Psyllid ID: psy1264

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MFKFQIQIKDWKKDVKRIVLPGLYVGNYRDSKDAVQLDRFNITHIVAIHDSARKIHPVSKTKASQPANHYQVDPRGGPDQVYLSEQNISHFSLAGMSRSVTVTIAYIMSVTSLNWKEALKVVRVGRAIANPNNGFQKQLQDFECFRLADERRRLRERFPSRALASMDEEQCQLLLIAYQGLLSGKHICEGNCAMGEICPTGMCRASRSR
ccccccccccccccccccccccEEEccHHccccHHHHHHccccEEEEEcccccccccccccccccccccccccccccHHHHHcccccEEEEccccccHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccc
ccEEEEEcccccccccEEEcccEEEccccccccHHHHHHcccEEEEEEcccccccccccccccccHHHHcHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccccHHHHHHHHHHHHcHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccc
MFKFQIQIKDWkkdvkrivlpglyvgnyrdskdavqldrfNITHIVAIHDsarkihpvsktkasqpanhyqvdprggpdqvylseqnishfslagmSRSVTVTIAYIMSVTSLNWKEALKVVRVGRaianpnngfqkqLQDFECFRLADERRRLRErfpsralasMDEEQCQLLLIAYQGLlsgkhicegncamgeicptgmcrasrsr
mfkfqiqikdwkkdvkrivlpglyvgnyrdskdavQLDRFNITHIVAIHDSARKIHPVsktkasqpanhyqVDPRGGPDQVYLSEQNISHFSLAGMSRSVTVTIAYIMSVTSLNWKEALKVVRVGRAIAnpnngfqkqlqdFECFRLADERRRLRERFPsralasmdEEQCQLLLIAYQGLLSGKHICEGNCamgeicptgmcrasrsr
MFKFQIQIKDWKKDVKRIVLPGLYVGNYRDSKDAVQLDRFNITHIVAIHDSARKIHPVSKTKASQPANHYQVDPRGGPDQVYLSEQNISHFSLAGMSRSVTVTIAYIMSVTSLNWKEALKVVRVGRAIANPNNGFQKQLQDFECfrladerrrlrerfpsraLASMDEEQCQLLLIAYQGLLSGKHICEGNCAMGEICPTGMCRASRSR
***FQIQIKDWKKDVKRIVLPGLYVGNYRDSKDAVQLDRFNITHIVAIHDSA****************************VYLSEQNISHFSLAGMSRSVTVTIAYIMSVTSLNWKEALKVVRVGRAIANPNNGFQKQLQDFECFRLADER***************DEEQCQLLLIAYQGLLSGKHICEGNCAMGEICPTGMC******
*****IQIKDWKKDVKRIVLPGLYVGNYRDSKDAVQLDRFNITHIVAIHDSARKIHPVSKTKASQPANHYQVDPRGGPDQVYLSEQNISHFSLAGMSRSVTVTIAYIMSVTSLNWKEALKVVRVGRAIANPNNGFQKQLQDFEC*****************************************************************
MFKFQIQIKDWKKDVKRIVLPGLYVGNYRDSKDAVQLDRFNITHIVAIHDSARK***************YQVDPRGGPDQVYLSEQNISHFSLAGMSRSVTVTIAYIMSVTSLNWKEALKVVRVGRAIANPNNGFQKQLQDFECFRLADERRRLRERFPSRALASMDEEQCQLLLIAYQGLLSGKHICEGNCAMGEICPTGMCRASRSR
MFKFQIQIKDWKKDVKRIVLPGLYVGNYRDSKDAVQLDRFNITHIVAIHDSARKIHPVSKTKASQPANHYQVDPRGGPDQVYLSEQNISHFSLAGMSRSVTVTIAYIMSVTSLNWKEALKVVRVGRAIANPNNGFQKQLQDFECFRLADERRRLRERFPSRALASMDEEQCQLLLIAYQGLLSGKHICEGNCAMGEICPTG********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFKFQIQIKDWKKDVKRIVLPGLYVGNYRDSKDAVQLDRFNITHIVAIHDSARKIHPVSKTKASQPANHYQVDPRGGPDQVYLSEQNISHFSLAGMSRSVTVTIAYIMSVTSLNWKEALKVVRVGRAIANPNNGFQKQLQDFECFRLADERRRLRERFPSRALASMDEEQCQLLLIAYQGLLSGKHICEGNCAMGEICPTGMCRASRSR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query209 2.2.26 [Sep-21-2011]
Q99N11184 Dual specificity protein yes N/A 0.712 0.809 0.411 3e-28
Q9NRW4184 Dual specificity protein yes N/A 0.712 0.809 0.398 2e-27
Q5XHB2209 Dual specificity protein yes N/A 0.736 0.736 0.384 2e-24
Q566R7183 Dual specificity protein yes N/A 0.736 0.841 0.406 3e-24
Q6GQJ8209 Dual specificity protein N/A N/A 0.736 0.736 0.378 5e-24
Q8R4V2235 Dual specificity protein no N/A 0.708 0.629 0.385 7e-23
Q9H1R2295 Dual specificity protein no N/A 0.588 0.416 0.393 5e-20
Q1LWL2208 Dual specificity protein no N/A 0.698 0.701 0.329 4e-18
Q9ZR37198 Dual specificity protein yes N/A 0.622 0.656 0.297 2e-09
Q9VVW5411 Dual specificity protein no N/A 0.679 0.345 0.324 1e-08
>sp|Q99N11|DUS22_MOUSE Dual specificity protein phosphatase 22 OS=Mus musculus GN=Dusp22 PE=1 SV=1 Back     alignment and function desciption
 Score =  125 bits (313), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 96/158 (60%), Gaps = 9/158 (5%)

Query: 19  VLPGLYVGNYRDSKDAVQLDRFNITHIVAIHDSARKIH--------PVSKTKASQPANHY 70
           +LPGLY+GN++D++DA QL R  +THI+++HD+AR +         P + T +     H+
Sbjct: 8   ILPGLYIGNFKDARDAEQLSRNKVTHILSVHDTARPMLEGVKYLCIPAADTPSQNLTRHF 67

Query: 71  QVDPRGGPDQVYLSEQNISHFSLAGMSRSVTVTIAYIMSVTSLNWKEALKVVRVGRAIAN 130
           +   +   +     E  + H  LAG+SRSVT+ IAYIM+VT   W++AL  VR GR+ AN
Sbjct: 68  KESIKFIHECRLQGESCLVH-CLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCAN 126

Query: 131 PNNGFQKQLQDFECFRLADERRRLRERFPSRALASMDE 168
           PN GFQ+QLQ+FE   +   R+ LRE +    L   +E
Sbjct: 127 PNLGFQRQLQEFEKHEVHQYRQWLREEYGENPLRDAEE 164
Activates the Jnk signaling pathway. Dephosphorylates and deactivates p38 and stress-activated protein kinase/c-Jun N-terminal kinase (SAPK/JNK).
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8
>sp|Q9NRW4|DUS22_HUMAN Dual specificity protein phosphatase 22 OS=Homo sapiens GN=DUSP22 PE=1 SV=1 Back     alignment and function description
>sp|Q5XHB2|DUS22_XENTR Dual specificity protein phosphatase 22 OS=Xenopus tropicalis GN=dusp22 PE=2 SV=1 Back     alignment and function description
>sp|Q566R7|DS22B_DANRE Dual specificity protein phosphatase 22-B OS=Danio rerio GN=dusp22b PE=2 SV=2 Back     alignment and function description
>sp|Q6GQJ8|DUS22_XENLA Dual specificity protein phosphatase 22 OS=Xenopus laevis GN=dusp22 PE=2 SV=1 Back     alignment and function description
>sp|Q8R4V2|DUS15_MOUSE Dual specificity protein phosphatase 15 OS=Mus musculus GN=Dusp15 PE=2 SV=3 Back     alignment and function description
>sp|Q9H1R2|DUS15_HUMAN Dual specificity protein phosphatase 15 OS=Homo sapiens GN=DUSP15 PE=1 SV=4 Back     alignment and function description
>sp|Q1LWL2|DS22A_DANRE Dual specificity protein phosphatase 22-A OS=Danio rerio GN=dusp22a PE=2 SV=2 Back     alignment and function description
>sp|Q9ZR37|DUS1_ARATH Dual specificity protein phosphatase 1 OS=Arabidopsis thaliana GN=DSPTP1 PE=1 SV=1 Back     alignment and function description
>sp|Q9VVW5|DUSK3_DROME Dual specificity protein phosphatase Mpk3 OS=Drosophila melanogaster GN=Mkp3 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query209
270004194304 hypothetical protein TcasGA2_TC003518 [T 0.851 0.585 0.600 4e-59
189235318309 PREDICTED: similar to jnk stimulatory ph 0.851 0.576 0.600 4e-59
242012239 480 dual specificity protein phosphatase, pu 0.856 0.372 0.569 2e-57
157114790 454 jnk stimulatory phosphatase (jsp1) [Aede 0.866 0.398 0.565 3e-55
332024455 455 Dual specificity protein phosphatase 22 0.937 0.430 0.524 3e-55
195378378 465 GJ11624 [Drosophila virilis] gi|19415511 0.842 0.378 0.567 1e-54
350407186 350 PREDICTED: hypothetical protein LOC10074 0.870 0.52 0.545 8e-54
380023464 358 PREDICTED: uncharacterized protein LOC10 0.870 0.508 0.541 3e-53
383856739 349 PREDICTED: uncharacterized protein LOC10 0.870 0.521 0.545 3e-53
195018631 333 GH16683 [Drosophila grimshawi] gi|193898 0.832 0.522 0.562 6e-53
>gi|270004194|gb|EFA00642.1| hypothetical protein TcasGA2_TC003518 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  233 bits (593), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 122/203 (60%), Positives = 140/203 (68%), Gaps = 25/203 (12%)

Query: 19  VLPGLYVGNYRDSKDAVQLDRFNITHIVAIHDSARKIHPVSKTKASQPANHYQ-VDPRGG 77
           VLPGLYVGNYRDSKDA QL + NITHI+AIHDSA++IH            HY  V     
Sbjct: 3   VLPGLYVGNYRDSKDANQLAKHNITHILAIHDSAKRIHS---------DKHYLCVMASDS 53

Query: 78  PDQ---------------VYLSEQNISHFSLAGMSRSVTVTIAYIMSVTSLNWKEALKVV 122
           PDQ                 L E N+    LAGMSRSVTV +AYIMSVT+LNWKEALKVV
Sbjct: 54  PDQNLTQYFSICNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMSVTNLNWKEALKVV 113

Query: 123 RVGRAIANPNNGFQKQLQDFECFRLADERRRLRERFPSRALASMDEEQCQLLLIAYQGLL 182
           R GRA+ANPN GFQKQLQDFE  RLA ERRRL+ER+PS AL ++D EQC L+L  Y+ LL
Sbjct: 114 RAGRAVANPNLGFQKQLQDFEATRLAKERRRLKERYPSLALVNIDREQCSLMLNNYEELL 173

Query: 183 SGKHICEGNCAMGEICPTGMCRA 205
             + ICEG CA+GE CPTG+CR+
Sbjct: 174 QSRSICEGRCALGEECPTGICRS 196

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|189235318|ref|XP_975119.2| PREDICTED: similar to jnk stimulatory phosphatase (jsp1) [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242012239|ref|XP_002426841.1| dual specificity protein phosphatase, putative [Pediculus humanus corporis] gi|212511054|gb|EEB14103.1| dual specificity protein phosphatase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|157114790|ref|XP_001652423.1| jnk stimulatory phosphatase (jsp1) [Aedes aegypti] gi|108883576|gb|EAT47801.1| AAEL001110-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|332024455|gb|EGI64653.1| Dual specificity protein phosphatase 22 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|195378378|ref|XP_002047961.1| GJ11624 [Drosophila virilis] gi|194155119|gb|EDW70303.1| GJ11624 [Drosophila virilis] Back     alignment and taxonomy information
>gi|350407186|ref|XP_003488012.1| PREDICTED: hypothetical protein LOC100743546 [Bombus impatiens] Back     alignment and taxonomy information
>gi|380023464|ref|XP_003695542.1| PREDICTED: uncharacterized protein LOC100862991 [Apis florea] Back     alignment and taxonomy information
>gi|383856739|ref|XP_003703865.1| PREDICTED: uncharacterized protein LOC100880233 [Megachile rotundata] Back     alignment and taxonomy information
>gi|195018631|ref|XP_001984819.1| GH16683 [Drosophila grimshawi] gi|193898301|gb|EDV97167.1| GH16683 [Drosophila grimshawi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query209
FB|FBgn0036369 447 CG10089 [Drosophila melanogast 0.880 0.411 0.497 3.6e-41
UNIPROTKB|E1BVW4206 DUSP22 "Uncharacterized protei 0.593 0.601 0.443 5.9e-25
MGI|MGI:1915926184 Dusp22 "dual specificity phosp 0.593 0.673 0.443 7.6e-25
UNIPROTKB|F1PKB0169 DUSP22 "Uncharacterized protei 0.593 0.733 0.451 1.2e-24
UNIPROTKB|J9NSI6204 DUSP22 "Uncharacterized protei 0.593 0.607 0.436 1.2e-24
RGD|1307146184 Dusp22 "dual specificity phosp 0.593 0.673 0.443 1.6e-24
UNIPROTKB|Q9NRW4184 DUSP22 "Dual specificity prote 0.593 0.673 0.436 2e-24
UNIPROTKB|F1MPX5205 DUSP22 "Uncharacterized protei 0.593 0.604 0.428 4.2e-24
UNIPROTKB|Q5XHB2209 dusp22 "Dual specificity prote 0.588 0.588 0.424 1e-22
ZFIN|ZDB-GENE-050417-257183 dusp22b "dual specificity phos 0.593 0.677 0.443 1.5e-21
FB|FBgn0036369 CG10089 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 437 (158.9 bits), Expect = 3.6e-41, P = 3.6e-41
 Identities = 96/193 (49%), Positives = 114/193 (59%)

Query:    19 VLPGLYVGNYRDSKDAVQLDRFNITHIVAIHDSARKIHP--------VSKTKASQPANHY 70
             VLPGLYVGNYRDSKD  QL+RF I+HI+AIHDS R++ P         S T     + ++
Sbjct:     8 VLPGLYVGNYRDSKDHAQLERFKISHIIAIHDSPRRLLPDKHYLCVMASDTPDQNLSQYF 67

Query:    71 QVDPRGGPDQVYLSEQNISHFSLAGMSRSVTVTIAYIMSVTSLNWKEALKVVRVGRAIAN 130
              V          L E N+    LAGMSRSVTV +AYIM+ T LNWKEALKVVR GRA+AN
Sbjct:    68 SVC-NDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVAN 126

Query:   131 PNNGFQKQLQDFECXXXXXXXXXXXXXXXXXXLASMDEEQCQLLLIAYQGLLSGKHICEG 190
             PN GFQ QLQ+FE                   L  +D  +    L  YQ LL  + ICEG
Sbjct:   127 PNAGFQSQLQEFEQFKLSEERRRLRERFPSSALEQLDRTKVATALDNYQELLQNRDICEG 186

Query:   191 NCAMGEICPTGMC 203
             NC+ GE CPTG+C
Sbjct:   187 NCSRGEKCPTGVC 199
GO:0006470 "protein dephosphorylation" evidence=IBA;NAS
GO:0008138 "protein tyrosine/serine/threonine phosphatase activity" evidence=IBA;NAS
GO:0005575 "cellular_component" evidence=ND
UNIPROTKB|E1BVW4 DUSP22 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1915926 Dusp22 "dual specificity phosphatase 22" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1PKB0 DUSP22 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NSI6 DUSP22 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1307146 Dusp22 "dual specificity phosphatase 22" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NRW4 DUSP22 "Dual specificity protein phosphatase 22" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MPX5 DUSP22 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q5XHB2 dusp22 "Dual specificity protein phosphatase 22" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050417-257 dusp22b "dual specificity phosphatase 22b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q566R7DS22B_DANRE3, ., 1, ., 3, ., 4, 80.40600.73680.8415yesN/A
Q5XHB2DUS22_XENTR3, ., 1, ., 3, ., 4, 80.38410.73680.7368yesN/A
Q99N11DUS22_MOUSE3, ., 1, ., 3, ., 4, 80.41130.71290.8097yesN/A
Q9NRW4DUS22_HUMAN3, ., 1, ., 3, ., 4, 80.39870.71290.8097yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3.160.824
3rd Layer3.1.30.766
3rd Layer3.1.3.480.824

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
cd00127139 cd00127, DSPc, Dual specificity phosphatases (DSP) 2e-26
smart00195138 smart00195, DSPc, Dual specificity phosphatase, ca 3e-21
pfam00782131 pfam00782, DSPc, Dual specificity phosphatase, cat 1e-12
>gnl|CDD|238073 cd00127, DSPc, Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information 
 Score = 98.4 bits (246), Expect = 2e-26
 Identities = 42/154 (27%), Positives = 65/154 (42%), Gaps = 46/154 (29%)

Query: 18  IVLPGLYVGNYRDSKDAVQLDRFNITHIVAIHDSARKIHPVSKTKASQPANHYQVDPRGG 77
            + PGLY+G+Y  + D   L +  ITH++ +                        +    
Sbjct: 4   EITPGLYLGSYPAASDKELLKKLGITHVLNVAKEVPN------------------ENLFL 45

Query: 78  PDQVYLS-------EQNIS-HFS--------------------LAGMSRSVTVTIAYIMS 109
            D  YL         Q+IS +F                     LAG+SRS T+ IAY+M 
Sbjct: 46  SDFNYLYVPILDLPSQDISKYFDEAVDFIDDAREKGGKVLVHCLAGVSRSATLVIAYLMK 105

Query: 110 VTSLNWKEALKVVRVGRAIANPNNGFQKQLQDFE 143
              L+ +EA + V+  R I +PN GF +QL+++E
Sbjct: 106 TLGLSLREAYEFVKSRRPIISPNAGFMRQLKEYE 139

Structurally similar to tyrosine-specific phosphatases but with a shallower active site cleft and a distinctive active site signature motif, HCxxGxxR. Characterized as VHR- or Cdc25-like. Length = 139
>gnl|CDD|214551 smart00195, DSPc, Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|216117 pfam00782, DSPc, Dual specificity phosphatase, catalytic domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 209
KOG1718|consensus198 100.0
smart00195138 DSPc Dual specificity phosphatase, catalytic domai 99.98
KOG1716|consensus285 99.96
KOG1717|consensus343 99.96
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr 99.96
PF00782133 DSPc: Dual specificity phosphatase, catalytic doma 99.96
PRK12361 547 hypothetical protein; Provisional 99.91
KOG1719|consensus183 99.86
PTZ00242166 protein tyrosine phosphatase; Provisional 99.85
PTZ00393241 protein tyrosine phosphatase; Provisional 99.8
KOG1720|consensus225 99.65
COG2453180 CDC14 Predicted protein-tyrosine phosphatase [Sign 99.53
KOG2836|consensus173 99.43
PF03162164 Y_phosphatase2: Tyrosine phosphatase family; Inter 99.39
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 99.37
PF05706168 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) 99.3
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 98.97
smart00012105 PTPc_DSPc Protein tyrosine phosphatase, catalytic 98.96
smart00404105 PTPc_motif Protein tyrosine phosphatase, catalytic 98.96
COG5350172 Predicted protein tyrosine phosphatase [General fu 98.84
PLN02727 986 NAD kinase 98.75
cd00047231 PTPc Protein tyrosine phosphatases (PTP) catalyze 98.72
smart00194258 PTPc Protein tyrosine phosphatase, catalytic domai 98.63
PF13350164 Y_phosphatase3: Tyrosine phosphatase family; PDB: 98.58
COG3453130 Uncharacterized protein conserved in bacteria [Fun 98.56
PRK15375535 pathogenicity island 1 effector protein StpP; Prov 98.41
PF00102235 Y_phosphatase: Protein-tyrosine phosphatase; Inter 98.24
KOG1572|consensus249 98.22
KOG2283|consensus 434 98.21
PHA02742303 protein tyrosine phosphatase; Provisional 98.15
PHA02747312 protein tyrosine phosphatase; Provisional 98.15
PHA02746323 protein tyrosine phosphatase; Provisional 98.13
COG2365249 Protein tyrosine/serine phosphatase [Signal transd 98.07
PHA02740298 protein tyrosine phosphatase; Provisional 98.06
PHA02738320 hypothetical protein; Provisional 97.92
KOG0790|consensus600 97.84
KOG0792|consensus1144 97.68
KOG2386|consensus 393 97.49
COG5599302 PTP2 Protein tyrosine phosphatase [Signal transduc 97.38
PF04179451 Init_tRNA_PT: Initiator tRNA phosphoribosyl transf 97.33
PF14566149 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 97.28
KOG0789|consensus415 97.24
KOG0791|consensus374 96.86
KOG0793|consensus1004 95.77
KOG4228|consensus1087 94.72
KOG4228|consensus 1087 94.44
PF14671141 DSPn: Dual specificity protein phosphatase, N-term 93.71
KOG4471|consensus 717 89.12
PRK01415247 hypothetical protein; Validated 87.75
COG0607110 PspE Rhodanese-related sulfurtransferase [Inorgani 84.01
>KOG1718|consensus Back     alignment and domain information 
Probab=100.00  E-value=8.3e-34  Score=219.12  Aligned_cols=129  Identities=26%  Similarity=0.388  Sum_probs=115.5

Q ss_pred             CCCccceeCCeEEcCccCcCCHHHHHhCCCceEEEcccCCCccCCCCcccCCCCCceEE-EcCCCCCcccc---------
Q psy1264          13 KDVKRIVLPGLYVGNYRDSKDAVQLDRFNITHIVAIHDSARKIHPVSKTKASQPANHYQ-VDPRGGPDQVY---------   82 (209)
Q Consensus        13 ~~~~~~I~p~LylG~~~~a~~~~~L~~~gIt~Vinl~~~~~~~~~~~~~~~~~~~~~y~-I~~~D~~~~~~---------   82 (209)
                      ..++++|+|+||+++-..+.+...|+++|||+|||.+.+.+....        +.+.|. ||+.|.|...+         
T Consensus        14 ~~~~SqIt~sLfl~~GvaA~~k~~l~~~~It~IiNat~E~pn~~l--------~~~qy~kv~~~D~p~~~l~~hfD~vAD   85 (198)
T KOG1718|consen   14 IGGMSQITPSLFLSNGVAANDKLLLKKRKITCIINATTEVPNTSL--------PDIQYMKVPLEDTPQARLYDHFDPVAD   85 (198)
T ss_pred             ccchhhcCcceeEeccccccCHHHHHhcCceEEEEcccCCCCccC--------CCceeEEEEcccCCcchhhhhhhHHHH
Confidence            478999999999998788889999999999999999887653222        227788 99999998773         


Q ss_pred             ------cCCCcEEEEcCCCCchhHHHHHHHHHHhCCCCHHHHHHHHHhhCCCccCCHHHHHHHHHHHHHHHHH
Q psy1264          83 ------LSEQNISHFSLAGMSRSVTVTIAYIMSVTSLNWKEALKVVRVGRAIANPNNGFQKQLQDFECFRLAD  149 (209)
Q Consensus        83 ------~~~~~VLVHC~~G~sRS~tvv~AYLm~~~~~~~~~A~~~vr~~Rp~i~pn~~f~~qL~~~e~~~l~~  149 (209)
                            ..||++||||.+|+|||+++++||||++.+|++.||+.++|++||.+.||.|||+||..||+.+.++
T Consensus        86 ~I~~v~~~gG~TLvHC~AGVSRSAsLClAYLmK~~~msLreAy~~vKa~RpiIRPN~GFw~QLi~YE~qL~g~  158 (198)
T KOG1718|consen   86 KIHSVIMRGGKTLVHCVAGVSRSASLCLAYLMKYHCMSLREAYHWVKARRPIIRPNVGFWRQLIDYEQQLFGN  158 (198)
T ss_pred             HHHHHHhcCCcEEEEEccccchhHHHHHHHHHHHccchHHHHHHHHHhhCceeCCCccHHHHHHHHHHHhcCC
Confidence                  6799999999999999999999999999999999999999999999999999999999999976553

>smart00195 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>KOG1716|consensus Back     alignment and domain information
>KOG1717|consensus Back     alignment and domain information
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PRK12361 hypothetical protein; Provisional Back     alignment and domain information
>KOG1719|consensus Back     alignment and domain information
>PTZ00242 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PTZ00393 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>KOG1720|consensus Back     alignment and domain information
>COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2836|consensus Back     alignment and domain information
>PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>COG5350 Predicted protein tyrosine phosphatase [General function prediction only] Back     alignment and domain information
>PLN02727 NAD kinase Back     alignment and domain information
>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>smart00194 PTPc Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B Back     alignment and domain information
>COG3453 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK15375 pathogenicity island 1 effector protein StpP; Provisional Back     alignment and domain information
>PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>KOG1572|consensus Back     alignment and domain information
>KOG2283|consensus Back     alignment and domain information
>PHA02742 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02747 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02746 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02740 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02738 hypothetical protein; Provisional Back     alignment and domain information
>KOG0790|consensus Back     alignment and domain information
>KOG0792|consensus Back     alignment and domain information
>KOG2386|consensus Back     alignment and domain information
>COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PF04179 Init_tRNA_PT: Initiator tRNA phosphoribosyl transferase ; InterPro: IPR007306 This enzyme (2 Back     alignment and domain information
>PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B Back     alignment and domain information
>KOG0789|consensus Back     alignment and domain information
>KOG0791|consensus Back     alignment and domain information
>KOG0793|consensus Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>PF14671 DSPn: Dual specificity protein phosphatase, N-terminal half; PDB: 1OHD_A 1OHE_A 1OHC_A Back     alignment and domain information
>KOG4471|consensus Back     alignment and domain information
>PRK01415 hypothetical protein; Validated Back     alignment and domain information
>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
1wrm_A165 Crystal Structure Of Jsp-1 Length = 165 1e-26
1yz4_A160 Crystal Structure Of Dusp15 Length = 160 3e-21
1mkp_A144 Crystal Structure Of Pyst1 (Mkp3) Length = 144 1e-09
2hxp_A155 Crystal Structure Of The Human Phosphatase (Dusp9) 1e-09
3lj8_A146 Crystal Structure Of Mkp-4 Length = 146 5e-09
1zzw_A149 Crystal Structure Of Catalytic Domain Of Human Map 5e-08
2oud_A177 Crystal Structure Of The Catalytic Domain Of Human 7e-08
2r0b_A154 Crystal Structure Of Human Tyrosine Phosphatase-lik 3e-07
2g6z_A211 Crystal Structure Of Human Dusp5 Length = 211 7e-07
1m3g_A145 Solution Structure Of The Catalytic Domain Of Mapk 1e-06
1j4x_A184 Human Vh1-Related Dual-Specificity Phosphatase C124 3e-06
4hrf_A160 Atomic Structure Of Dusp26 Length = 160 5e-06
1vhr_A184 Human Vh1-Related Dual-Specificity Phosphatase Leng 5e-06
3f81_A183 Interaction Of Vhr With Sa3 Length = 183 6e-06
2e0t_A151 Crystal Structure Of Catalytic Domain Of Dual Speci 2e-05
3ezz_A144 Crystal Structure Of Human Mkp-2 Length = 144 2e-05
2gwo_A198 Crystal Structure Of Tmdp Length = 198 3e-05
2wgp_A190 Crystal Structure Of Human Dual Specificity Phospha 3e-05
2pq5_A205 Crystal Structure Of Dual Specificity Protein Phosp 3e-05
2hcm_A164 Crystal Structure Of Mouse Putative Dual Specificit 3e-04
>pdb|1WRM|A Chain A, Crystal Structure Of Jsp-1 Length = 165 Back     alignment and structure 
Iteration: 1

 Score =  116 bits (290), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 58/133 (43%), Positives = 86/133 (64%), Gaps = 9/133 (6%)
Query: 19  VLPGLYVGNYRDSKDAVQLDRFNITHIVAIHDSARKIH--------PVSKTKASQPANHY 70
           +LPGLY+GN++D++DA QL +  +THI+++HDSAR +         P + + +     H+
Sbjct: 10  ILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHF 69
Query: 71  QVDPRGGPDQVYLSEQNISHFSLAGMSRSVTVTIAYIMSVTSLNWKEALKVVRVGRAIAN 130
           +   +   +     E  + H  LAG+SRSVT+ IAYIM+VT   W++AL  VR GR+ AN
Sbjct: 70  KESIKFIHECRLRGESCLVH-CLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCAN 128
Query: 131 PNNGFQKQLQDFE 143
           PN GFQ+QLQ+FE
Sbjct: 129 PNVGFQRQLQEFE 141
>pdb|1YZ4|A Chain A, Crystal Structure Of Dusp15 Length = 160 Back     alignment and structure
>pdb|1MKP|A Chain A, Crystal Structure Of Pyst1 (Mkp3) Length = 144 Back     alignment and structure
>pdb|2HXP|A Chain A, Crystal Structure Of The Human Phosphatase (Dusp9) Length = 155 Back     alignment and structure
>pdb|3LJ8|A Chain A, Crystal Structure Of Mkp-4 Length = 146 Back     alignment and structure
>pdb|1ZZW|A Chain A, Crystal Structure Of Catalytic Domain Of Human Map Kinase Phosphatase 5 Length = 149 Back     alignment and structure
>pdb|2OUD|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mkp5 Length = 177 Back     alignment and structure
>pdb|2R0B|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase-like Serine/threonine/tyrosine-interacting Protein Length = 154 Back     alignment and structure
>pdb|2G6Z|A Chain A, Crystal Structure Of Human Dusp5 Length = 211 Back     alignment and structure
>pdb|1M3G|A Chain A, Solution Structure Of The Catalytic Domain Of Mapk Phosphatase Pac-1: Insights Into Substrate-Induced Enzymatic Activation Length = 145 Back     alignment and structure
>pdb|1J4X|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase C124s Mutant- Peptide Complex Length = 184 Back     alignment and structure
>pdb|4HRF|A Chain A, Atomic Structure Of Dusp26 Length = 160 Back     alignment and structure
>pdb|1VHR|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase Length = 184 Back     alignment and structure
>pdb|3F81|A Chain A, Interaction Of Vhr With Sa3 Length = 183 Back     alignment and structure
>pdb|2E0T|A Chain A, Crystal Structure Of Catalytic Domain Of Dual Specificity Phosphatase 26, Ms0830 From Homo Sapiens Length = 151 Back     alignment and structure
>pdb|3EZZ|A Chain A, Crystal Structure Of Human Mkp-2 Length = 144 Back     alignment and structure
>pdb|2GWO|A Chain A, Crystal Structure Of Tmdp Length = 198 Back     alignment and structure
>pdb|2WGP|A Chain A, Crystal Structure Of Human Dual Specificity Phosphatase 14 Length = 190 Back     alignment and structure
>pdb|2PQ5|A Chain A, Crystal Structure Of Dual Specificity Protein Phosphatase 13 (Dusp13) Length = 205 Back     alignment and structure
>pdb|2HCM|A Chain A, Crystal Structure Of Mouse Putative Dual Specificity Phosphatase Complexed With Zinc Tungstate, New York Structural Genomics Consortium Length = 164 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 4e-37
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 2e-35
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 4e-32
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 6e-32
2hxp_A155 Dual specificity protein phosphatase 9; human phos 1e-30
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 1e-30
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 2e-30
2oud_A177 Dual specificity protein phosphatase 10; A central 5e-30
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 6e-30
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 1e-29
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 2e-29
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 2e-29
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 3e-29
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 3e-29
2hcm_A164 Dual specificity protein phosphatase; structural g 7e-29
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 3e-28
3emu_A161 Leucine rich repeat and phosphatase domain contain 6e-28
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 1e-27
2q05_A195 Late protein H1, dual specificity protein phosphat 8e-23
3cm3_A176 Late protein H1, dual specificity protein phosphat 3e-22
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 2e-20
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 3e-19
3nme_A294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 4e-08
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 2e-05
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Length = 165 Back     alignment and structure
 Score =  126 bits (318), Expect = 4e-37
 Identities = 64/170 (37%), Positives = 91/170 (53%), Gaps = 35/170 (20%)

Query: 19  VLPGLYVGNYRDSKDAVQLDRFNITHIVAIHDSARKIHPVSKTKASQPANHYQVDPRGGP 78
           +LPGLY+GN++D++DA QL +  +THI+++HDSAR +    K                  
Sbjct: 10  ILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYL------CIPAA----- 58

Query: 79  DQVYLSEQNIS-HF--------------------SLAGMSRSVTVTIAYIMSVTSLNWKE 117
           D      QN++ HF                     LAG+SRSVT+ IAYIM+VT   W++
Sbjct: 59  D---SPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWED 115

Query: 118 ALKVVRVGRAIANPNNGFQKQLQDFECFRLADERRRLRERFPSRALASMD 167
           AL  VR GR+ ANPN GFQ+QLQ+FE   +   R+ L+E +    L   +
Sbjct: 116 ALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAE 165
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Length = 160 Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Length = 205 Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Length = 188 Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Length = 155 Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Length = 219 Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Length = 144 Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Length = 177 Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Length = 149 Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} PDB: 1vhr_A* 1j4x_A* Length = 183 Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Length = 154 Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Length = 145 Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Length = 211 Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Length = 151 Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Length = 164 Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} PDB: 1m3g_A Length = 144 Back     alignment and structure
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Length = 161 Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Length = 190 Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Length = 195 Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Length = 176 Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Length = 157 Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Length = 294 Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query209
3emu_A161 Leucine rich repeat and phosphatase domain contain 100.0
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 100.0
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 100.0
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 100.0
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 100.0
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 100.0
2hxp_A155 Dual specificity protein phosphatase 9; human phos 99.97
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 99.97
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 99.97
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 99.97
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 99.97
2oud_A177 Dual specificity protein phosphatase 10; A central 99.97
2hcm_A164 Dual specificity protein phosphatase; structural g 99.97
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 99.97
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 99.97
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 99.97
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 99.97
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 99.97
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 99.97
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 99.96
3cm3_A176 Late protein H1, dual specificity protein phosphat 99.96
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 99.94
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 99.93
2q05_A195 Late protein H1, dual specificity protein phosphat 99.93
3nme_A294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 99.92
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 99.91
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 99.87
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 99.85
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 99.81
1xri_A151 AT1G05000; structural genomics, protein structure 99.8
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 99.79
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 99.79
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 99.78
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 99.77
2f46_A156 Hypothetical protein; structural genomics, joint c 99.63
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 99.61
1d5r_A324 Phosphoinositide phosphotase PTEN; C2 domain, phos 99.6
3v0d_A339 Voltage-sensor containing phosphatase; PTP, hydrol 99.37
3n0a_A 361 Tyrosine-protein phosphatase auxilin; phosphatase- 99.36
1ywf_A296 Phosphotyrosine protein phosphatase PTPB; four str 98.8
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 98.79
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 98.79
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 98.76
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 98.74
4grz_A288 Tyrosine-protein phosphatase non-receptor type 6; 98.73
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 98.71
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 98.69
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 98.69
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 98.67
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 98.66
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 98.64
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 98.63
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 98.61
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 98.6
4az1_A302 Tyrosine specific protein phosphatase; hydrolase, 98.58
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 98.58
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 98.57
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 98.57
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 98.57
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 98.55
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 98.54
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 98.54
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 98.54
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 98.5
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 98.49
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 98.44
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 98.43
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 98.41
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 98.39
4i8n_A354 Tyrosine-protein phosphatase non-receptor type 1; 98.35
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 98.31
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 98.27
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 98.26
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 98.25
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 98.24
4ge6_A314 Tyrosine-protein phosphatase non-receptor type 9; 98.24
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphata 98.23
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 98.23
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 98.22
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 98.22
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 98.21
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 98.12
3f41_A 629 Phytase; tandem repeat, protein tyrosine phosphata 98.1
1ohe_A 348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 96.82
1eyo_A30 Conotoxin TVIIA; cystine knot motif; HET: HYP; NMR 86.77
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Back     alignment and structure
Probab=100.00  E-value=6.3e-35  Score=228.39  Aligned_cols=129  Identities=15%  Similarity=0.172  Sum_probs=111.1

Q ss_pred             CCCccceeCCeEEcCccCcCCHHHHHhCCCceEEEcccCCCccCCCCcccCCCCCceEE-EcCCCCCcccc---------
Q psy1264          13 KDVKRIVLPGLYVGNYRDSKDAVQLDRFNITHIVAIHDSARKIHPVSKTKASQPANHYQ-VDPRGGPDQVY---------   82 (209)
Q Consensus        13 ~~~~~~I~p~LylG~~~~a~~~~~L~~~gIt~Vinl~~~~~~~~~~~~~~~~~~~~~y~-I~~~D~~~~~~---------   82 (209)
                      ...+++|.|+||+|+.+.+.+.+.|+++||++|||++.+.+..++.        .+.|+ ||+.|.+..++         
T Consensus         7 ~~~~~~I~~~LylG~~~~a~~~~~L~~~gIt~Vlnl~~~~~~~~~~--------~~~~~~ipi~D~~~~~l~~~~~~~~~   78 (161)
T 3emu_A            7 TLSPTQIIQYIHLGSFLNAHNVDYIHNNNISSILLVGIEVPSLFKD--------QCDILRLDIVSEEGHQLYDSIPNAIK   78 (161)
T ss_dssp             GGSCEEEETTEEEEETTGGGCHHHHHHTTEEEEEEEC-------CT--------TSEEEEECCCCSSTTHHHHHHHHHHH
T ss_pred             CCCceEEECCEEECChHHhhCHHHHHHCCCCEEEEeCCCCccccCC--------CCEEEEEeCcCCCCCcHHHHHHHHHH
Confidence            3568999999999999999999999999999999999865443332        37788 99999987662         


Q ss_pred             ------cCCCcEEEEcCCCCchhHHHHHHHHHHhCCCCHHHHHHHHHhhCCCccCCHHHHHHHHHHHHHHHHH
Q psy1264          83 ------LSEQNISHFSLAGMSRSVTVTIAYIMSVTSLNWKEALKVVRVGRAIANPNNGFQKQLQDFECFRLAD  149 (209)
Q Consensus        83 ------~~~~~VLVHC~~G~sRS~tvv~AYLm~~~~~~~~~A~~~vr~~Rp~i~pn~~f~~qL~~~e~~~l~~  149 (209)
                            ..+++|||||.+|+|||+++++||||...||++++|+++|+++||.+.||.+|++||++||+.+.++
T Consensus        79 fI~~~~~~~~~VlVHC~~G~sRS~~vv~ayLm~~~~~s~~~A~~~v~~~Rp~i~pn~~f~~qL~~~e~~L~~~  151 (161)
T 3emu_A           79 FIIRSIQRKEGVLIISGTGVNKAPAIVIAFLMYYQRLSFINAFNKVQGLYPLIDIESGFILQLKLFEKKLEKM  151 (161)
T ss_dssp             HHHHHHHTTCEEEEEESSSSSHHHHHHHHHHHHHTTCCHHHHHHHHHHHCTTCCCCHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHhcCCeEEEEcCCCCcHHHHHHHHHHHHHhCCCHHHHHHHHHHHCCCcCCCHHHHHHHHHHHHHHhcC
Confidence                  4678999999999999999999999999999999999999999999999999999999999966553
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Back     alignment and structure
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Back     alignment and structure
>3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Back     alignment and structure
>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Back     alignment and structure
>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Back     alignment and structure
>4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>1eyo_A Conotoxin TVIIA; cystine knot motif; HET: HYP; NMR {Synthetic} SCOP: g.3.6.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 209
d1vhra_178 c.45.1.1 (A:) VH1-related dual-specificity phospha 5e-23
d1m3ga_145 c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien 2e-22
d1mkpa_144 c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien 2e-20
d1i9sa_194 c.45.1.1 (A:) mRNA capping enzyme, triphosphatase 1e-07
d1ohea2182 c.45.1.1 (A:199-380) Proline directed phosphatase 9e-06
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Dual specificity phosphatase-like
domain: VH1-related dual-specificity phosphatase, VHR
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 89.1 bits (220), Expect = 5e-23
 Identities = 38/152 (25%), Positives = 62/152 (40%), Gaps = 20/152 (13%)

Query: 19  VLPGLYVGNYRDSKDAVQLDRFNITHIVAIHDSARKIHPVSKTKASQPAN--HYQVDPRG 76
           V P +YVGN   ++D  +L +  ITH++   +    +H  +     + +   +  +    
Sbjct: 26  VTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKAND 85

Query: 77  GPDQVYLSEQNISH----------------FSLAGMSRSVTVTIAYIMSVTSLNWKEALK 120
             +    +    +                     G SRS T+ IAY+M    ++ K AL 
Sbjct: 86  TQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALS 145

Query: 121 VVRVGRAIANPNNGFQKQLQDFECFRLADERR 152
           +VR  R I  PN+GF  QL      RLA E +
Sbjct: 146 IVRQNREIG-PNDGFLAQLCQLND-RLAKEGK 175
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Length = 145 Back     information, alignment and structure
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Length = 144 Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query209
d1m3ga_145 Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax 100.0
d1mkpa_144 Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp 100.0
d1vhra_178 VH1-related dual-specificity phosphatase, VHR {Hum 100.0
d1ohea2182 Proline directed phosphatase CDC14b2 {Human (Homo 99.87
d1fpza_176 Kinase associated phosphatase (kap) {Human (Homo s 99.82
d1i9sa_194 mRNA capping enzyme, triphosphatase domain {Mouse 99.81
d1rxda_152 Protein tyrosine phosphatase type IVa {Human (Homo 99.77
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 99.66
d1d5ra2174 Phoshphoinositide phosphatase Pten (Pten tumor sup 99.62
d1ywfa1272 Phosphotyrosine protein phosphatase PtpB {Mycobact 98.49
d1fpra_284 Tyrosine phosphatase {Human (Homo sapiens), shp-1 98.47
d1g4us2243 SptP tyrosine phosphatase, catalytic domain {Salmo 98.44
d2pt0a1313 Myo-inositol hexaphosphate phosphohydrolase (phyta 98.42
d1wcha_308 Tyrosine-protein phosphatase, non-receptor type 13 98.35
d1l8ka_273 Tyrosine phosphatase {Human (Homo sapiens), T-cell 98.31
d1jlna_297 Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl 98.3
d2f71a1297 Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta 98.24
d1lara1317 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 98.22
d1p15a_245 Protein-tyrosine phosphatase alpha {Mouse (Mus mus 98.21
d1yfoa_288 Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 98.2
d1lyva_283 Protein-tyrosine phosphatase YopH, catalytic domai 98.2
d2shpa1307 Tyrosine phosphatase {Human (Homo sapiens), shp-2 98.18
d1rpma_278 Tyrosine phosphatase {Human (Homo sapiens), mu [Ta 98.12
d1lara2249 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 98.07
d1ohea1157 Proline directed phosphatase CDC14b2 {Human (Homo 94.36
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Dual specificity phosphatase-like
domain: Mapk phosphatase
species: Human (Homo sapiens), pac-1 [TaxId: 9606]

Probab=100.00  E-value=6.5e-37  Score=234.03  Aligned_cols=126  Identities=27%  Similarity=0.346  Sum_probs=113.8

Q ss_pred             CCccceeCCeEEcCccCcCCHHHHHhCCCceEEEcccCCCccCCCCcccCCCCCceEE-EcCCCCCcccc----------
Q psy1264          14 DVKRIVLPGLYVGNYRDSKDAVQLDRFNITHIVAIHDSARKIHPVSKTKASQPANHYQ-VDPRGGPDQVY----------   82 (209)
Q Consensus        14 ~~~~~I~p~LylG~~~~a~~~~~L~~~gIt~Vinl~~~~~~~~~~~~~~~~~~~~~y~-I~~~D~~~~~~----------   82 (209)
                      .+|+||+|+||+|+..++.|.+.|+++||++|||++.+.+...+.        ...|. +|+.|.+..++          
T Consensus         2 ~gp~eI~p~LylG~~~~a~~~~~L~~~gI~~Iin~~~~~~~~~~~--------~~~y~~i~i~D~~~~~i~~~~~~~~~~   73 (145)
T d1m3ga_           2 GGPVEILPYLFLGSCSHSSDLQGLQACGITAVLNVSASCPNHFEG--------LFRYKSIPVEDNQMVEISAWFQEAIGF   73 (145)
T ss_dssp             CCCEEETTTEEECCSTHHHHHHHHHHHTCSEEEECSSSSSEEECS--------SSEEEECCCCCSTTCCCTTSHHHHHHH
T ss_pred             CCCeEEECCEEEcChhhhcCHHHHHHcCCcEEEEecCCCCcCCCC--------ceEEEEEeccCCchhhHHHHHHHHHHH
Confidence            588999999999999999999999999999999998776544333        26777 99999887663          


Q ss_pred             -----cCCCcEEEEcCCCCchhHHHHHHHHHHhCCCCHHHHHHHHHhhCCCccCCHHHHHHHHHHHHHHH
Q psy1264          83 -----LSEQNISHFSLAGMSRSVTVTIAYIMSVTSLNWKEALKVVRVGRAIANPNNGFQKQLQDFECFRL  147 (209)
Q Consensus        83 -----~~~~~VLVHC~~G~sRS~tvv~AYLm~~~~~~~~~A~~~vr~~Rp~i~pn~~f~~qL~~~e~~~l  147 (209)
                           .++++|||||.+|+|||+++++||||.+.+|++++|+++|+++||.+.||.+|++||.+||+.++
T Consensus        74 i~~~~~~~~~VlVHC~~G~sRS~~v~~aYLm~~~~~~~~~A~~~v~~~Rp~v~pn~~f~~qL~~~e~~l~  143 (145)
T d1m3ga_          74 IDWVKNSGGRVLVHSQAGISRSATICLAYLMQSRRVRLDEAFDFVKQRRGVISPNFSFMGQLLQFETQVL  143 (145)
T ss_dssp             HHHHHHTTCCEEECCSSSSSHHHHHHHHHHHHTTCCHHHHHHHHHSCSCCCCSSCSSCCCCSHHHHHHHT
T ss_pred             HHHhhccCceEEEEcccccccHHHHHHHHHHHHhCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHhc
Confidence                 47889999999999999999999999999999999999999999999999999999999999765
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Back     information, alignment and structure
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure