Psyllid ID: psy12635

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MELSFSIQTYEWGKIGLDSKVAQLVEAAGGTVDKDKNYAELWLGTHPSGPSSILSQCSRSENLESWIKNNPHCLGTDVISQFGEKLPFLLKVLSVDKALSIQMHPSKLQYPGCQIIFYDESSRSEEMNLFSRVYSRFPGDCGCFCVFLFNYVCLEEGQSIYIGANEPHAYLKGGNYKPDHSNEMRVCQKNNNNSSGPS
cccccccccccccccccccHHHHHHHHHccccccccccccccccccccccEEEEccccccccHHHHHHHccccccHHHHHHHccccHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHcccccccEEEEcccccEEEEEcccccccccHHHHHHHHHcccccccc
cccEccEEEccccccccHHHHHHHHHccccccccccEEcEEEEcccccccEEEcccccccccHHHHHHHcHHHHcHHHHHHHcccccEEEEEEEEcccccEEEcccHHHHHHHcccccccccccHHHHHHHHHHcccccccccccHHHEccccccHHHHHHccccHHHHHHccccccHHHHHHHHHHHcccccccccc
MELSFSIQTYEWGKIGLDSKVAQLVEAaggtvdkdknyaelwlgthpsgpssilsqcsrsENLESWiknnphclgtdvisQFGEKLPFLLKVLSVDKAlsiqmhpsklqypgcqiifydessrseEMNLFSRVysrfpgdcgcfcVFLFNyvcleegqsiyiganephaylkggnykpdhsnemrvcqknnnnssgps
MELSFSIQTYEWGKIGLDSKVAQLVEAAGGTVDKDKNYAELWLGTHPSGPSSILSQCSRSENLESWIKNNPHCLGTDVISQFGEKLPFLLKVLSVDKALSIqmhpsklqypgCQIIFYDESSRSEEMNLFSRVYSRFPGDCGCFCVFLFNYVCLEEGQSIYIGANEPHAYLKGGNYKPDHSNEMRVCqknnnnssgps
MELSFSIQTYEWGKIGLDSKVAQLVEAAGGTVDKDKNYAELWLGTHPSGPSSILSQCSRSENLESWIKNNPHCLGTDVISQFGEKLPFLLKVLSVDKALSIQMHPSKLQYPGCQIIFYDESSRSEEMNLFSRVYSRFPGDCGCFCVFLFNYVCLEEGQSIYIGANEPHAYLKGGNYKPDHSNEMRVCQKNNNNSSGPS
****FSIQTYEWGKIGLDSKVAQLVEAAGGTVDKDKNYAELWLGTH***************NLESWIKNNPHCLGTDVISQFGEKLPFLLKVLSVDKALSIQMHPSKLQYPGCQIIFYDESS**EEMNLFSRVYSRFPGDCGCFCVFLFNYVCLEEGQSIYIGANEPHAYLKG*************************
MELSFSIQTYEWGKIGLDSKVAQLVEAAGGTVDKDKNYAELWLGTHPSGPSSILSQCSRSENLESWIKNNPHCLGTDVISQFGEKLPFLLKVLSVDKALSIQMHPSKLQYPGCQIIFYDESSRSEEMNLFSRVYSRFPGDCGCFCVFLFNYVCLEEGQSIYIGANEPHAYLKGGNYKPDHSNEMRVCQKN*N******
MELSFSIQTYEWGKIGLDSKVAQLVEAAGGTVDKDKNYAELWLGTHPSGPSSILSQCSRSENLESWIKNNPHCLGTDVISQFGEKLPFLLKVLSVDKALSIQMHPSKLQYPGCQIIFYDESSRSEEMNLFSRVYSRFPGDCGCFCVFLFNYVCLEEGQSIYIGANEPHAYLKGGNYKPDHSNEMRVCQK*********
MELSFSIQTYEWGKIGLDSKVAQLVEAAGGTVDKDKNYAELWLGTHPSGPSSILSQCSRSENLESWIKNNPHCLGTDVISQFGEKLPFLLKVLSVDKALSIQMHPSKLQYPGCQIIFYDESSRSEEMNLFSRVYSRFPGDCGCFCVFLFNYVCLEEGQSIYIGANEPHAYLKGGNYKPDHSNEMRVCQK*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELSFSIQTYEWGKIGLDSKVAQLVEAAGGTVDKDKNYAELWLGTHPSGPSSILSQCSRSENLESWIKNNPHCLGTDVISQFGEKLPFLLKVLSVDKALSIQMHPSKLQYPGCQIIFYDESSRSEEMNLFSRVYSRFPGDCGCFCVFLFNYVCLEEGQSIYIGANEPHAYLKGGNYKPDHSNEMRVCQKNNNNSSGPS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query198 2.2.26 [Sep-21-2011]
Q924M7 423 Mannose-6-phosphate isome yes N/A 0.671 0.314 0.436 5e-24
Q3SZI0 423 Mannose-6-phosphate isome yes N/A 0.671 0.314 0.409 9e-22
Q9FZH5 441 Mannose-6-phosphate isome yes N/A 0.5 0.224 0.490 4e-21
A5A6K3 423 Mannose-6-phosphate isome yes N/A 0.671 0.314 0.402 5e-21
P34949 423 Mannose-6-phosphate isome yes N/A 0.671 0.314 0.402 5e-21
Q8HXX2 423 Mannose-6-phosphate isome N/A N/A 0.671 0.314 0.395 2e-20
Q9M884 432 Mannose-6-phosphate isome no N/A 0.727 0.333 0.387 3e-20
Q68FX1 423 Mannose-6-phosphate isome yes N/A 0.671 0.314 0.409 5e-20
O43014 412 Mannose-6-phosphate isome yes N/A 0.510 0.245 0.439 2e-18
P34948 441 Mannose-6-phosphate isome N/A N/A 0.656 0.294 0.405 2e-18
>sp|Q924M7|MPI_MOUSE Mannose-6-phosphate isomerase OS=Mus musculus GN=Mpi PE=2 SV=1 Back     alignment and function desciption
 Score =  110 bits (276), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 65/149 (43%), Positives = 84/149 (56%), Gaps = 16/149 (10%)

Query: 3   LSFSIQTYEWGKIGLDSKVAQLVEAAG--GTVDKDKNYAELWLGTHPSGPSSILSQCSRS 60
           LS  +Q Y WGK+G  S+VA L+ ++     + +DK YAELW+GTHP G + IL      
Sbjct: 9   LSCVVQQYAWGKVGSKSEVACLLASSDPLAQISEDKPYAELWMGTHPRGDAKILDNRISQ 68

Query: 61  ENLESWIKNNPHCLGTDVISQFGEKLPFLLKVLSVDKALSIQMHPSK-------LQYPGC 113
           + L  WI  NP CLG+ V + F  KLPFL KVLSVD ALSIQ HP+K       LQ P  
Sbjct: 69  KTLGQWIAENPDCLGSKVKNTFNGKLPFLFKVLSVDTALSIQAHPNKELAEKLHLQAPE- 127

Query: 114 QIIFYDESSRSEEMNLFSRVYSRFPGDCG 142
               Y +++   EM +     + F G CG
Sbjct: 128 ---HYPDANHKPEMAI---ALTSFQGLCG 150
Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions.
Mus musculus (taxid: 10090)
EC: 5EC: .EC: 3EC: .EC: 1EC: .EC: 8
>sp|Q3SZI0|MPI_BOVIN Mannose-6-phosphate isomerase OS=Bos taurus GN=MPI PE=2 SV=3 Back     alignment and function description
>sp|Q9FZH5|MPI2_ARATH Mannose-6-phosphate isomerase 2 OS=Arabidopsis thaliana GN=PMI2 PE=1 SV=1 Back     alignment and function description
>sp|A5A6K3|MPI_PANTR Mannose-6-phosphate isomerase OS=Pan troglodytes GN=MPI PE=2 SV=1 Back     alignment and function description
>sp|P34949|MPI_HUMAN Mannose-6-phosphate isomerase OS=Homo sapiens GN=MPI PE=1 SV=2 Back     alignment and function description
>sp|Q8HXX2|MPI_MACFA Mannose-6-phosphate isomerase OS=Macaca fascicularis GN=MPI PE=2 SV=3 Back     alignment and function description
>sp|Q9M884|MPI1_ARATH Mannose-6-phosphate isomerase 1 OS=Arabidopsis thaliana GN=PMI1 PE=1 SV=1 Back     alignment and function description
>sp|Q68FX1|MPI_RAT Mannose-6-phosphate isomerase OS=Rattus norvegicus GN=Mpi PE=2 SV=1 Back     alignment and function description
>sp|O43014|MPI_SCHPO Mannose-6-phosphate isomerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmi40 PE=3 SV=1 Back     alignment and function description
>sp|P34948|MPI_CANAL Mannose-6-phosphate isomerase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMI1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query198
426379794 362 PREDICTED: mannose-6-phosphate isomerase 0.863 0.472 0.353 2e-28
397479680 362 PREDICTED: mannose-6-phosphate isomerase 0.863 0.472 0.353 2e-28
332236162 362 PREDICTED: mannose-6-phosphate isomerase 0.863 0.472 0.353 5e-28
383858215 403 PREDICTED: mannose-6-phosphate isomerase 0.666 0.327 0.470 1e-24
66564896 403 PREDICTED: mannose-6-phosphate isomerase 0.601 0.295 0.5 2e-24
291239915 426 PREDICTED: mannose phosphate isomerase-l 0.530 0.246 0.542 2e-24
255581330 374 mannose-6-phosphate isomerase, putative 0.848 0.449 0.346 1e-23
119619704 342 mannose phosphate isomerase, isoform CRA 0.803 0.464 0.34 1e-23
380020793 404 PREDICTED: LOW QUALITY PROTEIN: mannose- 0.590 0.289 0.492 1e-23
147841344 455 hypothetical protein VITISV_011365 [Viti 0.525 0.228 0.528 4e-23
>gi|426379794|ref|XP_004056574.1| PREDICTED: mannose-6-phosphate isomerase isoform 3 [Gorilla gorilla gorilla] gi|16878311|gb|AAH17351.1| MPI protein [Homo sapiens] Back     alignment and taxonomy information
 Score =  130 bits (328), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 112/212 (52%), Gaps = 41/212 (19%)

Query: 3   LSFSIQTYEWGKIGLDSKVAQLVEAAG--GTVDKDKNYAELWLGTHPSGPSSILSQCSRS 60
           LS ++Q Y WGK+G +S+VA+L+ ++     + +DK YAELW+GTHP G + IL      
Sbjct: 9   LSCAVQQYAWGKMGSNSEVARLLASSDPLAQIAEDKPYAELWMGTHPRGDAKILDNRISQ 68

Query: 61  ENLESWIKNNPHCLGTDVISQFGEKLPFLLKVLSVDKALSIQMHPSK-------LQ---- 109
           + L  WI  N   LG+ V   F   LPFL KVLSV+  LSIQ HP+K       LQ    
Sbjct: 69  KTLSQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEKLHLQAPQH 128

Query: 110 YPGC-----------------------QIIFYDESSRSEEM-----NLFSRVYSRFPGDC 141
           YP                         +I+ + +++    M      L  +++ ++PGD 
Sbjct: 129 YPDANHKPEMAIALTPFQGLCGFRPVEEIVTFLKTAAGNNMEDIFGELLLQLHQQYPGDI 188

Query: 142 GCFCVFLFNYVCLEEGQSIYIGANEPHAYLKG 173
           GCF ++  N + L+ G+++++ AN PHAYLKG
Sbjct: 189 GCFAIYFLNLLTLKPGEAMFLEANVPHAYLKG 220

Source: Gorilla gorilla gorilla

Species: Gorilla gorilla

Genus: Gorilla

Family: Hominidae

Order: Primates

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota
>gi|397479680|ref|XP_003811136.1| PREDICTED: mannose-6-phosphate isomerase isoform 3 [Pan paniscus] Back     alignment and taxonomy information
>gi|332236162|ref|XP_003267272.1| PREDICTED: mannose-6-phosphate isomerase isoform 3 [Nomascus leucogenys] Back     alignment and taxonomy information
>gi|383858215|ref|XP_003704597.1| PREDICTED: mannose-6-phosphate isomerase-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|66564896|ref|XP_623842.1| PREDICTED: mannose-6-phosphate isomerase-like [Apis mellifera] Back     alignment and taxonomy information
>gi|291239915|ref|XP_002739863.1| PREDICTED: mannose phosphate isomerase-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|255581330|ref|XP_002531475.1| mannose-6-phosphate isomerase, putative [Ricinus communis] gi|223528902|gb|EEF30899.1| mannose-6-phosphate isomerase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|119619704|gb|EAW99298.1| mannose phosphate isomerase, isoform CRA_d [Homo sapiens] Back     alignment and taxonomy information
>gi|380020793|ref|XP_003694263.1| PREDICTED: LOW QUALITY PROTEIN: mannose-6-phosphate isomerase-like [Apis florea] Back     alignment and taxonomy information
>gi|147841344|emb|CAN60179.1| hypothetical protein VITISV_011365 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query198
MGI|MGI:97075 423 Mpi "mannose phosphate isomera 0.671 0.314 0.436 5.4e-35
UNIPROTKB|F1SJ30 423 MPI "Uncharacterized protein" 0.530 0.248 0.504 2e-34
UNIPROTKB|H3BUZ9 339 MPI "Mannose-6-phosphate isome 0.681 0.398 0.401 5.6e-34
UNIPROTKB|H3BPP3287 MPI "Mannose-6-phosphate isome 0.681 0.470 0.401 1.9e-33
UNIPROTKB|F1P6B2 567 MPI "Mannose-6-phosphate isome 0.681 0.238 0.421 2.9e-33
UNIPROTKB|Q3SZI0 423 MPI "Mannose-6-phosphate isome 0.681 0.319 0.408 1.3e-32
UNIPROTKB|H3BT46213 MPI "Mannose-6-phosphate isome 0.656 0.610 0.401 2.1e-32
TAIR|locus:2019748 441 DIN9 "DARK INDUCIBLE 9" [Arabi 0.510 0.229 0.509 4.1e-32
RGD|3107 423 Mpi "mannose phosphate isomera 0.671 0.314 0.409 4.7e-32
UNIPROTKB|P34949 423 MPI "Mannose-6-phosphate isome 0.681 0.319 0.401 5.2e-32
MGI|MGI:97075 Mpi "mannose phosphate isomerase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 275 (101.9 bits), Expect = 5.4e-35, Sum P(2) = 5.4e-35
 Identities = 65/149 (43%), Positives = 84/149 (56%)

Query:     3 LSFSIQTYEWGKIGLDSKVAQLVEAAG--GTVDKDKNYAELWLGTHPSGPSSILSQCSRS 60
             LS  +Q Y WGK+G  S+VA L+ ++     + +DK YAELW+GTHP G + IL      
Sbjct:     9 LSCVVQQYAWGKVGSKSEVACLLASSDPLAQISEDKPYAELWMGTHPRGDAKILDNRISQ 68

Query:    61 ENLESWIKNNPHCLGTDVISQFGEKLPFLLKVLSVDKALSIQMHPSK-------LQYPGC 113
             + L  WI  NP CLG+ V + F  KLPFL KVLSVD ALSIQ HP+K       LQ P  
Sbjct:    69 KTLGQWIAENPDCLGSKVKNTFNGKLPFLFKVLSVDTALSIQAHPNKELAEKLHLQAPE- 127

Query:   114 QIIFYDESSRSEEMNLFSRVYSRFPGDCG 142
                 Y +++   EM +     + F G CG
Sbjct:   128 ---HYPDANHKPEMAI---ALTSFQGLCG 150
GO:0004476 "mannose-6-phosphate isomerase activity" evidence=IDA
GO:0005737 "cytoplasm" evidence=IEA
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0006013 "mannose metabolic process" evidence=IC
GO:0008152 "metabolic process" evidence=IDA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0009298 "GDP-mannose biosynthetic process" evidence=IEA
GO:0016853 "isomerase activity" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
UNIPROTKB|F1SJ30 MPI "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|H3BUZ9 MPI "Mannose-6-phosphate isomerase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H3BPP3 MPI "Mannose-6-phosphate isomerase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1P6B2 MPI "Mannose-6-phosphate isomerase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SZI0 MPI "Mannose-6-phosphate isomerase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|H3BT46 MPI "Mannose-6-phosphate isomerase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2019748 DIN9 "DARK INDUCIBLE 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|3107 Mpi "mannose phosphate isomerase (mapped)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P34949 MPI "Mannose-6-phosphate isomerase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.3.1.8LOW CONFIDENCE prediction!
3rd Layer5.3.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
PLN02288 394 PLN02288, PLN02288, mannose-6-phosphate isomerase 8e-40
pfam01238 373 pfam01238, PMI_typeI, Phosphomannose isomerase typ 4e-26
COG1482 312 COG1482, ManA, Phosphomannose isomerase [Carbohydr 6e-26
TIGR00218 303 TIGR00218, manA, mannose-6-phosphate isomerase, cl 2e-18
PRK15131 389 PRK15131, PRK15131, mannose-6-phosphate isomerase; 4e-18
PLN02288394 PLN02288, PLN02288, mannose-6-phosphate isomerase 3e-15
pfam01238373 pfam01238, PMI_typeI, Phosphomannose isomerase typ 6e-08
PRK15131 389 PRK15131, PRK15131, mannose-6-phosphate isomerase; 3e-04
>gnl|CDD|215162 PLN02288, PLN02288, mannose-6-phosphate isomerase Back     alignment and domain information 
 Score =  139 bits (352), Expect = 8e-40
 Identities = 58/107 (54%), Positives = 74/107 (69%), Gaps = 1/107 (0%)

Query: 2   ELSFSIQTYEWGKIGLDSKVAQLVEAAGGT-VDKDKNYAELWLGTHPSGPSSILSQCSRS 60
            L  ++Q Y+WG+IG +S+VA+L  A  G+ VD DK YAELW+GTHPSGPS +++    S
Sbjct: 3   RLRCAVQNYDWGRIGSESEVARLAAANSGSDVDPDKPYAELWMGTHPSGPSFVVATGKGS 62

Query: 61  ENLESWIKNNPHCLGTDVISQFGEKLPFLLKVLSVDKALSIQMHPSK 107
             L+ WI  NP  LG  V+ ++G  LPFL KVLSV KALSIQ HP K
Sbjct: 63  VLLKEWIAENPAALGDRVVERWGGDLPFLFKVLSVAKALSIQAHPDK 109

Length = 394
>gnl|CDD|216382 pfam01238, PMI_typeI, Phosphomannose isomerase type I Back     alignment and domain information
>gnl|CDD|224399 COG1482, ManA, Phosphomannose isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|232879 TIGR00218, manA, mannose-6-phosphate isomerase, class I Back     alignment and domain information
>gnl|CDD|185085 PRK15131, PRK15131, mannose-6-phosphate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|215162 PLN02288, PLN02288, mannose-6-phosphate isomerase Back     alignment and domain information
>gnl|CDD|216382 pfam01238, PMI_typeI, Phosphomannose isomerase type I Back     alignment and domain information
>gnl|CDD|185085 PRK15131, PRK15131, mannose-6-phosphate isomerase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 198
PLN02288394 mannose-6-phosphate isomerase 100.0
PRK15131 389 mannose-6-phosphate isomerase; Provisional 100.0
KOG2757|consensus 411 100.0
COG1482 312 ManA Phosphomannose isomerase [Carbohydrate transp 100.0
TIGR00218 302 manA mannose-6-phosphate isomerase, class I. The n 100.0
PF01238373 PMI_typeI: Phosphomannose isomerase type I; InterP 100.0
PF01050151 MannoseP_isomer: Mannose-6-phosphate isomerase; In 96.3
COG4101142 Predicted mannose-6-phosphate isomerase [Carbohydr 95.78
COG0662127 {ManC} Mannose-6-phosphate isomerase [Carbohydrate 94.8
PF0788371 Cupin_2: Cupin domain; InterPro: IPR013096 This fa 94.71
COG1917131 Uncharacterized conserved protein, contains double 93.46
PF02373114 JmjC: JmjC domain, hydroxylase; InterPro: IPR01312 93.0
TIGR03037159 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase 92.53
PF02311136 AraC_binding: AraC-like ligand binding domain; Int 92.35
PRK13290125 ectC L-ectoine synthase; Reviewed 91.65
TIGR03214260 ura-cupin putative allantoin catabolism protein. T 91.25
PRK13264177 3-hydroxyanthranilate 3,4-dioxygenase; Provisional 91.02
PF08007319 Cupin_4: Cupin superfamily protein; InterPro: IPR0 90.73
PF06052151 3-HAO: 3-hydroxyanthranilic acid dioxygenase; Inte 90.12
PRK09943185 DNA-binding transcriptional repressor PuuR; Provis 89.68
PF00190144 Cupin_1: Cupin; InterPro: IPR006045 This family re 89.17
PF13621251 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XU 88.92
PF03079157 ARD: ARD/ARD' family; InterPro: IPR004313 The two 88.48
KOG2107|consensus179 87.12
PRK04190191 glucose-6-phosphate isomerase; Provisional 86.48
smart00835146 Cupin_1 Cupin. This family represents the conserve 86.35
PRK15457233 ethanolamine utilization protein EutQ; Provisional 84.92
PRK13500 312 transcriptional activator RhaR; Provisional 82.35
PRK15460478 cpsB mannose-1-phosphate guanyltransferase; Provis 81.5
PF12852186 Cupin_6: Cupin 81.29
>PLN02288 mannose-6-phosphate isomerase Back     alignment and domain information 
Probab=100.00  E-value=5.1e-50  Score=360.16  Aligned_cols=186  Identities=45%  Similarity=0.793  Sum_probs=161.5

Q ss_pred             CeeeccccccccCCCCCChHHHHHHHhhCC-CCCCCCcceeeeeeecCCCCeEEccCCcCCccHHHHHHhCCCCCCchhH
Q psy12635          1 MELSFSIQTYEWGKIGLDSKVAQLVEAAGG-TVDKDKNYAELWLGTHPSGPSSILSQCSRSENLESWIKNNPHCLGTDVI   79 (198)
Q Consensus         1 ~~l~p~~~~~~WGg~~~~s~i~~l~~~~~~-~~~~~~~~gE~W~s~hp~~~S~v~~~~~~~~~L~~~i~~~p~~lG~~~~   79 (198)
                      |+|+|.+|+|+||+++.+|.|++|++..+. .+++++||||+|+|+||+++|+|.++++.+++|.++|+++|++||....
T Consensus         2 ~~L~~~vq~YaWG~~~~~s~ia~l~~~~~~~~~~~~~p~aElW~g~hp~~pS~v~~~~~~~~~L~~~i~~~~~~lG~~~~   81 (394)
T PLN02288          2 LRLRCAVQNYDWGRIGSESEVARLAAANSGSDVDPDKPYAELWMGTHPSGPSFVVATGKGSVLLKEWIAENPAALGDRVV   81 (394)
T ss_pred             eeeeCCccccCCCCCChHHHHHHHhcccCCCcCCCCCcEEEEEeeECCCCCeEEeCCCCCCCcHHHHHHhChhhhCchhh
Confidence            689999999999999988999999986432 4567889999999999999999988776789999999999999999988


Q ss_pred             hhhcCCCceeeeeeccCCCceeeeCCCCC-------------CCCCc--eEE---------eccCCC-------------
Q psy12635         80 SQFGEKLPFLLKVLSVDKALSIQMHPSKL-------------QYPGC--QII---------FYDESS-------------  122 (198)
Q Consensus        80 ~~~g~~fP~L~K~Ld~~~~LSiQVHPdd~-------------~~p~~--ei~---------~G~~~~-------------  122 (198)
                      ++||++||||+|+||++++||||||||++             .|++|  ||+         +|+++.             
T Consensus        82 ~~~~~~lP~L~KvL~a~~~LSIQvHPd~~~A~~~~~~~P~~Y~D~nHKPEm~iALt~F~al~GFRp~~ei~~~l~~~p~l  161 (394)
T PLN02288         82 ERWGGDLPFLFKVLSVAKALSIQAHPDKKLAEKLHAEQPNVYKDDNHKPEMALALTEFEALCGFVTIQELKAVLRTVPEL  161 (394)
T ss_pred             hhccccCceEEEEeecCCCCceeeCCCHHHHHHhcccCccccCCCCCCceeEEEcChHHHhcCCCCHHHHHHHHHhChHH
Confidence            89999999999999999999999999998             23444  554         232110             


Q ss_pred             ----------------------------------------------------c----------cCHHHHHHHHHhhCCCC
Q psy12635        123 ----------------------------------------------------R----------SEEMNLFSRVYSRFPGD  140 (198)
Q Consensus       123 ----------------------------------------------------r----------~~~~el~~~l~~~~~~D  140 (198)
                                                                          |          ....+++.+|.++||+|
T Consensus       162 ~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~~f~~lm~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~l~~~L~~~yP~D  241 (394)
T PLN02288        162 RELVGSEAADQLLALPEHDGEEDVKSVLRSAFTALMTASKDVVTEAVSKLKARLHAESQARELTDKEELVLRLEKQYPGD  241 (394)
T ss_pred             HHHhhhhhhhhhhhccccccccchHHHHHHHHHHHHcCChHHHHHHHHHHHHHHHhcccccccchHHHHHHHHHHHCCCC
Confidence                                                                0          01345778889999999


Q ss_pred             cccchhccceeEECCCCCEEEecCCCceeecCCCeEEEEeccCCcc
Q psy12635        141 CGCFCVFLFNYVCLEEGQSIYIGANEPHAYLKGGNYKPDHSNEMRV  186 (198)
Q Consensus       141 ~g~~~~~~ln~v~v~pGd~i~IPaGt~HA~~~G~~~e~~~sSD~~~  186 (198)
                      +|+|+.++||++.++|||+||+|||++|||.+|+|||||++||.|+
T Consensus       242 ~G~~~~llLN~v~L~PGeaifl~ag~~HAYl~G~~vE~MA~SDNVl  287 (394)
T PLN02288        242 VGVLSAFFLNYVKLNPGEALYLGANEPHAYLSGECIECMATSDNVV  287 (394)
T ss_pred             CeeEhhhhhceEecCCCCEEEecCCCCceecCCCeEEeeecCCcee
Confidence            9999999999999999999999999999999999999999999855

>PRK15131 mannose-6-phosphate isomerase; Provisional Back     alignment and domain information
>KOG2757|consensus Back     alignment and domain information
>COG1482 ManA Phosphomannose isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00218 manA mannose-6-phosphate isomerase, class I Back     alignment and domain information
>PF01238 PMI_typeI: Phosphomannose isomerase type I; InterPro: IPR001250 Mannose-6-phosphate isomerase or phosphomannose isomerase (5 Back     alignment and domain information
>PF01050 MannoseP_isomer: Mannose-6-phosphate isomerase; InterPro: IPR001538 Mannose-6-phosphate isomerase or phosphomannose isomerase (5 Back     alignment and domain information
>COG4101 Predicted mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) Back     alignment and domain information
>COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PF02373 JmjC: JmjC domain, hydroxylase; InterPro: IPR013129 Jumonji protein is required for neural tube formation in mice [] Back     alignment and domain information
>TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase Back     alignment and domain information
>PF02311 AraC_binding: AraC-like ligand binding domain; InterPro: IPR003313 This entry defines the arabinose-binding and dimerisation domain of the bacterial gene regulatory protein AraC Back     alignment and domain information
>PRK13290 ectC L-ectoine synthase; Reviewed Back     alignment and domain information
>TIGR03214 ura-cupin putative allantoin catabolism protein Back     alignment and domain information
>PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional Back     alignment and domain information
>PF08007 Cupin_4: Cupin superfamily protein; InterPro: IPR022777 This signature represents primarily the cupin fold found in JmjC transcription factors Back     alignment and domain information
>PF06052 3-HAO: 3-hydroxyanthranilic acid dioxygenase; InterPro: IPR010329 Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase (1 Back     alignment and domain information
>PRK09943 DNA-binding transcriptional repressor PuuR; Provisional Back     alignment and domain information
>PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel) Back     alignment and domain information
>PF13621 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XUM_A 2Y0I_A 1MZE_A 3KCY_A 1MZF_A 1YCI_A 2ILM_A 1H2L_A Back     alignment and domain information
>PF03079 ARD: ARD/ARD' family; InterPro: IPR004313 The two acireductone dioxygenase enzymes (ARD and ARD', previously known as E-2 and E-2') from Klebsiella pneumoniae share the same amino acid sequence Q9ZFE7 from SWISSPROT, but bind different metal ions: ARD binds Ni2+, ARD' binds Fe2+ [] Back     alignment and domain information
>KOG2107|consensus Back     alignment and domain information
>PRK04190 glucose-6-phosphate isomerase; Provisional Back     alignment and domain information
>smart00835 Cupin_1 Cupin Back     alignment and domain information
>PRK15457 ethanolamine utilization protein EutQ; Provisional Back     alignment and domain information
>PRK13500 transcriptional activator RhaR; Provisional Back     alignment and domain information
>PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>PF12852 Cupin_6: Cupin Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
1pmi_A 440 Candida Albicans Phosphomannose Isomerase Length = 2e-19
1pmi_A 440 Candida Albicans Phosphomannose Isomerase Length = 4e-07
2wfp_A 394 Crystal Structure Of Mannose 6-Phosphate Isomerase 1e-12
2wfp_A 394 Crystal Structure Of Mannose 6-Phosphate Isomerase 2e-04
3h1m_A 393 Crystal Structure Of Mannose 6-Phosphate Isomerase 1e-12
3h1m_A 393 Crystal Structure Of Mannose 6-Phosphate Isomerase 2e-04
>pdb|1PMI|A Chain A, Candida Albicans Phosphomannose Isomerase Length = 440 Back     alignment and structure 
Iteration: 1

 Score = 92.0 bits (227), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 58/143 (40%), Positives = 78/143 (54%), Gaps = 13/143 (9%)
Query: 8   QTYEWGKIGLDSKVAQLVEAAGG--TVDKDKNYAELWLGTHPSGPSSILSQCSRSENLES 65
           Q Y+WGKIG  S VAQ V  +    T+D+ K YAELW+GTHPS PS  +     ++ L  
Sbjct: 13  QNYDWGKIGSSSAVAQFVHNSDPSITIDETKPYAELWMGTHPSVPSKAIDL--NNQTLRD 70
Query: 66  WIKNNPH-CLGTDVISQFG--EKLPFLLKVLSVDKALSIQMHPSK---LQYPGCQIIFYD 119
            +   P   LG  +I++FG  ++LPFL KVLS++K LSIQ HP K    Q        Y 
Sbjct: 71  LVTAKPQEYLGESIITKFGSSKELPFLFKVLSIEKVLSIQAHPDKKLGAQLHAADPKNYP 130
Query: 120 ESSRSEEMNLFSRVYSRFPGDCG 142
           + +   EM +     + F G CG
Sbjct: 131 DDNHKPEMAI---AVTDFEGFCG 150
>pdb|1PMI|A Chain A, Candida Albicans Phosphomannose Isomerase Length = 440 Back     alignment and structure
>pdb|2WFP|A Chain A, Crystal Structure Of Mannose 6-Phosphate Isomerase (Apo Form) From Salmonella Typhimurium Length = 394 Back     alignment and structure
>pdb|2WFP|A Chain A, Crystal Structure Of Mannose 6-Phosphate Isomerase (Apo Form) From Salmonella Typhimurium Length = 394 Back     alignment and structure
>pdb|3H1M|A Chain A, Crystal Structure Of Mannose 6-Phosphate Isomerase (Holo; Zinc Bound) Length = 393 Back     alignment and structure
>pdb|3H1M|A Chain A, Crystal Structure Of Mannose 6-Phosphate Isomerase (Holo; Zinc Bound) Length = 393 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
1pmi_A 440 PMI, phosphomannose isomerase; aldose-ketose isome 2e-25
1pmi_A 440 PMI, phosphomannose isomerase; aldose-ketose isome 4e-09
2wfp_A 394 Mannose-6-phosphate isomerase; APO-structure, meta 7e-22
2wfp_A 394 Mannose-6-phosphate isomerase; APO-structure, meta 9e-09
1qwr_A 319 Mannose-6-phosphate isomerase; structural genomics 3e-09
1zx5_A 300 Mannosephosphate isomerase, putative; STRU genomic 3e-08
>1pmi_A PMI, phosphomannose isomerase; aldose-ketose isomerase; 1.70A {Candida albicans} SCOP: b.82.1.3 Length = 440 Back     alignment and structure
 Score =  101 bits (251), Expect = 2e-25
 Identities = 56/147 (38%), Positives = 78/147 (53%), Gaps = 15/147 (10%)

Query: 6   SIQTYEWGKIGLDSKVAQLVEAA--GGTVDKDKNYAELWLGTHPSGPSSILSQCSRSENL 63
             Q Y+WGKIG  S VAQ V  +    T+D+ K YAELW+GTHPS PS  +   +++  L
Sbjct: 11  GYQNYDWGKIGSSSAVAQFVHNSDPSITIDETKPYAELWMGTHPSVPSKAIDLNNQT--L 68

Query: 64  ESWIKNNP-HCLGTDVISQFGE--KLPFLLKVLSVDKALSIQMHPSKLQ----YPGCQII 116
              +   P   LG  +I++FG   +LPFL KVLS++K LSIQ HP K      +      
Sbjct: 69  RDLVTAKPQEYLGESIITKFGSSKELPFLFKVLSIEKVLSIQAHPDKKLGAQLHAADPKN 128

Query: 117 FYDESSRSEEMNLFSRVYSRFPGDCGC 143
           + D++ + E         + F G CG 
Sbjct: 129 YPDDNHKPEMA----IAVTDFEGFCGF 151
>1pmi_A PMI, phosphomannose isomerase; aldose-ketose isomerase; 1.70A {Candida albicans} SCOP: b.82.1.3 Length = 440 Back     alignment and structure
>2wfp_A Mannose-6-phosphate isomerase; APO-structure, metal-binding; 1.67A {Salmonella typhimurium} PDB: 3h1w_A 3h1m_A 3h1y_A* Length = 394 Back     alignment and structure
>2wfp_A Mannose-6-phosphate isomerase; APO-structure, metal-binding; 1.67A {Salmonella typhimurium} PDB: 3h1w_A 3h1m_A 3h1y_A* Length = 394 Back     alignment and structure
>1qwr_A Mannose-6-phosphate isomerase; structural genomics, D-mannose 6-phosphate, PSI, protein structure initiative; 1.80A {Bacillus subtilis} SCOP: b.82.1.3 Length = 319 Back     alignment and structure
>1zx5_A Mannosephosphate isomerase, putative; STRU genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; HET: LFR; 2.30A {Archaeoglobus fulgidus} SCOP: b.82.1.3 Length = 300 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query198
1pmi_A 440 PMI, phosphomannose isomerase; aldose-ketose isome 100.0
2wfp_A 394 Mannose-6-phosphate isomerase; APO-structure, meta 100.0
1zx5_A300 Mannosephosphate isomerase, putative; STRU genomic 100.0
1qwr_A 319 Mannose-6-phosphate isomerase; structural genomics 100.0
2y0o_A175 Probable D-lyxose ketol-isomerase; carbohydrate me 97.02
2ozj_A114 Cupin 2, conserved barrel; cupin superfamily prote 94.7
2opk_A112 Hypothetical protein; putative mannose-6-phosphate 94.58
2i45_A107 Hypothetical protein; neisseria meningitidis cupin 94.18
3lwc_A119 Uncharacterized protein; structural genomics, unkn 94.12
1v70_A105 Probable antibiotics synthesis protein; structural 94.09
3fjs_A114 Uncharacterized protein with RMLC-like cupin fold; 93.96
1o5u_A101 Novel thermotoga maritima enzyme TM1112; cupin, st 93.94
2fqp_A97 Hypothetical protein BP2299; double-stranded beta- 93.6
2gu9_A113 Tetracenomycin polyketide synthesis protein; X-RAY 93.57
4h7l_A157 Uncharacterized protein; structural genomics, PSI- 93.56
3d82_A102 Cupin 2, conserved barrel domain protein; structur 93.37
2pfw_A116 Cupin 2, conserved barrel domain protein; cupin do 93.32
2q30_A110 Uncharacterized protein; double-stranded beta-heli 93.28
3h8u_A125 Uncharacterized conserved protein with double-STR 93.15
3ht1_A145 REMF protein; cupin fold, Zn-binding, antibiotic b 92.99
2b8m_A117 Hypothetical protein MJ0764; structural genomics, 92.9
1yhf_A115 Hypothetical protein SPY1581; structural genomics, 92.75
4e2g_A126 Cupin 2 conserved barrel domain protein; MCSG, PSI 92.74
2o8q_A134 Hypothetical protein; cpuin-like fold, structural 92.63
1yfu_A174 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid 92.56
3rns_A 227 Cupin 2 conserved barrel domain protein; structura 92.56
4axo_A151 EUTQ, ethanolamine utilization protein; structural 92.37
2oa2_A148 BH2720 protein; 10175341, structural genomics, joi 92.26
3cew_A125 Uncharacterized cupin protein; all beta-protein, j 92.25
1vr3_A191 Acireductone dioxygenase; 13543033, structural gen 92.23
4i4a_A128 Similar to unknown protein; structural genomics, P 92.22
1lr5_A163 Auxin binding protein 1; beta jellyroll, double st 92.17
1zrr_A179 E-2/E-2' protein; nickel, cupin, beta helix, methi 92.05
3kgz_A156 Cupin 2 conserved barrel domain protein; metallopr 92.02
3ibm_A167 Cupin 2, conserved barrel domain protein; cupin 2 91.97
2arc_A164 ARAC, arabinose operon regulatory protein; transcr 91.91
1zvf_A176 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b 91.81
3jzv_A166 Uncharacterized protein RRU_A2000; structural geno 91.75
2bnm_A198 Epoxidase; oxidoreductase, cupin, HTH, cation-depe 91.6
1dgw_A178 Canavalin; duplicated swiss-roll beta barrels, loo 91.51
2pyt_A133 Ethanolamine utilization protein EUTQ; structural 91.49
1juh_A350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 91.37
1y9q_A192 Transcriptional regulator, HTH_3 family; transcrip 91.25
3bcw_A123 Uncharacterized protein; structural genomics, join 91.13
1vj2_A126 Novel manganese-containing cupin TM1459; structura 91.11
3l2h_A162 Putative sugar phosphate isomerase; AFE_0303, stru 90.81
2xlg_A239 SLL1785 protein, CUCA; metal binding protein, cupi 90.54
1x82_A190 Glucose-6-phosphate isomerase; cupin superfamily, 90.5
1o4t_A133 Putative oxalate decarboxylase; double-stranded be 90.45
4b29_A217 Dimethylsulfoniopropionate lyase; hydrolase, dimet 90.4
4e2q_A266 Ureidoglycine aminohydrolase; BI-cupin, manganese 90.23
2qnk_A286 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol 90.0
2ozi_A98 Hypothetical protein RPA4178; APC6210, putative pr 89.94
4gjz_A235 Lysine-specific demethylase 8; JMJC, beta barrel, 89.86
3lag_A98 Uncharacterized protein RPA4178; functionally unkn 89.85
3rns_A227 Cupin 2 conserved barrel domain protein; structura 89.65
2vpv_A166 Protein MIF2, MIF2P; nucleus, mitosis, centromere, 89.49
2f4p_A147 Hypothetical protein TM1010; double-stranded beta- 89.24
1sef_A274 Conserved hypothetical protein; structural genomic 88.5
1fi2_A201 Oxalate oxidase, germin; beta-jellyroll, oxidoredu 87.91
3i7d_A163 Sugar phosphate isomerase; YP_168127.1, structural 87.69
1y3t_A 337 Hypothetical protein YXAG; BI cupin, dioxygenase, 87.56
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 87.48
1rc6_A261 Hypothetical protein YLBA; structural genomics, NY 87.34
1sfn_A 246 Conserved hypothetical protein; structural genomic 87.23
2d40_A 354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 86.61
1sq4_A 278 GLXB, glyoxylate-induced protein; structural genom 86.59
1rc6_A 261 Hypothetical protein YLBA; structural genomics, NY 86.05
1y3t_A337 Hypothetical protein YXAG; BI cupin, dioxygenase, 85.53
1sfn_A246 Conserved hypothetical protein; structural genomic 85.2
2vqa_A 361 SLL1358 protein, MNCA; periplasmic binding protein 84.99
2ypd_A392 Probable JMJC domain-containing histone demethyla 84.91
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 84.82
3h7j_A 243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 84.6
2vqa_A361 SLL1358 protein, MNCA; periplasmic binding protein 83.85
1sef_A 274 Conserved hypothetical protein; structural genomic 83.71
1vrb_A342 Putative asparaginyl hydroxylase; 2636534, structu 83.65
3k2o_A336 Bifunctional arginine demethylase and lysyl-hydro 83.42
1juh_A 350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 83.31
2e9q_A 459 11S globulin subunit beta; cucubitin, pumpkin SEED 83.02
2d5f_A 493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 82.74
1j58_A385 YVRK protein; cupin, decarboxyklase, oxalate, mang 82.68
2o1q_A145 Putative acetyl/propionyl-COA carboxylase, alpha; 82.63
3c3v_A510 Arachin ARAH3 isoform; peanut allergen, allergy, g 82.63
1fxz_A476 Glycinin G1; proglycinin, legumin, SEED storage pr 82.2
2ea7_A 434 7S globulin-1; beta barrel, cupin superfamily, pla 82.03
1uij_A 416 Beta subunit of beta conglycinin; double-stranded 81.83
3nw4_A 368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 81.77
2qnk_A 286 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol 81.54
3k3o_A 371 PHF8, PHD finger protein 8; histone demethylase, c 80.92
3es1_A172 Cupin 2, conserved barrel domain protein; YP_00116 80.89
3pua_A392 GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe 80.72
2cav_A 445 Protein (canavalin); vicilin, 7S SEED protein, dom 80.43
2xdv_A 442 MYC-induced nuclear antigen; ribosome biogenesis, 80.28
1fxz_A 476 Glycinin G1; proglycinin, legumin, SEED storage pr 80.27
2yu1_A 451 JMJC domain-containing histone demethylation PROT; 80.14
3kv4_A447 PHD finger protein 8; epigenetics, histone CODE, c 80.1
>1pmi_A PMI, phosphomannose isomerase; aldose-ketose isomerase; 1.70A {Candida albicans} SCOP: b.82.1.3 Back     alignment and structure
Probab=100.00  E-value=1.2e-49  Score=361.68  Aligned_cols=184  Identities=38%  Similarity=0.692  Sum_probs=156.2

Q ss_pred             CeeeccccccccCCCCCChHHHHHHHhhCC--CCCCCCcceeeeeeecCCCCeEEccCCcCCccHHHHHHhCCC-CCCch
Q psy12635          1 MELSFSIQTYEWGKIGLDSKVAQLVEAAGG--TVDKDKNYAELWLGTHPSGPSSILSQCSRSENLESWIKNNPH-CLGTD   77 (198)
Q Consensus         1 ~~l~p~~~~~~WGg~~~~s~i~~l~~~~~~--~~~~~~~~gE~W~s~hp~~~S~v~~~~~~~~~L~~~i~~~p~-~lG~~   77 (198)
                      |+|+|.+++|+|||+|+++++++|++..++  .++++++|||+|||+||+++|+|.++  +|++|.++|+++|. +||..
T Consensus         6 ~~l~p~~~~~~WGg~Gs~~l~~~l~~~~~~~~~~~~~~~~aE~W~g~hp~~~S~v~~~--~G~~L~~~i~~~~~~llG~~   83 (440)
T 1pmi_A            6 FRIQCGYQNYDWGKIGSSSAVAQFVHNSDPSITIDETKPYAELWMGTHPSVPSKAIDL--NNQTLRDLVTAKPQEYLGES   83 (440)
T ss_dssp             EEEEECEECCTTBEEGGGSHHHHHHHHHCTTSCCCTTSEECEEEESCCTTSCEEETTT--TTEEHHHHHHHCHHHHTCHH
T ss_pred             EEeecccCcCCCCCCchHHHHHHHhcCCCccccCCCCCCEEEEEEEecCCCCeEEeCC--CCCCHHHHHHhChHhhcCch
Confidence            589999999999998888889999876542  44457899999999999999999874  37999999999976 99999


Q ss_pred             hHhhhcC--CCceeeeeeccCCCceeeeCCCCC-------------CCCCc-----------eEEeccCCCc--------
Q psy12635         78 VISQFGE--KLPFLLKVLSVDKALSIQMHPSKL-------------QYPGC-----------QIIFYDESSR--------  123 (198)
Q Consensus        78 ~~~~~g~--~fP~L~K~Ld~~~~LSiQVHPdd~-------------~~p~~-----------ei~~G~~~~r--------  123 (198)
                      +.++||.  +||||+||||++++|||||||||+             .|+++           ++++|+++..        
T Consensus        84 ~~~~fg~~~~~P~L~K~Lda~~~LSiQvHPd~~~A~~~~~~~p~~YkD~ngKpE~~y~L~~~~~~~Gf~~~~ei~~~l~~  163 (440)
T 1pmi_A           84 IITKFGSSKELPFLFKVLSIEKVLSIQAHPDKKLGAQLHAADPKNYPDDNHKPEMAIAVTDFEGFCGFKPLDQLAKTLAT  163 (440)
T ss_dssp             HHHHHCCSSSCSEEEEEEEESSCCCEEECCCHHHHHHHHHHCTTTCCSSCCCCEEEEESSCEEEEEEECCHHHHHHHHHH
T ss_pred             hhhhcCCcccCcEEEhhhccCCCCceeeCcCHHHHHHhhcccccccCCCCCCcEEEEEccchhhhhcCCcHHHHHHHHhh
Confidence            9999998  899999999999999999999998             12333           4456766520        


Q ss_pred             -------c-------------------------CH-------------------------------------------HH
Q psy12635        124 -------S-------------------------EE-------------------------------------------MN  128 (198)
Q Consensus       124 -------~-------------------------~~-------------------------------------------~e  128 (198)
                             .                         ++                                           .+
T Consensus       164 ~pel~~~v~~~~~~~l~~~~~~~~~~~~~~~~~~~~~L~~~f~~lm~~~~~~~~~~v~~l~~~~~~~~~~~~~~~~~~~~  243 (440)
T 1pmi_A          164 VPELNEIIGQELVDEFISGIKLPAEVGSQDDVNNRKLLQKVFGKLMNTDDDVIKQQTAKLLERTDREPQVFKDIDSRLPE  243 (440)
T ss_dssp             CHHHHHHHCHHHHHHHHHHCCCSCCTTSHHHHHHHHHHHHHHHHHHTSCHHHHHHHHHHHHHHHHHCHHHHHTTCTTHHH
T ss_pred             chhhhhhhchhhhhhhhhhcccccccccccccccHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHhhccccccccchHHH
Confidence                   0                         00                                           23


Q ss_pred             HHHHHHhhCCCCcccch-hccceeEECCCCCEEEecCCCceeecCCCeEEEEeccCCcc
Q psy12635        129 LFSRVYSRFPGDCGCFC-VFLFNYVCLEEGQSIYIGANEPHAYLKGGNYKPDHSNEMRV  186 (198)
Q Consensus       129 l~~~l~~~~~~D~g~~~-~~~ln~v~v~pGd~i~IPaGt~HA~~~G~~~e~~~sSD~~~  186 (198)
                      ++.+|.++||+|+|+|+ .++||+|+|+|||+|||||||+|||++|+|||||++||+|+
T Consensus       244 ~i~~L~~~yP~D~G~~~~~~lLN~v~L~pGea~flpAg~~HAYl~G~~vE~Ma~SDNV~  302 (440)
T 1pmi_A          244 LIQRLNKQFPNDIGLFCGCLLLNHVGLNKGEAMFLQAKDPHAYISGDIIECMAASDNVV  302 (440)
T ss_dssp             HHHHHHHHSTTCTHHHHTTTTEEEEEECTTCEEEECTTCCEEEEEEEEEEEEESCCCCE
T ss_pred             HHHHHHHHCCCCccceehhhhcceEecCCCCEEecCCCCccccCCCcEEEEeccCCcEE
Confidence            44556788999999999 99999999999999999999999999999999999999865
>2wfp_A Mannose-6-phosphate isomerase; APO-structure, metal-binding; 1.67A {Salmonella typhimurium} PDB: 3h1w_A 3h1m_A 3h1y_A* Back     alignment and structure
>1zx5_A Mannosephosphate isomerase, putative; STRU genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; HET: LFR; 2.30A {Archaeoglobus fulgidus} SCOP: b.82.1.3 Back     alignment and structure
>1qwr_A Mannose-6-phosphate isomerase; structural genomics, D-mannose 6-phosphate, PSI, protein structure initiative; 1.80A {Bacillus subtilis} SCOP: b.82.1.3 Back     alignment and structure
>2y0o_A Probable D-lyxose ketol-isomerase; carbohydrate metabolism, metal-binding, sugar ISO stress response; HET: MSE; 1.23A {Bacillus subtilis subsp} Back     alignment and structure
>2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} Back     alignment and structure
>2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha} Back     alignment and structure
>2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} Back     alignment and structure
>3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} Back     alignment and structure
>1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Back     alignment and structure
>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Back     alignment and structure
>1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A Back     alignment and structure
>2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} Back     alignment and structure
>2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Back     alignment and structure
>4h7l_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, cupin, unknown function; 2.45A {Planctomyces limnophilus} Back     alignment and structure
>3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} Back     alignment and structure
>2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} Back     alignment and structure
>2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A Back     alignment and structure
>2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18 Back     alignment and structure
>1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 Back     alignment and structure
>4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} Back     alignment and structure
>2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans} Back     alignment and structure
>1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A* Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile} Back     alignment and structure
>2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans} Back     alignment and structure
>3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} Back     alignment and structure
>1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6 Back     alignment and structure
>4i4a_A Similar to unknown protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.35A {Photorhabdus luminescens subsp} Back     alignment and structure
>1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* Back     alignment and structure
>1zrr_A E-2/E-2' protein; nickel, cupin, beta helix, methionine salvage, oxidoreductase; NMR {Klebsiella oxytoca} SCOP: b.82.1.6 PDB: 2hji_A Back     alignment and structure
>3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} Back     alignment and structure
>3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} Back     alignment and structure
>2arc_A ARAC, arabinose operon regulatory protein; transcription factor, carbohydrate binding, coiled-coil, jelly roll; HET: ARA; 1.50A {Escherichia coli} SCOP: b.82.4.1 PDB: 2aac_A* 1xja_A 2ara_A Back     alignment and structure
>1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20 Back     alignment and structure
>3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A Back     alignment and structure
>1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Back     alignment and structure
>2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Back     alignment and structure
>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 Back     alignment and structure
>3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} Back     alignment and structure
>1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 Back     alignment and structure
>3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} Back     alignment and structure
>2xlg_A SLL1785 protein, CUCA; metal binding protein, cupin; 1.80A {Synechocystis SP} PDB: 2xl7_A 2xl9_A 2xlf_A* 2xla_A Back     alignment and structure
>1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* Back     alignment and structure
>1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} Back     alignment and structure
>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A Back     alignment and structure
>2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A Back     alignment and structure
>4gjz_A Lysine-specific demethylase 8; JMJC, beta barrel, Fe(II) and 2-oxoglutarate binding, oxidor; HET: AKG BME; 1.05A {Homo sapiens} PDB: 4gjy_A* 4aap_A* 3uyj_A* Back     alignment and structure
>3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris} Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>2vpv_A Protein MIF2, MIF2P; nucleus, mitosis, centromere, cell cycle, DNA-binding, kinetochore, cell division, phosphoprotein, jelly-roll fold; 2.7A {Saccharomyces cerevisiae} Back     alignment and structure
>2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 Back     alignment and structure
>1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A Back     alignment and structure
>3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 Back     alignment and structure
>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Back     alignment and structure
>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Back     alignment and structure
>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>2ypd_A Probable JMJC domain-containing histone demethyla PROT EIN 2C; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 Back     alignment and structure
>1vrb_A Putative asparaginyl hydroxylase; 2636534, structural genomi center for structural genomics, JCSG, protein structure INI PSI, oxidoreductase; 2.60A {Bacillus subtilis} SCOP: b.82.2.11 Back     alignment and structure
>3k2o_A Bifunctional arginine demethylase and lysyl-hydro JMJD6; structural genomics consortium, SGC, chromatin regulator, developmental protein; 1.75A {Homo sapiens} PDB: 3ld8_A 3ldb_A* Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Back     alignment and structure
>2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure
>2o1q_A Putative acetyl/propionyl-COA carboxylase, alpha; putative acetylacetone dioxygenase, structural genomics; HET: MSE PG4; 1.50A {Methylibium petroleiphilum} SCOP: b.82.1.21 Back     alignment and structure
>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A Back     alignment and structure
>2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A Back     alignment and structure
>3k3o_A PHF8, PHD finger protein 8; histone demethylase, chromatin modification, methylated H3K9, mental retardation, metal-BI phosphoprotein, zinc-finger; HET: AKG; 2.10A {Homo sapiens} PDB: 3k3n_A* 4do0_A* 2wwu_A* Back     alignment and structure
>3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>3pua_A GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe2+ dependent dioxygenases, histone TAI protein, protein binding; HET: OGA; 1.89A {Homo sapiens} PDB: 3pu3_A* 3ptr_B* 3pu8_B* 3pus_A* Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Back     alignment and structure
>2xdv_A MYC-induced nuclear antigen; ribosome biogenesis, nuclear protein; HET: OGA; 2.57A {Homo sapiens} Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Back     alignment and structure
>2yu1_A JMJC domain-containing histone demethylation PROT; JMJC-domain-containing histone demethylases, oxidoreductase; HET: AKG; 2.70A {Homo sapiens} PDB: 2yu2_A Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 198
d1pmia_ 440 b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Can 6e-33
d1pmia_ 440 b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Can 6e-08
d1qwra_ 315 b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA { 8e-20
d1zx5a1299 b.82.1.3 (A:1-299) Putative mannosephosphate isome 2e-18
>d1pmia_ b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Candida albicans) [TaxId: 5476]} Length = 440 Back     information, alignment and structure

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Type I phosphomannose isomerase
domain: Phosphomannose isomerase
species: Yeast (Candida albicans) [TaxId: 5476]

 Score =  120 bits (301), Expect = 6e-33
 Identities = 49/107 (45%), Positives = 66/107 (61%), Gaps = 7/107 (6%)

Query: 6   SIQTYEWGKIGLDSKVAQLVEAAGGT--VDKDKNYAELWLGTHPSGPSSILSQCSRSENL 63
             Q Y+WGKIG  S VAQ V  +  +  +D+ K YAELW+GTHPS PS  +   +++  L
Sbjct: 11  GYQNYDWGKIGSSSAVAQFVHNSDPSITIDETKPYAELWMGTHPSVPSKAIDLNNQT--L 68

Query: 64  ESWIKNNP-HCLGTDVISQFGE--KLPFLLKVLSVDKALSIQMHPSK 107
              +   P   LG  +I++FG   +LPFL KVLS++K LSIQ HP K
Sbjct: 69  RDLVTAKPQEYLGESIITKFGSSKELPFLFKVLSIEKVLSIQAHPDK 115
>d1pmia_ b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Candida albicans) [TaxId: 5476]} Length = 440 Back     information, alignment and structure
>d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]} Length = 315 Back     information, alignment and structure
>d1zx5a1 b.82.1.3 (A:1-299) Putative mannosephosphate isomerase AF0035 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 299 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query198
d1pmia_ 440 Phosphomannose isomerase {Yeast (Candida albicans) 100.0
d1qwra_ 315 Mannose-6-phosphate isomerase ManA {Bacillus subti 100.0
d1zx5a1299 Putative mannosephosphate isomerase AF0035 {Archae 100.0
d2bnma2122 Hydroxypropylphosphonic acid epoxidase Fom4, C-ter 94.38
d1yhfa1112 Hypothetical protein SPy1581 {Streptococcus pyogen 94.33
d1v70a_105 Hypothetical protein TTHA0104 {Thermus thermophilu 94.0
d1lr5a_160 Auxin binding protein {Maize (Zea mays) [TaxId: 45 93.77
d1o4ta_115 Hypothetical protein TM1287 {Thermotoga maritima [ 93.21
d1y9qa299 Probable transcriptional regulator VC1968, C-termi 93.04
d2b8ma1108 Hypothetical protein MJ0764 {Archaeon Methanococcu 93.04
d1yfua1174 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia m 93.0
d2pyta1128 Ethanolamine utilization protein EutQ {Salmonella 92.76
d1uija1170 Seed storage 7S protein {Soybean (Glycine max), be 92.68
d1sefa_250 Hypothetical protein EF2996 {Enterococcus faecalis 92.59
d1vj2a_114 Hypothetical protein TM1459 {Thermotoga maritima [ 92.52
d1rc6a_253 Hypothetical protein YlbA {Escherichia coli [TaxId 92.42
d2f4pa1134 Hypothetical protein TM1010 {Thermotoga maritima [ 92.17
d2arca_161 Regulatory protein AraC {Escherichia coli [TaxId: 91.57
d1zvfa1175 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yea 91.21
d1sfna_245 Hypothetical protein DR1152 {Deinococcus radiodura 91.05
d1x82a_190 Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc 90.89
d1uika1203 Seed storage 7S protein {Soybean (Glycine max), be 90.44
d1dgwa_178 Seed storage 7S protein {Jack bean (Canavalia ensi 90.38
d1vrba1319 Putative asparaginyl hydroxylase YxbC {Bacillus su 90.14
d1zrra1179 Acireductone dioxygenase {Klebsiella pneumoniae [T 90.01
d1juha_348 Quercetin 2,3-dioxygenase {Aspergillus japonicus [ 89.94
d2phla1200 Seed storage 7S protein {French bean (Phaseolus vu 89.45
d1sq4a_273 Glyoxylate-induced protein PA1140 {Pseudomonas aer 88.88
d1vr3a1179 Acireductone dioxygenase {Mouse (Mus musculus) [Ta 88.22
d1y3ta1330 Hypothetical protein YxaG {Bacillus subtilis [TaxI 88.08
g1dgw.1168 Seed storage 7S protein {Jack bean (Canavalia ensi 88.02
d1juha_ 348 Quercetin 2,3-dioxygenase {Aspergillus japonicus [ 87.7
d1y3ta1 330 Hypothetical protein YxaG {Bacillus subtilis [TaxI 86.18
d2phla2162 Seed storage 7S protein {French bean (Phaseolus vu 85.85
d1fxza2174 Seed storage 7S protein {Soybean (Glycine max), pr 85.57
d2d40a1 308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 85.48
d1sefa_ 250 Hypothetical protein EF2996 {Enterococcus faecalis 85.22
d1sfna_ 245 Hypothetical protein DR1152 {Deinococcus radiodura 85.05
d1uika2185 Seed storage 7S protein {Soybean (Glycine max), be 84.38
d1sq4a_ 273 Glyoxylate-induced protein PA1140 {Pseudomonas aer 82.81
d1j58a_372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 81.81
d1od5a2173 Seed storage 7S protein {Soybean (Glycine max), gl 81.75
d1h2ka_335 Hypoxia-inducible factor HIF ihhibitor (FIH1) {Hum 81.31
d1j58a_ 372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 81.21
>d1pmia_ b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Type I phosphomannose isomerase
domain: Phosphomannose isomerase
species: Yeast (Candida albicans) [TaxId: 5476]

Probab=100.00  E-value=1.3e-51  Score=372.65  Aligned_cols=185  Identities=38%  Similarity=0.688  Sum_probs=160.4

Q ss_pred             CeeeccccccccCCCCCChHHHHHHHhhCC--CCCCCCcceeeeeeecCCCCeEEccCCcCCccHHHHHHhCCC-CCCch
Q psy12635          1 MELSFSIQTYEWGKIGLDSKVAQLVEAAGG--TVDKDKNYAELWLGTHPSGPSSILSQCSRSENLESWIKNNPH-CLGTD   77 (198)
Q Consensus         1 ~~l~p~~~~~~WGg~~~~s~i~~l~~~~~~--~~~~~~~~gE~W~s~hp~~~S~v~~~~~~~~~L~~~i~~~p~-~lG~~   77 (198)
                      |+|+|.+|+|+||++|++|+|++|++...+  .+++++||||+|||+||+++|+|.++.  +++|.++++++|+ +||..
T Consensus         6 ~~l~~~~q~Y~WG~~g~~s~i~~l~~~~~~~~~~~~~~P~AElW~g~Hp~~pS~v~~g~--g~~L~~~i~~~p~~~LG~~   83 (440)
T d1pmia_           6 FRIQCGYQNYDWGKIGSSSAVAQFVHNSDPSITIDETKPYAELWMGTHPSVPSKAIDLN--NQTLRDLVTAKPQEYLGES   83 (440)
T ss_dssp             EEEEECEECCTTBEEGGGSHHHHHHHHHCTTSCCCTTSEECEEEESCCTTSCEEETTTT--TEEHHHHHHHCHHHHTCHH
T ss_pred             EeccCCcccCCCCCCCchhHHHHHhccCCCccccCCCCEEEEEEeeeCCCCceeeecCC--CCcHHHHHHhChHhhcChh
Confidence            689999999999999999999999998765  455778999999999999999998774  8999999999999 99999


Q ss_pred             hHhhhcC--CCceeeeeeccCCCceeeeCCCCC-------------CCC--CceEEe---------ccCCC---------
Q psy12635         78 VISQFGE--KLPFLLKVLSVDKALSIQMHPSKL-------------QYP--GCQIIF---------YDESS---------  122 (198)
Q Consensus        78 ~~~~~g~--~fP~L~K~Ld~~~~LSiQVHPdd~-------------~~p--~~ei~~---------G~~~~---------  122 (198)
                      +.++||.  +||||+|+||++++||||||||++             .++  +.|+++         |+++.         
T Consensus        84 ~~~~fg~~~~lP~L~KvLda~~~LSIQVHPd~~~A~~~~~~~~~~y~D~n~KpE~~~aLt~F~al~Gfrp~~ei~~~L~~  163 (440)
T d1pmia_          84 IITKFGSSKELPFLFKVLSIEKVLSIQAHPDKKLGAQLHAADPKNYPDDNHKPEMAIAVTDFEGFCGFKPLDQLAKTLAT  163 (440)
T ss_dssp             HHHHHCCSSSCSEEEEEEEESSCCCEEECCCHHHHHHHHHHCTTTCCSSCCCCEEEEESSCEEEEEEECCHHHHHHHHHH
T ss_pred             hHhhcCCCcCCceeeeeeccCCCCceeeCCCHHHHHhhccccccccCCCCCCceEEEEecchhhhcCCCCHHHHHHHHHh
Confidence            9999985  899999999999999999999997             122  337764         33211         


Q ss_pred             --------------------------------------------------------------------------ccCHHH
Q psy12635        123 --------------------------------------------------------------------------RSEEMN  128 (198)
Q Consensus       123 --------------------------------------------------------------------------r~~~~e  128 (198)
                                                                                                .....+
T Consensus       164 ~p~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~~f~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~  243 (440)
T d1pmia_         164 VPELNEIIGQELVDEFISGIKLPAEVGSQDDVNNRKLLQKVFGKLMNTDDDVIKQQTAKLLERTDREPQVFKDIDSRLPE  243 (440)
T ss_dssp             CHHHHHHHCHHHHHHHHHHCCCSCCTTSHHHHHHHHHHHHHHHHHHTSCHHHHHHHHHHHHHHHHHCHHHHHTTCTTHHH
T ss_pred             ChHHHHhhhhhhhhhhhhhhccccccccccchhHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHhhchhcccccchhHHH
Confidence                                                                                      011235


Q ss_pred             HHHHHHhhCCCCcccch-hccceeEECCCCCEEEecCCCceeecCCCeEEEEeccCCccc
Q psy12635        129 LFSRVYSRFPGDCGCFC-VFLFNYVCLEEGQSIYIGANEPHAYLKGGNYKPDHSNEMRVC  187 (198)
Q Consensus       129 l~~~l~~~~~~D~g~~~-~~~ln~v~v~pGd~i~IPaGt~HA~~~G~~~e~~~sSD~~~~  187 (198)
                      ++.+|.++||+|+|+++ .++||+++|+|||+|||||||+|||++|++||||++||+|+-
T Consensus       244 ~~~~l~~~yp~D~g~~~~~l~LN~v~l~pGdaifvpaG~~HAyl~G~~vEima~SDnV~R  303 (440)
T d1pmia_         244 LIQRLNKQFPNDIGLFCGCLLLNHVGLNKGEAMFLQAKDPHAYISGDIIECMAASDNVVR  303 (440)
T ss_dssp             HHHHHHHHSTTCTHHHHTTTTEEEEEECTTCEEEECTTCCEEEEEEEEEEEEESCCCCEE
T ss_pred             HHHHHHHHCCCCcchhhHhhhheeecccccceEEcCCCCceEecCCcEEEEecccCcEEE
Confidence            77888999999999997 578999999999999999999999999999999999998763
>d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zx5a1 b.82.1.3 (A:1-299) Putative mannosephosphate isomerase AF0035 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1yfua1 b.82.1.20 (A:1-174) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]} Back     information, alignment and structure
>d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2arca_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zvfa1 b.82.1.20 (A:1-175) 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Back     information, alignment and structure
>d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Back     information, alignment and structure
>d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure
>d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure