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.88A {Vibrio parahaemolyticus} Back     alignment and structure
>3hl0_A Maleylacetate reductase; structur genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE NAD EPE; 1.60A {Agrobacterium tumefaciens str} Back     alignment and structure
>3gv0_A Transcriptional regulator, LACI family; transcription regulator, PSI-II, structural genomics structure initiative; 2.35A {Agrobacterium tumefaciens str} Back     alignment and structure
>2qu7_A Putative transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 2.30A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>1dbq_A Purine repressor; transcription regulation, DNA-binding regulatory protein; 2.20A {Escherichia coli} SCOP: c.93.1.1 PDB: 1jhz_A Back     alignment and structure
>3rot_A ABC sugar transporter, periplasmic sugar binding; nysgrc, PSI-biology, structural genomics; 1.91A {Legionella pneumophila subsp} Back     alignment and structure
>3gyb_A Transcriptional regulators (LACI-family transcriptional regulatory protein); protein structure initiative II(PSI II), nysgxrc; 1.60A {Corynebacterium glutamicum} Back     alignment and structure
>2h0a_A TTHA0807, transcriptional regulator; repressor, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} Back     alignment and structure
>1xvl_A Mn transporter, MNTC protein; manganese, ABC-type transport systems, photosynthesis, cyanobacteria, disulfide bond, metal transport; 2.90A {Synechocystis SP} SCOP: c.92.2.2 Back     alignment and structure
>2rjo_A Twin-arginine translocation pathway signal protei; PSI-2, NYSGXRC, twin arginine translocation pathway signal P structural genomics; HET: GAL; 2.05A {Burkholderia phytofirmans} Back     alignment and structure
>3brs_A Periplasmic binding protein/LACI transcriptional; structural genomics, protein structure initiative; 2.00A {Clostridium phytofermentans} Back     alignment and structure
>3gbv_A Putative LACI-family transcriptional regulator; NYSGXRC, PSI-II, 11231J, structur genomics, protein structure initiative; 2.20A {Bacteroides fragilis} Back     alignment and structure
>3m9w_A D-xylose-binding periplasmic protein; xylose binding protein, conformational changes, SUGA protein; 2.15A {Escherichia coli} PDB: 3m9x_A* 3ma0_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 144
d1ewka_ 477 c.93.1.1 (A:) Metabotropic glutamate receptor subt 5e-19
>d1ewka_ c.93.1.1 (A:) Metabotropic glutamate receptor subtype 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 477 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like I
superfamily: Periplasmic binding protein-like I
family: L-arabinose binding protein-like
domain: Metabotropic glutamate receptor subtype 1
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score = 80.0 bits (196), Expect = 5e-19
 Identities = 32/84 (38%), Positives = 56/84 (66%)

Query: 1   VSFWSTSPELSNKQRFEYFTRTIPSDHHQVKAMVEIVKKLGWSYVSIIYEESNYGVKAFE 60
           +++ +TS +LS+K  ++YF R +PSD  Q +AM++IVK+  W+YVS ++ E NYG    +
Sbjct: 148 IAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMD 207

Query: 61  ELEVLLAKYSICIAIKEKLVKDSG 84
             + L A+  +CIA  +K+  ++G
Sbjct: 208 AFKELAAQEGLCIAHSDKIYSNAG 231


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query144
d1ewka_ 477 Metabotropic glutamate receptor subtype 1 {Rat (Ra 99.9
d1dp4a_ 425 Hormone binding domain of the atrial natriuretic p 99.56
d1jdpa_ 401 Hormone binding domain of the atrial natriuretic p 99.45
d1usga_ 346 Leucine-binding protein {Escherichia coli [TaxId: 99.3
d1qo0a_ 373 Amide receptor/negative regulator of the amidase o 99.26
d3ckma1 317 YraM C-terminal domain {Haemophilus influenzae [Ta 98.85
d1vlja_ 398 NADH-dependent butanol dehydrogenase A (TM0820) {T 95.59
d1rrma_ 385 Lactaldehyde reductase FucO {Escherichia coli [Tax 94.98
d1o2da_ 359 Alcohol dehydrogenase TM0920 {Thermotoga maritima 94.26
d1y5ea1155 MoaB {Bacillus cereus [TaxId: 1396]} 91.87
d1jq5a_ 366 Glycerol dehydrogenase {Bacillus stearothermophilu 89.72
d1mkza_170 MoaB {Escherichia coli [TaxId: 562]} 87.55
d1guda_ 288 D-allose-binding protein {Escherichia coli [TaxId: 86.26
d1tjya_ 316 AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370 84.94
d1dbqa_ 282 Purine repressor (PurR), C-terminal domain {Escher 84.82
d1uuya_161 Plant CNX1 G domain {Mouse-ear cress (Arabidopsis 83.14
d1byka_ 255 Trehalose repressor, C-terminal domain {Escherichi 81.24
>d1ewka_ c.93.1.1 (A:) Metabotropic glutamate receptor subtype 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like I
superfamily: Periplasmic binding protein-like I
family: L-arabinose binding protein-like
domain: Metabotropic glutamate receptor subtype 1
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.90  E-value=7.4e-24  Score=167.95  Aligned_cols=128  Identities=30%  Similarity=0.552  Sum_probs=108.5

Q ss_pred             CcccCCCCCCcCCCCCCceEEecCCchHHHHHHHHHHHhCCCcEEEEEEEeCCcchHHHHHHHHHhhhCceEEEEEeccc
Q psy12591          1 VSFWSTSPELSNKQRFEYFTRTIPSDHHQVKAMVEIVKKLGWSYVSIIYEESNYGVKAFEELEVLLAKYSICIAIKEKLV   80 (144)
Q Consensus         1 Is~~at~~~ls~~~~~p~ffRt~p~d~~~~~a~~~ll~~f~W~~Vaii~~~~~~g~~~~~~~~~~l~~~Gi~V~~~~~~~   80 (144)
                      |||+++++.|+++..||+||||.|++..|++++++|+++|||++|++|+++++||....+.|++.++++|+||+..+.++
T Consensus       148 IS~~ats~~lsd~~~yp~f~Rt~psd~~~~~ai~~ll~~f~W~~V~vi~~~d~~g~~~~~~l~~~~~~~~i~v~~~~~i~  227 (477)
T d1ewka_         148 IAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKELAAQEGLCIAHSDKIY  227 (477)
T ss_dssp             EESSCCCGGGGCTTTCTTEEESSCCHHHHHHHHHHHHHHTTCCEEEEEEESSHHHHHHHHHHHHHHHHHTCEEEEEEEEC
T ss_pred             eccccCCccccccccCCceEEecccchhhHHHHHHHHHHcCCcEEEEEEecchhHHHHHHHHHHHHHHcCcEEEEEeecc
Confidence            68999999999999999999999999999999999999999999999999999999999999999999999999999997


Q ss_pred             CCCCCcchhhHHHHHHHHhcC-CCceEEEEeeEEeeeCCcchhhhhHHHHHHHhcCc
Q psy12591         81 KDSGVAEETAYDDIVLKLLTK-PRARGLFKRLKLVKDSGVAEETAYDDIVLKLLTKP  136 (144)
Q Consensus        81 ~~~~~~~~~~~~~~l~~lk~~-~~arvii~~~~~~~~~g~~~~~~~~~~~~~~~~~~  136 (144)
                      ...   .+.++..++++||.+ .++||||+++.     .-....++.++.....++.
T Consensus       228 ~~~---~~~~~~~~l~~l~~~~~~~rVIv~~~~-----~~~~~~ll~~a~~~g~~g~  276 (477)
T d1ewka_         228 SNA---GEKSFDRLLRKLRERLPKARVVVCFCE-----GMTVRGLLSAMRRLGVVGE  276 (477)
T ss_dssp             TTC---CHHHHHHHHHHHHTTTTTCCEEEEECC-----HHHHHHHHHHHHHHTCCSC
T ss_pred             CCC---chhhHHHHHHHHhhhccCceEEEEecC-----HHHHHHHHHHHHHcCccCC
Confidence            765   378999999999842 47999999864     2222334444444444443



>d1dp4a_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jdpa_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1usga_ c.93.1.1 (A:) Leucine-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo0a_ c.93.1.1 (A:) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3ckma1 c.93.1.1 (A:257-573) YraM C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vlja_ e.22.1.2 (A:) NADH-dependent butanol dehydrogenase A (TM0820) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rrma_ e.22.1.2 (A:) Lactaldehyde reductase FucO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o2da_ e.22.1.2 (A:) Alcohol dehydrogenase TM0920 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y5ea1 c.57.1.1 (A:12-166) MoaB {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1jq5a_ e.22.1.2 (A:) Glycerol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mkza_ c.57.1.1 (A:) MoaB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1guda_ c.93.1.1 (A:) D-allose-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tjya_ c.93.1.1 (A:) AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1dbqa_ c.93.1.1 (A:) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uuya_ c.57.1.1 (A:) Plant CNX1 G domain {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1byka_ c.93.1.1 (A:) Trehalose repressor, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure