Psyllid ID: psy12654

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130---
PLLFQLNDFAPEPIQIVGDDLTVTNPKRIATAVEKKACNCLLLKVNQIGSVTESIQAHLLAKQNGWGTMVSHRSGETEDNFIADLVVGLSTGQIKTGAPCRSERLAKYNQILRIEEELGANAKFAGKNFRRPV
ccccccccccccccEEEccccccccHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccc
ccHHHHHHHcccccEEEEcccccccHHHHHHHHHHccccEEEEcHHHcccHHHHHHHHHHHHHcccEEEEEcccEcccccHHHHHHHHHcccEEEccccccHHHHHHHHHHHHHHHHHHHHEEEcHHHHcccc
pllfqlndfapepiqivgddltvtnpKRIATAVEKKACNCLLLKVNQIGSVTESIQAHLLAKQngwgtmvshrsgetednFIADLVVGlstgqiktgapcrsERLAKYNQILRIEEELGanakfagknfrrpv
PLLFQlndfapepiqivgddltvTNPKRIATAVEKKACNCLLLKVNQIGSVTESIQAHLLAKQNGWGTMVSHRSGETEDNFIADLVVGLSTgqiktgapcrsERLAKYNQILRIEeelganakfagknfrrpv
PLLFQLNDFAPEPIQIVGDDLTVTNPKRIATAVEKKACNCLLLKVNQIGSVTESIQAHLLAKQNGWGTMVSHRSGETEDNFIADLVVGLSTGQIKTGAPCRSERLAKYNQILRIEEELGANAKFAGKNFRRPV
***FQLNDFAPEPIQIVGDDLTVTNPKRIATAVEKKACNCLLLKVNQIGSVTESIQAHLLAKQNGWGTMVSHRSGETEDNFIADLVVGLSTGQIKTGAPCRSERLAKYNQILRIEEELG**************
PLLFQLNDFAPEPIQIVGDDLTVTNPKRIATAVEKKACNCLLLKVNQIGSVTESIQAHLLAKQNGWGTMVSHRSGETEDNFIADLVVGLSTGQIKTGAPCRSERLAKYNQILRIEEELGANAKFAGKNFRR**
PLLFQLNDFAPEPIQIVGDDLTVTNPKRIATAVEKKACNCLLLKVNQIGSVTESIQAHLLAKQNGWGTMVSHRSGETEDNFIADLVVGLSTGQIKTGAPCRSERLAKYNQILRIEEELGANAKFAGKNFRRPV
PLLFQLNDFAPEPIQIVGDDLTVTNPKRIATAVEKKACNCLLLKVNQIGSVTESIQAHLLAKQNGWGTMVSHRSGETEDNFIADLVVGLSTGQIKTGAPCRSERLAKYNQILRIEEELGANAKFAGKNFR***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PLLFQLNDFAPEPIQIVGDDLTVTNPKRIATAVEKKACNCLLLKVNQIGSVTESIQAHLLAKQNGWGTMVSHRSGETEDNFIADLVVGLSTGQIKTGAPCRSERLAKYNQILRIEEELGANAKFAGKNFRRPV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query133 2.2.26 [Sep-21-2011]
P15007500 Enolase OS=Drosophila mel no N/A 0.894 0.238 0.915 2e-60
P56252433 Enolase OS=Homarus gammar N/A N/A 0.894 0.274 0.924 1e-59
P08734434 Alpha-enolase OS=Xenopus N/A N/A 0.932 0.285 0.830 3e-56
Q9PVK2434 Alpha-enolase OS=Alligato N/A N/A 0.894 0.274 0.857 7e-56
P19140434 Alpha-enolase OS=Anas pla N/A N/A 0.894 0.274 0.857 8e-56
P51913434 Alpha-enolase OS=Gallus g yes N/A 0.894 0.274 0.848 1e-55
P06733434 Alpha-enolase OS=Homo sap yes N/A 0.932 0.285 0.822 3e-55
Q9W7L0434 Alpha-enolase OS=Python r N/A N/A 0.924 0.283 0.821 3e-55
Q27527434 Enolase OS=Caenorhabditis yes N/A 0.894 0.274 0.831 3e-55
P42894436 Enolase OS=Neocallimastix N/A N/A 0.909 0.277 0.834 6e-55
>sp|P15007|ENO_DROME Enolase OS=Drosophila melanogaster GN=Eno PE=1 SV=2 Back     alignment and function desciption
 Score =  230 bits (586), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 109/119 (91%), Positives = 115/119 (96%)

Query: 14  IQIVGDDLTVTNPKRIATAVEKKACNCLLLKVNQIGSVTESIQAHLLAKQNGWGTMVSHR 73
           IQIVGDDLTVTNPKRIATAVEKKACNCLLLKVNQIG+VTESI AHLLAK+NGWGTMVSHR
Sbjct: 381 IQIVGDDLTVTNPKRIATAVEKKACNCLLLKVNQIGTVTESIAAHLLAKKNGWGTMVSHR 440

Query: 74  SGETEDNFIADLVVGLSTGQIKTGAPCRSERLAKYNQILRIEEELGANAKFAGKNFRRP 132
           SGETED+FI DLVVGLSTGQIKTGAPCRSERLAKYNQILRIEEE+GA  KFAGK+FR+P
Sbjct: 441 SGETEDSFIGDLVVGLSTGQIKTGAPCRSERLAKYNQILRIEEEIGAGVKFAGKSFRKP 499

Drosophila melanogaster (taxid: 7227)
EC: 4EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 1
>sp|P56252|ENO_HOMGA Enolase OS=Homarus gammarus PE=1 SV=1 Back     alignment and function description
>sp|P08734|ENOA_XENLA Alpha-enolase OS=Xenopus laevis GN=eno1 PE=2 SV=2 Back     alignment and function description
>sp|Q9PVK2|ENOA_ALLMI Alpha-enolase OS=Alligator mississippiensis PE=2 SV=3 Back     alignment and function description
>sp|P19140|ENOA_ANAPL Alpha-enolase OS=Anas platyrhynchos GN=ENO1 PE=2 SV=2 Back     alignment and function description
>sp|P51913|ENOA_CHICK Alpha-enolase OS=Gallus gallus GN=ENO1 PE=2 SV=2 Back     alignment and function description
>sp|P06733|ENOA_HUMAN Alpha-enolase OS=Homo sapiens GN=ENO1 PE=1 SV=2 Back     alignment and function description
>sp|Q9W7L0|ENOA_PYTRG Alpha-enolase OS=Python regius PE=2 SV=3 Back     alignment and function description
>sp|Q27527|ENO_CAEEL Enolase OS=Caenorhabditis elegans GN=enol-1 PE=1 SV=3 Back     alignment and function description
>sp|P42894|ENO_NEOFR Enolase OS=Neocallimastix frontalis PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query133
308743359 433 enolase [Antheraea pernyi] 0.909 0.279 0.958 3e-62
357616014 403 enolase [Danaus plexippus] 0.909 0.300 0.958 3e-62
389608773 433 enolase [Papilio xuthus] 0.909 0.279 0.958 4e-62
148298800 433 enolase [Bombyx mori] gi|119381542|gb|AB 0.909 0.279 0.950 9e-62
270298186 433 enolase [Pieris rapae] 0.902 0.277 0.958 4e-61
53830714 433 enolase [Oncometopia nigricans] 0.894 0.274 0.949 1e-60
157121051 433 enolase [Aedes aegypti] gi|108882996|gb| 0.894 0.274 0.941 6e-60
194762349 499 GF15876 [Drosophila ananassae] gi|190617 0.902 0.240 0.916 7e-60
91090950 433 PREDICTED: similar to AGAP007827-PA isof 0.894 0.274 0.941 8e-60
58390364 433 AGAP007827-PA [Anopheles gambiae str. PE 0.894 0.274 0.949 9e-60
>gi|308743359|gb|ADO40102.1| enolase [Antheraea pernyi] Back     alignment and taxonomy information
 Score =  243 bits (619), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 116/121 (95%), Positives = 118/121 (97%)

Query: 13  PIQIVGDDLTVTNPKRIATAVEKKACNCLLLKVNQIGSVTESIQAHLLAKQNGWGTMVSH 72
           PIQIVGDDLTVTNPKRIATAVEKKACNCLLLKVNQIGSV+ESI AHLLAKQNGWGTMVSH
Sbjct: 313 PIQIVGDDLTVTNPKRIATAVEKKACNCLLLKVNQIGSVSESIDAHLLAKQNGWGTMVSH 372

Query: 73  RSGETEDNFIADLVVGLSTGQIKTGAPCRSERLAKYNQILRIEEELGANAKFAGKNFRRP 132
           RSGETED FIADLVVGLSTGQIKTGAPCRSERLAKYNQILRIEEELGA AK+AGKNFRRP
Sbjct: 373 RSGETEDTFIADLVVGLSTGQIKTGAPCRSERLAKYNQILRIEEELGAAAKYAGKNFRRP 432

Query: 133 V 133
           V
Sbjct: 433 V 433

Source: Antheraea pernyi

Species: Antheraea pernyi

Genus: Antheraea

Family: Saturniidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|357616014|gb|EHJ69958.1| enolase [Danaus plexippus] Back     alignment and taxonomy information
>gi|389608773|dbj|BAM17998.1| enolase [Papilio xuthus] Back     alignment and taxonomy information
>gi|148298800|ref|NP_001091831.1| enolase [Bombyx mori] gi|119381542|gb|ABL73887.1| enolase [Bombyx mori] Back     alignment and taxonomy information
>gi|270298186|gb|ACZ68117.1| enolase [Pieris rapae] Back     alignment and taxonomy information
>gi|53830714|gb|AAU95200.1| enolase [Oncometopia nigricans] Back     alignment and taxonomy information
>gi|157121051|ref|XP_001653750.1| enolase [Aedes aegypti] gi|108882996|gb|EAT47221.1| AAEL001668-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|194762349|ref|XP_001963312.1| GF15876 [Drosophila ananassae] gi|190617009|gb|EDV32533.1| GF15876 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|91090950|ref|XP_967559.1| PREDICTED: similar to AGAP007827-PA isoform 1 [Tribolium castaneum] gi|270014058|gb|EFA10506.1| hypothetical protein TcasGA2_TC012754 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|58390364|ref|XP_317672.2| AGAP007827-PA [Anopheles gambiae str. PEST] gi|55237886|gb|EAA12254.2| AGAP007827-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query133
FB|FBgn0000579500 Eno "Enolase" [Drosophila mela 0.894 0.238 0.915 9.9e-55
UNIPROTKB|F1NZ78434 ENO1 "Alpha-enolase" [Gallus g 0.894 0.274 0.848 1.1e-50
UNIPROTKB|P51913434 ENO1 "Alpha-enolase" [Gallus g 0.894 0.274 0.848 1.1e-50
ZFIN|ZDB-GENE-030131-6048432 eno1a "enolase 1a, (alpha)" [D 0.954 0.293 0.811 1.3e-50
UNIPROTKB|P06733434 ENO1 "Alpha-enolase" [Homo sap 0.902 0.276 0.841 1.7e-50
ZFIN|ZDB-GENE-040426-1651433 eno1b "enolase 1b, (alpha)" [D 0.902 0.277 0.841 2.2e-50
UNIPROTKB|F1MB08434 ENO1 "Alpha-enolase" [Bos taur 0.902 0.276 0.841 2.8e-50
ZFIN|ZDB-GENE-031006-5467 eno3 "enolase 3, (beta, muscle 0.894 0.254 0.857 3.6e-50
RGD|2554434 Eno2 "enolase 2, gamma, neuron 0.894 0.274 0.848 5.8e-50
UNIPROTKB|P07323434 Eno2 "Gamma-enolase" [Rattus n 0.894 0.274 0.848 5.8e-50
FB|FBgn0000579 Eno "Enolase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 565 (203.9 bits), Expect = 9.9e-55, P = 9.9e-55
 Identities = 109/119 (91%), Positives = 115/119 (96%)

Query:    14 IQIVGDDLTVTNPKRIATAVEKKACNCLLLKVNQIGSVTESIQAHLLAKQNGWGTMVSHR 73
             IQIVGDDLTVTNPKRIATAVEKKACNCLLLKVNQIG+VTESI AHLLAK+NGWGTMVSHR
Sbjct:   381 IQIVGDDLTVTNPKRIATAVEKKACNCLLLKVNQIGTVTESIAAHLLAKKNGWGTMVSHR 440

Query:    74 SGETEDNFIADLVVGLSTGQIKTGAPCRSERLAKYNQILRIEEELGANAKFAGKNFRRP 132
             SGETED+FI DLVVGLSTGQIKTGAPCRSERLAKYNQILRIEEE+GA  KFAGK+FR+P
Sbjct:   441 SGETEDSFIGDLVVGLSTGQIKTGAPCRSERLAKYNQILRIEEEIGAGVKFAGKSFRKP 499
GO:0004634 "phosphopyruvate hydratase activity" evidence=ISS
GO:0006096 "glycolysis" evidence=IEA;NAS
GO:0000287 "magnesium ion binding" evidence=IEA
GO:0000015 "phosphopyruvate hydratase complex" evidence=IEA
GO:0005811 "lipid particle" evidence=IDA
UNIPROTKB|F1NZ78 ENO1 "Alpha-enolase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P51913 ENO1 "Alpha-enolase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-6048 eno1a "enolase 1a, (alpha)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P06733 ENO1 "Alpha-enolase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1651 eno1b "enolase 1b, (alpha)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MB08 ENO1 "Alpha-enolase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-031006-5 eno3 "enolase 3, (beta, muscle)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|2554 Eno2 "enolase 2, gamma, neuronal" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P07323 Eno2 "Gamma-enolase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P17183ENOG_MOUSE4, ., 2, ., 1, ., 1, 10.84870.89470.2741yesN/A
P06733ENOA_HUMAN4, ., 2, ., 1, ., 1, 10.82250.93230.2857yesN/A
P15007ENO_DROME4, ., 2, ., 1, ., 1, 10.91590.89470.238noN/A
Q27527ENO_CAEEL4, ., 2, ., 1, ., 1, 10.83190.89470.2741yesN/A
Q42971ENO_ORYSJ4, ., 2, ., 1, ., 1, 10.75400.91720.2735yesN/A
Q5R6Y1ENOA_PONAB4, ., 2, ., 1, ., 1, 10.81450.93230.2857yesN/A
P25696ENO2_ARATH4, ., 2, ., 1, ., 1, 10.7750.90220.2702yesN/A
P56252ENO_HOMGA4, ., 2, ., 1, ., 1, 10.92430.89470.2748N/AN/A
P51913ENOA_CHICK4, ., 2, ., 1, ., 1, 10.84870.89470.2741yesN/A
Q8IJN7ENO_PLAF74, ., 2, ., 1, ., 1, 10.76920.87960.2623yesN/A
P07323ENOG_RAT4, ., 2, ., 1, ., 1, 10.84870.89470.2741yesN/A
Q27727ENO_PLAFA4, ., 2, ., 1, ., 1, 10.76920.87960.2623yesN/A
Q54RK5ENOA_DICDI4, ., 2, ., 1, ., 1, 10.77960.88720.2718yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer4.2.1.11LOW CONFIDENCE prediction!
3rd Layer4.2.10.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query133
pfam00113296 pfam00113, Enolase_C, Enolase, C-terminal TIM barr 1e-87
PLN00191457 PLN00191, PLN00191, enolase 3e-84
PTZ00081439 PTZ00081, PTZ00081, enolase; Provisional 2e-81
cd03313408 cd03313, enolase, Enolase: Enolases are homodimeri 2e-77
PRK00077425 PRK00077, eno, enolase; Provisional 3e-73
COG0148423 COG0148, Eno, Enolase [Carbohydrate transport and 8e-65
TIGR01060425 TIGR01060, eno, phosphopyruvate hydratase 2e-60
cd00308229 cd00308, enolase_like, Enolase-superfamily, charac 7e-10
>gnl|CDD|109180 pfam00113, Enolase_C, Enolase, C-terminal TIM barrel domain Back     alignment and domain information 
 Score =  256 bits (656), Expect = 1e-87
 Identities = 99/120 (82%), Positives = 108/120 (90%)

Query: 14  IQIVGDDLTVTNPKRIATAVEKKACNCLLLKVNQIGSVTESIQAHLLAKQNGWGTMVSHR 73
           IQIVGDDLTVTNPKRIA A+EKKACN LLLKVNQIGSVTES+ A  +AK  GWG MVSHR
Sbjct: 177 IQIVGDDLTVTNPKRIAKAIEKKACNSLLLKVNQIGSVTESLAAVKMAKDAGWGVMVSHR 236

Query: 74  SGETEDNFIADLVVGLSTGQIKTGAPCRSERLAKYNQILRIEEELGANAKFAGKNFRRPV 133
           SGETED FIADLVVGL+ GQIKTGAPCRSERLAKYNQ+LRIEEELG+ AK+AG+NFR+P 
Sbjct: 237 SGETEDTFIADLVVGLNAGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKYAGRNFRKPQ 296

Length = 296
>gnl|CDD|215095 PLN00191, PLN00191, enolase Back     alignment and domain information
>gnl|CDD|240259 PTZ00081, PTZ00081, enolase; Provisional Back     alignment and domain information
>gnl|CDD|239429 cd03313, enolase, Enolase: Enolases are homodimeric enzymes that catalyse the reversible dehydration of 2-phospho-D-glycerate to phosphoenolpyruvate as part of the glycolytic and gluconeogenesis pathways Back     alignment and domain information
>gnl|CDD|234617 PRK00077, eno, enolase; Provisional Back     alignment and domain information
>gnl|CDD|223226 COG0148, Eno, Enolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|213580 TIGR01060, eno, phosphopyruvate hydratase Back     alignment and domain information
>gnl|CDD|238188 cd00308, enolase_like, Enolase-superfamily, characterized by the presence of an enolate anion intermediate which is generated by abstraction of the alpha-proton of the carboxylate substrate by an active site residue and is stabilized by coordination to the essential Mg2+ ion Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 133
PF00113295 Enolase_C: Enolase, C-terminal TIM barrel domain; 100.0
KOG2670|consensus433 100.0
COG0148423 Eno Enolase [Carbohydrate transport and metabolism 100.0
PRK08350341 hypothetical protein; Provisional 100.0
PTZ00378518 hypothetical protein; Provisional 100.0
PTZ00081439 enolase; Provisional 100.0
PLN00191457 enolase 100.0
PRK00077425 eno enolase; Provisional 100.0
TIGR01060425 eno phosphopyruvate hydratase. Alternate name: eno 100.0
cd03313408 enolase Enolase: Enolases are homodimeric enzymes 100.0
TIGR01502408 B_methylAsp_ase methylaspartate ammonia-lyase. Thi 98.75
cd03314369 MAL Methylaspartate ammonia lyase (3-methylasparta 98.53
cd00308229 enolase_like Enolase-superfamily, characterized by 97.63
cd03317354 NAAAR N-acylamino acid racemase (NAAAR), an octame 97.41
PF07476248 MAAL_C: Methylaspartate ammonia-lyase C-terminus; 97.36
cd03318365 MLE Muconate Lactonizing Enzyme (MLE), an homoocta 96.96
cd03319316 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat 96.92
TIGR01928324 menC_lowGC/arch o-succinylbenzoic acid (OSB) synth 96.87
cd03316357 MR_like Mandelate racemase (MR)-like subfamily of 96.83
PF13378111 MR_MLE_C: Enolase C-terminal domain-like; PDB: 3FC 96.72
cd03321355 mandelate_racemase Mandelate racemase (MR) catalyz 96.64
cd03315265 MLE_like Muconate lactonizing enzyme (MLE) like su 96.57
cd03329368 MR_like_4 Mandelate racemase (MR)-like subfamily o 96.5
cd03322361 rpsA The starvation sensing protein RpsA from E.co 96.42
cd03327341 MR_like_2 Mandelate racemase (MR)-like subfamily o 96.3
TIGR01927307 menC_gamma/gm+ o-succinylbenzoic acid (OSB) synthe 96.1
cd03325352 D-galactonate_dehydratase D-galactonate dehydratas 95.97
TIGR02534368 mucon_cyclo muconate and chloromuconate cycloisome 95.95
PRK14017382 galactonate dehydratase; Provisional 95.75
cd03320263 OSBS o-Succinylbenzoate synthase (OSBS) catalyzes 95.43
PRK15072404 bifunctional D-altronate/D-mannonate dehydratase; 95.35
cd03323395 D-glucarate_dehydratase D-Glucarate dehydratase (G 95.21
TIGR03247441 glucar-dehydr glucarate dehydratase. Glucarate deh 94.72
PRK02901327 O-succinylbenzoate synthase; Provisional 94.57
PRK15129321 L-Ala-D/L-Glu epimerase; Provisional 94.33
cd03328352 MR_like_3 Mandelate racemase (MR)-like subfamily o 94.02
PRK05105322 O-succinylbenzoate synthase; Provisional 92.39
PRK15440394 L-rhamnonate dehydratase; Provisional 91.36
PRK02714320 O-succinylbenzoate synthase; Provisional 91.24
cd03326385 MR_like_1 Mandelate racemase (MR)-like subfamily o 91.07
cd03324415 rTSbeta_L-fuconate_dehydratase Human rTS beta is e 89.33
COG4948372 L-alanine-DL-glutamate epimerase and related enzym 88.28
PLN02980 1655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 86.7
COG3799410 Mal Methylaspartate ammonia-lyase [Amino acid tran 86.03
>PF00113 Enolase_C: Enolase, C-terminal TIM barrel domain; InterPro: IPR020810 Enolase (2-phospho-D-glycerate hydrolase) is an essential glycolytic enzyme that catalyses the interconversion of 2-phosphoglycerate and phosphoenolpyruvate [, ] Back     alignment and domain information 
Probab=100.00  E-value=4e-60  Score=393.71  Aligned_cols=130  Identities=70%  Similarity=1.084  Sum_probs=114.7

Q ss_pred             chhhhhhcCCCeEEecCcccccCHHHHHHHHhhcccccceehccccccHHHHHHHHHHHHHCCCcEEeecCCCCCCchhH
Q psy12654          3 LFQLNDFAPEPIQIVGDDLTVTNPKRIATAVEKKACNCLLLKVNQIGSVTESIQAHLLAKQNGWGTMVSHRSGETEDNFI   82 (133)
Q Consensus         3 ~~~~~~~~~~~iqivGDDl~vTn~~ri~~~i~~~~~na~llK~nQigTvTe~lea~~~a~~~g~~~vvS~rsGETeD~~i   82 (133)
                      ..+||++++++|||||||||||||+||++++++++||++||||||||||||++|++++|+++||.+|||||||||+|+||
T Consensus       166 w~~lt~~~g~~~~iVGDDl~vTn~~ri~~~i~~~~~na~llK~NQigTvte~lea~~~a~~~g~~~vvS~rsgEteD~~i  245 (295)
T PF00113_consen  166 WAKLTKRLGDKIQIVGDDLFVTNPKRIKKGIEKKACNALLLKPNQIGTVTETLEAVKLAKSAGWGVVVSHRSGETEDTFI  245 (295)
T ss_dssp             HHHHHHHHTTTSEEEESTTTTT-HHHHHHHHHCT--SEEEE-HHHHSSHHHHHHHHHHHHHTT-EEEEE--SS--S--HH
T ss_pred             HHHHHHhhhcceeeecccccccchhhhhccchhhhccchhhhhhhhHHHHHHHHHHHHHHHCCceeeccCCCCCcCchhH
Confidence            35789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhhhhhccCceecCCCCchhHHHHHHHHHHHHHHhCCcccccCccCCCC
Q psy12654         83 ADLVVGLSTGQIKTGAPCRSERLAKYNQILRIEEELGANAKFAGKNFRRP  132 (133)
Q Consensus        83 adLAVgl~a~~iK~G~p~r~Er~aKyN~LLrIeeelg~~~~~~g~~~~~~  132 (133)
                      ||||||++++|||+|+|||+||++||||||||||+|+++++|+|++||+|
T Consensus       246 adLaVg~~a~~iK~G~p~r~Er~aKyN~LLrIeeelg~~a~~~g~~~~~~  295 (295)
T PF00113_consen  246 ADLAVGLGAGQIKTGAPCRGERIAKYNRLLRIEEELGSKAKYAGKNFRKP  295 (295)
T ss_dssp             HHHHHHTT-SEEEEESSSSHHHHHHHHHHHHHHHHHGGGSEE-GGGCTSC
T ss_pred             HHHHhccCcCeEecccchhhHHHHHhhHHHHHHHHcCCCCEECChhhhCc
Confidence            99999999999999999999999999999999999999999999999997

In vertebrates, there are 3 different, tissue-specific isoenzymes, designated alpha, beta and gamma. Alpha is present in most tissues, beta is localised in muscle tissue, and gamma is found only in nervous tissue. The functional enzyme exists as a dimer of any 2 isoforms. In immature organs and in adult liver, it is usually an alpha homodimer, in adult skeletal muscle, a beta homodimer, and in adult neurons, a gamma homodimer. In developing muscle, it is usually an alpha/beta heterodimer, and in the developing nervous system, an alpha/gamma heterodimer []. The tissue specific forms display minor kinetic differences. Tau-crystallin, one of the major lens proteins in some fish, reptiles and birds, has been shown [] to be evolutionary related to enolase. Neuron-specific enolase is released in a variety of neurological diseases, such as multiple sclerosis and after seizures or acute stroke. Several tumour cells have also been found positive for neuron-specific enolase. Beta-enolase deficiency is associated with glycogenosis type XIII defect.; GO: 0000287 magnesium ion binding, 0004634 phosphopyruvate hydratase activity, 0006096 glycolysis, 0000015 phosphopyruvate hydratase complex; PDB: 2FYM_D 3H8A_C 1E9I_D 3TQP_B 2PU1_A 1OEP_A 2PA6_A 1PDY_A 1PDZ_A 3UJ2_E ....
>KOG2670|consensus Back     alignment and domain information
>COG0148 Eno Enolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08350 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00378 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00081 enolase; Provisional Back     alignment and domain information
>PLN00191 enolase Back     alignment and domain information
>PRK00077 eno enolase; Provisional Back     alignment and domain information
>TIGR01060 eno phosphopyruvate hydratase Back     alignment and domain information
>cd03313 enolase Enolase: Enolases are homodimeric enzymes that catalyse the reversible dehydration of 2-phospho-D-glycerate to phosphoenolpyruvate as part of the glycolytic and gluconeogenesis pathways Back     alignment and domain information
>TIGR01502 B_methylAsp_ase methylaspartate ammonia-lyase Back     alignment and domain information
>cd03314 MAL Methylaspartate ammonia lyase (3-methylaspartase, MAL) is a homodimeric enzyme, catalyzing the magnesium-dependent reversible alpha,beta-elimination of ammonia from L-threo-(2S,3S)-3-methylaspartic acid to mesaconic acid Back     alignment and domain information
>cd00308 enolase_like Enolase-superfamily, characterized by the presence of an enolate anion intermediate which is generated by abstraction of the alpha-proton of the carboxylate substrate by an active site residue and is stabilized by coordination to the essential Mg2+ ion Back     alignment and domain information
>cd03317 NAAAR N-acylamino acid racemase (NAAAR), an octameric enzyme that catalyzes the racemization of N-acylamino acids Back     alignment and domain information
>PF07476 MAAL_C: Methylaspartate ammonia-lyase C-terminus; InterPro: IPR022662 Methylaspartate ammonia-lyase 4 Back     alignment and domain information
>cd03318 MLE Muconate Lactonizing Enzyme (MLE), an homooctameric enzyme, catalyses the conversion of cis,cis-muconate (CCM) to muconolactone (ML) in the catechol branch of the beta-ketoadipate pathway Back     alignment and domain information
>cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides Back     alignment and domain information
>TIGR01928 menC_lowGC/arch o-succinylbenzoic acid (OSB) synthetase Back     alignment and domain information
>cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily Back     alignment and domain information
>PF13378 MR_MLE_C: Enolase C-terminal domain-like; PDB: 3FCP_B 3P0W_D 3VFC_A 3VDG_A 3FJ4_B 3CT2_B 3DGB_A 3V3W_A 3V4B_A 3NO1_E Back     alignment and domain information
>cd03321 mandelate_racemase Mandelate racemase (MR) catalyzes the Mg2+-dependent 1,1-proton transfer reaction that interconverts the enantiomers of mandelic acid Back     alignment and domain information
>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily Back     alignment and domain information
>cd03329 MR_like_4 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 4 Back     alignment and domain information
>cd03322 rpsA The starvation sensing protein RpsA from E Back     alignment and domain information
>cd03327 MR_like_2 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 2 Back     alignment and domain information
>TIGR01927 menC_gamma/gm+ o-succinylbenzoic acid (OSB) synthetase Back     alignment and domain information
>cd03325 D-galactonate_dehydratase D-galactonate dehydratase catalyses the dehydration of galactonate to 2-keto-3-deoxygalactnate (KDGal), as part of the D-galactonate nonphosphorolytic catabolic Entner-Doudoroff pathway Back     alignment and domain information
>TIGR02534 mucon_cyclo muconate and chloromuconate cycloisomerases Back     alignment and domain information
>PRK14017 galactonate dehydratase; Provisional Back     alignment and domain information
>cd03320 OSBS o-Succinylbenzoate synthase (OSBS) catalyzes the conversion of 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate (SHCHC) to 4-(2'-carboxyphenyl)-4-oxobutyrate (o-succinylbenzoate or OSB), a reaction in the menaquinone biosynthetic pathway Back     alignment and domain information
>PRK15072 bifunctional D-altronate/D-mannonate dehydratase; Provisional Back     alignment and domain information
>cd03323 D-glucarate_dehydratase D-Glucarate dehydratase (GlucD) catalyzes the dehydration of both D-glucarate and L-idarate to form 5-keto-4-deoxy-D-glucarate (5-KDG) , the initial reaction of the catabolic pathway for (D)-glucarate Back     alignment and domain information
>TIGR03247 glucar-dehydr glucarate dehydratase Back     alignment and domain information
>PRK02901 O-succinylbenzoate synthase; Provisional Back     alignment and domain information
>PRK15129 L-Ala-D/L-Glu epimerase; Provisional Back     alignment and domain information
>cd03328 MR_like_3 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 3 Back     alignment and domain information
>PRK05105 O-succinylbenzoate synthase; Provisional Back     alignment and domain information
>PRK15440 L-rhamnonate dehydratase; Provisional Back     alignment and domain information
>PRK02714 O-succinylbenzoate synthase; Provisional Back     alignment and domain information
>cd03326 MR_like_1 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 1 Back     alignment and domain information
>cd03324 rTSbeta_L-fuconate_dehydratase Human rTS beta is encoded by the rTS gene which, through alternative RNA splicing, also encodes rTS alpha whose mRNA is complementary to thymidylate synthase mRNA Back     alignment and domain information
>COG4948 L-alanine-DL-glutamate epimerase and related enzymes of enolase superfamily [Cell envelope biogenesis, outer membrane / General function prediction only] Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>COG3799 Mal Methylaspartate ammonia-lyase [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query133
1pdz_A434 X-Ray Structure And Catalytic Mechanism Of Lobster 1e-60
2psn_A434 Crystal Structure Of Enolase1 Length = 434 2e-56
3b97_A433 Crystal Structure Of Human Enolase 1 Length = 433 2e-56
3ucc_A439 Asymmetric Complex Of Human Neuron Specific Enolase 7e-56
1te6_A439 Crystal Structure Of Human Neuron Specific Enolase 7e-56
3uje_A443 Asymmetric Complex Of Human Neuron Specific Enolase 7e-56
2xsx_A435 Crystal Structure Of Human Beta Enolase Enob Length 2e-55
2al2_B436 Crystal Structure Analysis Of Enolase Mg Subunit Co 5e-48
1els_A436 Catalytic Metal Ion Binding In Enolase: The Crystal 6e-48
1p48_A436 Reverse Protonation Is The Key To General Acid-Base 6e-48
1p43_A436 Reverse Protonation Is The Key To General Acid-Base 6e-48
1ebg_A436 Chelation Of Ser 39 To Mg2+ Latches A Gate At The A 6e-48
1l8p_A436 Mg-phosphonoacetohydroxamate Complex Of S39a Yeast 6e-48
3otr_A452 2.75 Angstrom Crystal Structure Of Enolase 1 From T 2e-47
2al2_A436 Crystal Structure Analysis Of Enolase Mg Subunit Co 3e-47
2xh4_A443 Engineering The Enolase Active Site Pocket: Crystal 6e-47
2xh7_A443 Engineering The Enolase Active Site Pocket: Crystal 7e-47
2xh2_A443 Engineering The Enolase Active Site Pocket: Crystal 7e-47
2xgz_A443 Engineering The Enolase Active Site Pocket: Crystal 8e-47
2xh0_A443 Engineering The Enolase Active Site Pocket: Crystal 8e-47
4g7f_A429 Crystal Structure Of Enolase From Trypanosoma Cruzi 4e-45
1oep_A432 Structure Of Trypanosoma Brucei Enolase Reveals The 3e-43
2ptw_A432 Crystal Structure Of The T. Brucei Enolase Complexe 3e-43
3qtp_A441 Crystal Structure Analysis Of Entamoeba Histolytica 8e-43
2pa6_A427 Crystal Structure Of Mj0232 From Methanococcus Jann 3e-39
3uj2_A449 Crystal Structure Of An Enolase From Anaerostipes C 1e-34
4a3r_A430 Crystal Structure Of Enolase From Bacillus Subtilis 5e-32
1iyx_A432 Crystal Structure Of Enolase From Enterococcus Hira 5e-32
3h8a_A432 Crystal Structure Of E. Coli Enolase Bound To Its C 4e-31
1e9i_A431 Enolase From E.Coli Length = 431 5e-31
4ewj_A443 Structure Of The Enloase From Streptococcus Suis Se 6e-31
1w6t_A444 Crystal Structure Of Octameric Enolase From Strepto 2e-30
3tqp_A428 Structure Of An Enolase (Eno) From Coxiella Burneti 2e-30
3qn3_A417 Phosphopyruvate Hydratase From Campylobacter Jejuni 2e-26
>pdb|1PDZ|A Chain A, X-Ray Structure And Catalytic Mechanism Of Lobster Enolase Length = 434 Back     alignment and structure 
Iteration: 1

 Score =  227 bits (579), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 110/119 (92%), Positives = 112/119 (94%)
Query: 14  IQIVGDDLTVTNPKRIATAVEKKACNCLLLKVNQIGSVTESIQAHLLAKQNGWGTMVSHR 73
           IQIVGDDLTVTNPKRI TAVEKKAC CLLLKVNQIGSVTESI AHLLAK+NGWGTMVSHR
Sbjct: 315 IQIVGDDLTVTNPKRITTAVEKKACKCLLLKVNQIGSVTESIDAHLLAKKNGWGTMVSHR 374
Query: 74  SGETEDNFIADLVVGLSTGQIKTGAPCRSERLAKYNQILRIEEELGANAKFAGKNFRRP 132
           SGETED FIADLVVGL TGQIKTGAPCRSERLAKYNQILRIEEELG+ AKFAGKNFR P
Sbjct: 375 SGETEDCFIADLVVGLCTGQIKTGAPCRSERLAKYNQILRIEEELGSGAKFAGKNFRAP 433
>pdb|2PSN|A Chain A, Crystal Structure Of Enolase1 Length = 434 Back     alignment and structure
>pdb|3B97|A Chain A, Crystal Structure Of Human Enolase 1 Length = 433 Back     alignment and structure
>pdb|3UCC|A Chain A, Asymmetric Complex Of Human Neuron Specific Enolase-1-PgaPEP Length = 439 Back     alignment and structure
>pdb|1TE6|A Chain A, Crystal Structure Of Human Neuron Specific Enolase At 1.8 Angstrom Length = 439 Back     alignment and structure
>pdb|3UJE|A Chain A, Asymmetric Complex Of Human Neuron Specific Enolase-3-PgaPEP Length = 443 Back     alignment and structure
>pdb|2XSX|A Chain A, Crystal Structure Of Human Beta Enolase Enob Length = 435 Back     alignment and structure
>pdb|2AL2|B Chain B, Crystal Structure Analysis Of Enolase Mg Subunit Complex At Ph 8.0 Length = 436 Back     alignment and structure
>pdb|1ELS|A Chain A, Catalytic Metal Ion Binding In Enolase: The Crystal Structure Of Enolase-Mn2+-Phosphonoacetohydroxamate Complex At 2.4 Angstroms Resolution Length = 436 Back     alignment and structure
>pdb|1P48|A Chain A, Reverse Protonation Is The Key To General Acid-Base Catalysis In Enolase Length = 436 Back     alignment and structure
>pdb|1P43|A Chain A, Reverse Protonation Is The Key To General Acid-Base Catalysis In Enolase Length = 436 Back     alignment and structure
>pdb|1EBG|A Chain A, Chelation Of Ser 39 To Mg2+ Latches A Gate At The Active Site Of Enolase: Structure Of The Bis(Mg2+) Complex Of Yeast Enolase And The Intermediate Analog Phosphonoacetohydroxamate At 2.1 Angstroms Resolution Length = 436 Back     alignment and structure
>pdb|1L8P|A Chain A, Mg-phosphonoacetohydroxamate Complex Of S39a Yeast Enolase 1 Length = 436 Back     alignment and structure
>pdb|3OTR|A Chain A, 2.75 Angstrom Crystal Structure Of Enolase 1 From Toxoplasma Gondii Length = 452 Back     alignment and structure
>pdb|2AL2|A Chain A, Crystal Structure Analysis Of Enolase Mg Subunit Complex At Ph 8.0 Length = 436 Back     alignment and structure
>pdb|2XH4|A Chain A, Engineering The Enolase Active Site Pocket: Crystal Structure Of The S39a D321a Mutant Of Yeast Enolase 1 Length = 443 Back     alignment and structure
>pdb|2XH7|A Chain A, Engineering The Enolase Active Site Pocket: Crystal Structure Of The D321a Mutant Of Yeast Enolase 1 Length = 443 Back     alignment and structure
>pdb|2XH2|A Chain A, Engineering The Enolase Active Site Pocket: Crystal Structure Of The S39n D321a Mutant Of Yeast Enolase 1 Length = 443 Back     alignment and structure
>pdb|2XGZ|A Chain A, Engineering The Enolase Active Site Pocket: Crystal Structure Of The S39n D321r Mutant Of Yeast Enolase 1 Length = 443 Back     alignment and structure
>pdb|2XH0|A Chain A, Engineering The Enolase Active Site Pocket: Crystal Structure Of The S39n Q167k D321r Mutant Of Yeast Enolase 1 Length = 443 Back     alignment and structure
>pdb|4G7F|A Chain A, Crystal Structure Of Enolase From Trypanosoma Cruzi Length = 429 Back     alignment and structure
>pdb|1OEP|A Chain A, Structure Of Trypanosoma Brucei Enolase Reveals The Inhibitory Divalent Metal Site Length = 432 Back     alignment and structure
>pdb|2PTW|A Chain A, Crystal Structure Of The T. Brucei Enolase Complexed With Sulphate, Identification Of A Metal Binding Site Iv Length = 432 Back     alignment and structure
>pdb|3QTP|A Chain A, Crystal Structure Analysis Of Entamoeba Histolytica Enolase Length = 441 Back     alignment and structure
>pdb|2PA6|A Chain A, Crystal Structure Of Mj0232 From Methanococcus Jannaschii Length = 427 Back     alignment and structure
>pdb|3UJ2|A Chain A, Crystal Structure Of An Enolase From Anaerostipes Caccae (Efi Target Efi-502054) With Bound Mg And Sulfate Length = 449 Back     alignment and structure
>pdb|4A3R|A Chain A, Crystal Structure Of Enolase From Bacillus Subtilis. Length = 430 Back     alignment and structure
>pdb|1IYX|A Chain A, Crystal Structure Of Enolase From Enterococcus Hirae Length = 432 Back     alignment and structure
>pdb|3H8A|A Chain A, Crystal Structure Of E. Coli Enolase Bound To Its Cognate Rnase E Recognition Domain Length = 432 Back     alignment and structure
>pdb|1E9I|A Chain A, Enolase From E.Coli Length = 431 Back     alignment and structure
>pdb|4EWJ|A Chain A, Structure Of The Enloase From Streptococcus Suis Serotype 2 Length = 443 Back     alignment and structure
>pdb|1W6T|A Chain A, Crystal Structure Of Octameric Enolase From Streptococcus Pneumoniae Length = 444 Back     alignment and structure
>pdb|3TQP|A Chain A, Structure Of An Enolase (Eno) From Coxiella Burnetii Length = 428 Back     alignment and structure
>pdb|3QN3|A Chain A, Phosphopyruvate Hydratase From Campylobacter Jejuni. Length = 417 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query133
2al1_A436 Enolase 1, 2-phospho-D-; beta barrel, lyase; HET: 2e-93
2akz_A439 Gamma enolase, neural; fluoride inhibition, negati 3e-93
3otr_A452 Enolase; structural genomics, center for structura 9e-91
3qtp_A441 Enolase 1; glycolysis, lyase; HET: 2PG; 1.90A {Ent 7e-90
2ptz_A432 Enolase; lyase, glycolysis,His-TAG; 1.65A {Trypano 8e-89
2pa6_A427 Enolase; glycolysis, lyase, magnesium, metal-bindi 7e-85
3uj2_A449 Enolase 1; enzyme function initiative, EFI, lyase; 3e-69
1w6t_A444 Enolase; bacterial infection, surface protein, moo 4e-69
3tqp_A428 Enolase; energy metabolism, lyase; 2.20A {Coxiella 4e-69
2fym_A431 Enolase; RNA degradosome, enolase, lyase; 1.60A {E 5e-69
3qn3_A417 Enolase; structural genomics, center for structura 1e-65
1kcz_A413 Beta-methylaspartase; beta zigzag, alpha/beta-barr 5e-12
1kko_A413 3-methylaspartate ammonia-lyase; enolase superfami 1e-11
2okt_A342 OSB synthetase, O-succinylbenzoic acid synthetase; 2e-05
>2al1_A Enolase 1, 2-phospho-D-; beta barrel, lyase; HET: PEP 2PG; 1.50A {Saccharomyces cerevisiae} SCOP: c.1.11.1 d.54.1.1 PDB: 1ebg_A 1ebh_A* 1one_A* 2one_A* 1p48_A* 1p43_A* 1l8p_A 4enl_A 1nel_A 1els_A 3enl_A 5enl_A* 6enl_A 7enl_A* 2al2_A* 2al2_B* 2xh7_A* 2xgz_A* 2xh2_A* 2xh4_A* ... Length = 436 Back     alignment and structure
 Score =  275 bits (706), Expect = 2e-93
 Identities = 91/120 (75%), Positives = 100/120 (83%)

Query: 14  IQIVGDDLTVTNPKRIATAVEKKACNCLLLKVNQIGSVTESIQAHLLAKQNGWGTMVSHR 73
           IQIV DDLTVTNPKRIATA+EKKA + LLLKVNQIG+++ESI+A   +   GWG MVSHR
Sbjct: 315 IQIVADDLTVTNPKRIATAIEKKAADALLLKVNQIGTLSESIKAAQDSFAAGWGVMVSHR 374

Query: 74  SGETEDNFIADLVVGLSTGQIKTGAPCRSERLAKYNQILRIEEELGANAKFAGKNFRRPV 133
           SGETED FIADLVVGL TGQIKTGAP RSERLAK NQ+LRIEEELG NA FAG+NF    
Sbjct: 375 SGETEDTFIADLVVGLRTGQIKTGAPARSERLAKLNQLLRIEEELGDNAVFAGENFHHGD 434
>2akz_A Gamma enolase, neural; fluoride inhibition, negative cooperativity, glycolysis, , isothermal titration calorimetry, lyase; 1.36A {Homo sapiens} SCOP: c.1.11.1 d.54.1.1 PDB: 2akm_A 1te6_A 2psn_A 3b97_A 2xsx_A 1pdz_A 1pdy_A Length = 439 Back     alignment and structure
>3otr_A Enolase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta barrel, TIM barrel; 2.75A {Toxoplasma gondii} Length = 452 Back     alignment and structure
>3qtp_A Enolase 1; glycolysis, lyase; HET: 2PG; 1.90A {Entamoeba histolytica} Length = 441 Back     alignment and structure
>2ptz_A Enolase; lyase, glycolysis,His-TAG; 1.65A {Trypanosoma brucei} SCOP: c.1.11.1 d.54.1.1 PDB: 2ptx_A 2pty_A* 2ptw_A 2pu0_A 2pu1_A* 1oep_A Length = 432 Back     alignment and structure
>2pa6_A Enolase; glycolysis, lyase, magnesium, metal-binding, structural GENO NPPSFA; 1.85A {Methanocaldococcus jannaschii} Length = 427 Back     alignment and structure
>3uj2_A Enolase 1; enzyme function initiative, EFI, lyase; 2.00A {Anaerostipes caccae} Length = 449 Back     alignment and structure
>1w6t_A Enolase; bacterial infection, surface protein, moonlighting protein, glycolysis, phosphopyruvate hydratase, lyase; HET: 2PE; 2.10A {Streptococcus pneumoniae} SCOP: c.1.11.1 d.54.1.1 PDB: 1iyx_A Length = 444 Back     alignment and structure
>3tqp_A Enolase; energy metabolism, lyase; 2.20A {Coxiella burnetii} Length = 428 Back     alignment and structure
>2fym_A Enolase; RNA degradosome, enolase, lyase; 1.60A {Escherichia coli} SCOP: c.1.11.1 d.54.1.1 PDB: 1e9i_A 3h8a_A Length = 431 Back     alignment and structure
>3qn3_A Enolase; structural genomics, center for structural genomics of infec diseases, csgid, glycolysis, lyase; 2.13A {Campylobacter jejuni} Length = 417 Back     alignment and structure
>1kcz_A Beta-methylaspartase; beta zigzag, alpha/beta-barrel, lyase; 1.90A {Clostridium tetanomorphum} SCOP: c.1.11.2 d.54.1.1 PDB: 1kd0_A* 3zvi_A 3zvh_A Length = 413 Back     alignment and structure
>1kko_A 3-methylaspartate ammonia-lyase; enolase superfamily, TIM barrel; 1.33A {Citrobacter amalonaticus} SCOP: c.1.11.2 d.54.1.1 PDB: 1kkr_A* Length = 413 Back     alignment and structure
>2okt_A OSB synthetase, O-succinylbenzoic acid synthetase; enolase, structural genom protein structure initiative, PSI, nysgrc; 1.30A {Staphylococcus aureus subsp} PDB: 2ola_A 3h70_A Length = 342 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query133
3otr_A452 Enolase; structural genomics, center for structura 100.0
3qtp_A441 Enolase 1; glycolysis, lyase; HET: 2PG; 1.90A {Ent 100.0
3tqp_A428 Enolase; energy metabolism, lyase; 2.20A {Coxiella 100.0
2al1_A436 Enolase 1, 2-phospho-D-; beta barrel, lyase; HET: 100.0
3qn3_A417 Enolase; structural genomics, center for structura 100.0
2akz_A439 Gamma enolase, neural; fluoride inhibition, negati 100.0
3uj2_A449 Enolase 1; enzyme function initiative, EFI, lyase; 100.0
2ptz_A432 Enolase; lyase, glycolysis,His-TAG; 1.65A {Trypano 100.0
2fym_A431 Enolase; RNA degradosome, enolase, lyase; 1.60A {E 100.0
1w6t_A444 Enolase; bacterial infection, surface protein, moo 99.98
2pa6_A427 Enolase; glycolysis, lyase, magnesium, metal-bindi 99.97
1kko_A413 3-methylaspartate ammonia-lyase; enolase superfami 99.86
1kcz_A413 Beta-methylaspartase; beta zigzag, alpha/beta-barr 99.85
2pge_A377 MENC; OSBS, NYSGXRC, PSI-II, structural genomics, 98.91
3p3b_A392 Mandelate racemase/muconate lactonizing protein; e 98.73
2hzg_A401 Mandelate racemase/muconate lactonizing enzyme/EN 98.69
3bjs_A428 Mandelate racemase/muconate lactonizing enzyme; en 98.67
1rvk_A382 Isomerase/lactonizing enzyme; enolase superfamily, 98.63
2p8b_A369 Mandelate racemase/muconate lactonizing enzyme fam 98.59
2pp0_A398 L-talarate/galactarate dehydratase; enolase superf 98.58
1tkk_A366 Similar to chloromuconate cycloisomerase; epimeras 98.55
2gdq_A382 YITF; mandelate racemase/muconate lactonizing enzy 98.54
2p3z_A415 L-rhamnonate dehydratase; enolase, structural geno 98.53
2ps2_A371 Putative mandelate racemase/muconate lactonizing e 98.49
1sjd_A368 N-acylamino acid racemase; lyase, isomerase; HET: 98.49
1r0m_A375 N-acylamino acid racemase; isomerase; 1.30A {Deino 98.49
2ox4_A403 Putative mandelate racemase; enolase, dehydratase, 98.48
2zc8_A369 N-acylamino acid racemase; octamer, TIM beta/alpha 98.43
2poz_A392 Putative dehydratase; octamer, structural genomics 98.41
1nu5_A370 Chloromuconate cycloisomerase; enzyme, dehalogenat 98.4
2qq6_A410 Mandelate racemase/muconate lactonizing enzyme- li 98.4
2rdx_A379 Mandelate racemase/muconate lactonizing enzyme, P; 98.4
1mdl_A359 Mandelate racemase; isomerase, mandelate pathway, 98.35
2nql_A388 AGR_PAT_674P, isomerase/lactonizing enzyme; enolas 98.31
2qdd_A378 Mandelate racemase/muconate lactonizing enzyme; en 98.31
2o56_A407 Putative mandelate racemase; dehydratase, structur 98.27
2zad_A345 Muconate cycloisomerase; muconate lactonizing enzy 98.25
2gl5_A410 Putative dehydratase protein; structural genomics, 98.23
2og9_A393 Mandelate racemase/muconate lactonizing enzyme; NY 98.23
2pgw_A384 Muconate cycloisomerase; enolase superfamily, octa 98.22
3cyj_A372 Mandelate racemase/muconate lactonizing enzyme-LI 98.22
1wue_A386 Mandelate racemase/muconate lactonizing enzyme FA 98.22
1wuf_A393 Hypothetical protein LIN2664; structural genomics, 98.19
2ovl_A371 Putative racemase; structural genomics, PSI-2, pro 98.13
3jva_A354 Dipeptide epimerase; enolase superfamily, isomeras 98.11
2qgy_A391 Enolase from the environmental genome shotgun sequ 98.03
2hxt_A441 L-fuconate dehydratase; enolase superfamily, D-ery 97.94
2qde_A397 Mandelate racemase/muconate lactonizing enzyme FA 97.91
1tzz_A392 Hypothetical protein L1841; structural genomics, m 97.86
2oz8_A389 MLL7089 protein; structural genomics, unknown func 97.81
2ozt_A332 TLR1174 protein; structural genomics, O-succinylbe 97.79
1jpd_X324 L-Ala-D/L-Glu epimerase; enolase superfamily, muco 97.78
1r6w_A322 OSB synthase, O-succinylbenzoate synthase, OSBS; e 97.74
4hnl_A421 Mandelate racemase/muconate lactonizing enzyme; de 97.58
4dye_A398 Isomerase; enolase family protein, EFI, enzym func 97.4
3q45_A368 Mandelate racemase/muconate lactonizing enzyme FA 97.13
3i4k_A383 Muconate lactonizing enzyme; structural genomics, 97.11
3qld_A388 Mandelate racemase/muconate lactonizing protein; s 97.07
3dgb_A382 Muconate cycloisomerase; muconate lactonizing enzy 97.06
3i6e_A385 Muconate cycloisomerase I; structural genomics, NY 97.05
1chr_A370 Chloromuconate cycloisomerase; 3.00A {Ralstonia eu 97.04
3ro6_B356 Putative chloromuconate cycloisomerase; TIM barrel 96.95
3fcp_A381 L-Ala-D/L-Glu epimerase, A muconate lactonizing en 96.94
3my9_A377 Muconate cycloisomerase; structural genomics, PSI- 96.94
3fv9_G386 Mandelate racemase/muconate lactonizing enzyme; st 96.9
3ik4_A365 Mandelate racemase/muconate lactonizing protein; s 96.87
3gd6_A391 Muconate cycloisomerase; structural genomics, NYSG 96.85
3mwc_A400 Mandelate racemase/muconate lactonizing protein; e 96.84
3dip_A410 Enolase; structural genomics, isomerase, PSI-2, pr 96.82
2okt_A342 OSB synthetase, O-succinylbenzoic acid synthetase; 96.79
3ozy_A389 Putative mandelate racemase; beta-alpha barrel, en 96.78
3eez_A378 Putative mandelate racemase/muconate lactonizing e 96.74
3go2_A409 Putative L-alanine-DL-glutamate epimerase; structu 96.73
3ekg_A404 Mandelate racemase/muconate lactonizing enzyme; st 96.71
3tj4_A372 Mandelate racemase; enolase, dehydratase, enzyme f 96.61
3ddm_A392 Putative mandelate racemase/muconate lactonizing e 96.61
3r4e_A418 Mandelate racemase/muconate lactonizing enzyme; en 96.55
4e4f_A426 Mannonate dehydratase; magnesium binding, enzyme f 96.54
3v3w_A424 Starvation sensing protein RSPA; enolase, enzyme f 96.51
3sjn_A374 Mandelate racemase/muconate lactonizing protein; e 96.51
3s5s_A389 Mandelate racemase/muconate lactonizing enzyme FA 96.47
3sbf_A401 Mandelate racemase / muconate lactonizing enzyme; 96.41
4e8g_A391 Enolase, mandelate racemase/muconate lactonizing e 96.39
4dxk_A400 Mandelate racemase / muconate lactonizing enzyme p 96.39
3rr1_A405 GALD, putative D-galactonate dehydratase; enolase, 96.38
3mqt_A394 Mandelate racemase/muconate lactonizing protein; P 96.38
3stp_A412 Galactonate dehydratase, putative; PSI biology, st 96.35
3mkc_A394 Racemase; metabolic process, PSI2, NYSGXRC, struct 96.32
3r0u_A379 Enzyme of enolase superfamily; structural genomics 96.31
3toy_A383 Mandelate racemase/muconate lactonizing enzyme FA 96.29
4dwd_A393 Mandelate racemase/muconate lactonizing enzyme, C 96.25
3t6c_A440 RSPA, putative MAND family dehydratase; enolase, m 96.24
3tcs_A388 Racemase, putative; PSI-biology, nysgrc, structura 96.22
3vcn_A425 Mannonate dehydratase; enolase, magnesium binding 96.22
3u9i_A393 Mandelate racemase/muconate lactonizing enzyme, C 96.2
4e5t_A404 Mandelate racemase / muconate lactonizing enzyme, 96.19
3vdg_A445 Probable glucarate dehydratase; enolase, magnesium 96.14
4e4u_A412 Mandalate racemase/muconate lactonizing enzyme; ma 96.14
3va8_A445 Probable dehydratase; enolase, magnesium binding s 96.14
3tji_A422 Mandelate racemase/muconate lactonizing enzyme, N 95.99
3dg3_A367 Muconate cycloisomerase; muconate lactonizing enzy 95.9
4a35_A441 Mitochondrial enolase superfamily member 1; isomer 95.88
3rcy_A433 Mandelate racemase/muconate lactonizing enzyme-LI 95.88
3ugv_A390 Enolase; enzyme function initiative, EFI, lyase; 2 95.87
3vc5_A441 Mandelate racemase/muconate lactonizing protein; d 95.85
3mzn_A450 Glucarate dehydratase; lyase, structural genomics, 95.84
2chr_A370 Chloromuconate cycloisomerase; 3.00A {Cupriavidus 95.4
3pfr_A455 Mandelate racemase/muconate lactonizing protein; e 95.32
3v5c_A392 Mandelate racemase/muconate lactonizing protein; e 95.2
3p0w_A470 Mandelate racemase/muconate lactonizing protein; s 95.19
4hpn_A378 Putative uncharacterized protein; enolase, enzyme 95.18
3ijl_A338 Muconate cycloisomerase; enolase superfamily, dipe 94.99
3fxg_A455 Rhamnonate dehydratase; structural gemomics, enola 94.79
2opj_A327 O-succinylbenzoate-COA synthase; TIM barrel, struc 93.71
4gfi_A329 Mandelate racemase/muconate lactonizing enzyme FA 92.91
4h83_A388 Mandelate racemase/muconate lactonizing enzyme; st 92.3
4h2h_A376 Mandelate racemase/muconate lactonizing enzyme; en 92.28
4h1z_A412 Enolase Q92ZS5; dehydratase, magnesium binding sit 91.79
3caw_A330 O-succinylbenzoate synthase; structural genomics, 81.65
4g8t_A464 Glucarate dehydratase; enolase, enzyme function IN 80.75
>3otr_A Enolase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta barrel, TIM barrel; 2.75A {Toxoplasma gondii} Back     alignment and structure
Probab=100.00  E-value=5e-52  Score=360.18  Aligned_cols=131  Identities=64%  Similarity=1.028  Sum_probs=127.8

Q ss_pred             chhhhhhcCCCeEEecCcccccCHHHHHHHHhhcccccceehccccccHHHHHHHHHHHHHCCCcEEeecCCCCCCchhH
Q psy12654          3 LFQLNDFAPEPIQIVGDDLTVTNPKRIATAVEKKACNCLLLKVNQIGSVTESIQAHLLAKQNGWGTMVSHRSGETEDNFI   82 (133)
Q Consensus         3 ~~~~~~~~~~~iqivGDDl~vTn~~ri~~~i~~~~~na~llK~nQigTvTe~lea~~~a~~~g~~~vvS~rsGETeD~~i   82 (133)
                      +.+|++.++.+|||||||+|||||+++++++++++||+++|||||+||+||+++++++|+++||.+|+|||||||+|+||
T Consensus       314 ~a~Lt~~lg~~iqIvGDDl~vTn~~~i~~~Ie~~a~n~IlIKvnQIGgITEalka~~lA~~~G~~vmvshrSGETeD~~i  393 (452)
T 3otr_A          314 FSAFTKDVGEKTQVIGDDILVTNILRIEKALKDKACNCLLLKVNQIGSVTEAIEACLLAQKSGWGVQVSHRSGETEDSFI  393 (452)
T ss_dssp             HHHHHHHHTTTSEEEESTTTTTCHHHHHHHHHHTCCSEEEECHHHHCCHHHHHHHHHHHHHTTCEEEEECCSSCCSCCHH
T ss_pred             HHHHHHhhCCCeEEEeCccccCCHHHHHHHHhcCCCCEEEeeccccccHHHHHHHHHHHHHcCCeEEEeCCCCCCchhHH
Confidence            35788888899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhhhhhccCceecCCCCchhHHHHHHHHHHHHHHhCCcccccCccCCCCC
Q psy12654         83 ADLVVGLSTGQIKTGAPCRSERLAKYNQILRIEEELGANAKFAGKNFRRPV  133 (133)
Q Consensus        83 adLAVgl~a~~iK~G~p~r~Er~aKyN~LLrIeeelg~~~~~~g~~~~~~~  133 (133)
                      ||||||++++|||+|+|||+||++|||||||||||||++++|+|++||+|+
T Consensus       394 AdLaVgl~~gqIKtGap~rsER~aKyNqLlrIeeelg~~a~~~g~~~~~~~  444 (452)
T 3otr_A          394 ADLVVGLRCGQIKSGSPCRSERLCKYNQLMRIEESLGADCVYAGESFRHPK  444 (452)
T ss_dssp             HHHHHHTTCCEEECCCSCSHHHHHHHHHHHHHHHHHGGGEEECGGGTTSCC
T ss_pred             HHHHHHcCCCccccCCCcchhHHHHHHHHHHHHHHhCccceecccccCCCc
Confidence            999999999999999999999999999999999999999999999999995
>3qtp_A Enolase 1; glycolysis, lyase; HET: 2PG; 1.90A {Entamoeba histolytica} Back     alignment and structure
>3tqp_A Enolase; energy metabolism, lyase; 2.20A {Coxiella burnetii} Back     alignment and structure
>2al1_A Enolase 1, 2-phospho-D-; beta barrel, lyase; HET: PEP 2PG; 1.50A {Saccharomyces cerevisiae} SCOP: c.1.11.1 d.54.1.1 PDB: 1ebg_A 1ebh_A* 1one_A* 2one_A* 1p48_A* 1p43_A* 1l8p_A 4enl_A 1nel_A 1els_A 3enl_A 5enl_A* 6enl_A 7enl_A* 2al2_A* 2al2_B* 2xh7_A* 2xgz_A* 2xh2_A* 2xh4_A* ... Back     alignment and structure
>3qn3_A Enolase; structural genomics, center for structural genomics of infec diseases, csgid, glycolysis, lyase; 2.13A {Campylobacter jejuni} Back     alignment and structure
>2akz_A Gamma enolase, neural; fluoride inhibition, negative cooperativity, glycolysis, , isothermal titration calorimetry, lyase; 1.36A {Homo sapiens} SCOP: c.1.11.1 d.54.1.1 PDB: 2akm_A 1te6_A 2psn_A 3b97_A 2xsx_A 1pdz_A 1pdy_A Back     alignment and structure
>3uj2_A Enolase 1; enzyme function initiative, EFI, lyase; 2.00A {Anaerostipes caccae} Back     alignment and structure
>2ptz_A Enolase; lyase, glycolysis,His-TAG; 1.65A {Trypanosoma brucei} SCOP: c.1.11.1 d.54.1.1 PDB: 2ptx_A 2pty_A* 2ptw_A 2pu0_A 2pu1_A* 1oep_A Back     alignment and structure
>2fym_A Enolase; RNA degradosome, enolase, lyase; 1.60A {Escherichia coli} SCOP: c.1.11.1 d.54.1.1 PDB: 1e9i_A 3h8a_A Back     alignment and structure
>1w6t_A Enolase; bacterial infection, surface protein, moonlighting protein, glycolysis, phosphopyruvate hydratase, lyase; HET: 2PE; 2.10A {Streptococcus pneumoniae} SCOP: c.1.11.1 d.54.1.1 PDB: 1iyx_A Back     alignment and structure
>2pa6_A Enolase; glycolysis, lyase, magnesium, metal-binding, structural GENO NPPSFA; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>1kko_A 3-methylaspartate ammonia-lyase; enolase superfamily, TIM barrel; 1.33A {Citrobacter amalonaticus} SCOP: c.1.11.2 d.54.1.1 PDB: 1kkr_A* Back     alignment and structure
>1kcz_A Beta-methylaspartase; beta zigzag, alpha/beta-barrel, lyase; 1.90A {Clostridium tetanomorphum} SCOP: c.1.11.2 d.54.1.1 PDB: 1kd0_A* 3zvi_A 3zvh_A Back     alignment and structure
>2pge_A MENC; OSBS, NYSGXRC, PSI-II, structural genomics, protein structure initiative; 1.60A {Desulfotalea psychrophila LSV54} Back     alignment and structure
>3p3b_A Mandelate racemase/muconate lactonizing protein; enolase superfamily fold, galacturonate dehydratase, D-tartr galacturonate, lyase; HET: TAR; 1.65A {Geobacillus SP} PDB: 3ops_A* 3n4f_A* 3qpe_A* Back     alignment and structure
>2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} Back     alignment and structure
>3bjs_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI-2, protein struc initiative; 2.70A {Polaromonas SP} Back     alignment and structure
>1rvk_A Isomerase/lactonizing enzyme; enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, structural genomics, PSI; 1.70A {Agrobacterium tumefaciens} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* Back     alignment and structure
>2pp0_A L-talarate/galactarate dehydratase; enolase superfamily, LYA; 2.20A {Salmonella typhimurium} PDB: 2pp1_A* 2pp3_A* Back     alignment and structure
>1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A Back     alignment and structure
>2gdq_A YITF; mandelate racemase/muconate lactonizing enzyme, TIM-barrel, octamer, structural genomics, PSI; 1.80A {Bacillus subtilis subsp} SCOP: c.1.11.2 d.54.1.1 PDB: 2gge_A Back     alignment and structure
>2p3z_A L-rhamnonate dehydratase; enolase, structural genomics, PSI, protein structure initiat YORK structural genomics research consortium; 1.80A {Salmonella typhimurium LT2} PDB: 3box_A 3cxo_A* 2gsh_A 3d47_A 3d46_A 2i5q_A Back     alignment and structure
>2ps2_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9440A, enolase superfamily, PSI-2; 1.80A {Aspergillus oryzae RIB40} Back     alignment and structure
>1sjd_A N-acylamino acid racemase; lyase, isomerase; HET: NPG; 1.87A {Amycolatopsis SP} SCOP: c.1.11.2 d.54.1.1 PDB: 1sja_A* 1sjb_A* 1sjc_A* Back     alignment and structure
>1r0m_A N-acylamino acid racemase; isomerase; 1.30A {Deinococcus radiodurans} SCOP: c.1.11.2 d.54.1.1 PDB: 1xpy_A* 1xs2_A 2ggj_A 2ggi_A 2ggh_A* 2ggg_A* 2fkp_A Back     alignment and structure
>2ox4_A Putative mandelate racemase; enolase, dehydratase, structural genomics, protein structure initiative, PSI, nysgrc; 1.80A {Zymomonas mobilis} Back     alignment and structure
>2zc8_A N-acylamino acid racemase; octamer, TIM beta/alpha-barrel, metal-binding, metal binding; 1.95A {Thermus thermophilus} Back     alignment and structure
>2poz_A Putative dehydratase; octamer, structural genomics, P protein structure initiative, NEW YORK SGX research center structural genomics, nysgxrc; 2.04A {Mesorhizobium loti} Back     alignment and structure
>1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>2qq6_A Mandelate racemase/muconate lactonizing enzyme- like protein; enolase, Mg ION, PSI-2, NYSGXRC, structural genomics; 2.90A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Back     alignment and structure
>1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A Back     alignment and structure
>2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A Back     alignment and structure
>2qdd_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.30A {Roseovarius nubinhibens} PDB: 3fvd_B Back     alignment and structure
>2o56_A Putative mandelate racemase; dehydratase, structural genomics, protein structure initiati 2; 2.00A {Salmonella typhimurium} Back     alignment and structure
>2zad_A Muconate cycloisomerase; muconate lactonizing enzyme (MLE), TM0006, struct genomics, NPPSFA; HET: 1PE; 1.60A {Thermotoga maritima} PDB: 3deq_A 3der_A* 3des_A* 3dfy_A Back     alignment and structure
>2gl5_A Putative dehydratase protein; structural genomics, protein structure initiati nysgxrc; 1.60A {Salmonella typhimurium} SCOP: c.1.11.2 d.54.1.1 PDB: 4e6m_A* Back     alignment and structure
>2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>3cyj_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, isomerase, PSI-2; 2.30A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>1wue_A Mandelate racemase/muconate lactonizing enzyme FA protein; structural genomics, unknown function, nysgxrc target T2185; 2.10A {Enterococcus faecalis} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>1wuf_A Hypothetical protein LIN2664; structural genomics, unknown function, nysgxrc target T2186, superfamily, protein structure initiative, PSI; 2.90A {Listeria innocua} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A Back     alignment and structure
>3jva_A Dipeptide epimerase; enolase superfamily, isomerase; 1.70A {Enterococcus faecalis V583} PDB: 3jw7_A* 3jzu_A* 3k1g_A* 3kum_A* Back     alignment and structure
>2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} Back     alignment and structure
>2hxt_A L-fuconate dehydratase; enolase superfamily, D-erythromohydr unknown function; HET: EHM; 1.70A {Xanthomonas campestris PV} PDB: 1yey_A 2hxu_A* 2hne_A Back     alignment and structure
>2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} Back     alignment and structure
>1tzz_A Hypothetical protein L1841; structural genomics, mandelate racemase like fold, nysgxrc target T1523, PSI, protein structure initiative; 1.86A {Bradyrhizobium japonicum} SCOP: c.1.11.2 d.54.1.1 PDB: 2dw7_A* 2dw6_A* Back     alignment and structure
>2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} Back     alignment and structure
>2ozt_A TLR1174 protein; structural genomics, O-succinylbenzoate synthase, PSI, protein structure initiative; 1.42A {Synechococcus elongatus} PDB: 3h7v_A Back     alignment and structure
>1jpd_X L-Ala-D/L-Glu epimerase; enolase superfamily, muconate lactonizing enzyme subgroup, alpha/beta barrel, structural genomics, isomerase; 2.60A {Escherichia coli} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>1r6w_A OSB synthase, O-succinylbenzoate synthase, OSBS; enolase superfamily, TIM barrel, capping alpha+beta domain, lyase; HET: 164; 1.62A {Escherichia coli} SCOP: c.1.11.2 d.54.1.1 PDB: 1fhv_A* 1fhu_A 2ofj_A 3gc2_A* Back     alignment and structure
>4hnl_A Mandelate racemase/muconate lactonizing enzyme; dehydratase, magnesium binding, enzyme function initiative,; 1.48A {Enterococcus gallinarum EG2} PDB: 3s47_A Back     alignment and structure
>4dye_A Isomerase; enolase family protein, EFI, enzym function initiative; 1.60A {Streptomyces coelicolor} PDB: 2oqh_A Back     alignment and structure
>3q45_A Mandelate racemase/muconate lactonizing enzyme FA possible chloromuconate cycloisomerase...; (beta/alpha)8-barrel; 3.00A {Cytophaga hutchinsonii} PDB: 3q4d_A Back     alignment and structure
>3i4k_A Muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9450D, isomerase, PSI-2, protein structure initiative; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3qld_A Mandelate racemase/muconate lactonizing protein; structural genomics, PSI-2, isomerase; HET: MSE; 1.85A {Alicyclobacillus acidocaldarius LAA1} Back     alignment and structure
>3dgb_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding, isomeras structural genomics, PSI-2; HET: MUC; 1.70A {Pseudomonas fluorescens} PDB: 3ct2_A* 3fj4_A* 1muc_A 1bkh_A 3muc_A 2muc_A 1f9c_A Back     alignment and structure
>3i6e_A Muconate cycloisomerase I; structural genomics, NYSGXRC, targer 9468A, muconate lactonizing enzyme, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} PDB: 3i6t_A Back     alignment and structure
>1chr_A Chloromuconate cycloisomerase; 3.00A {Ralstonia eutropha} PDB: 2chr_A Back     alignment and structure
>3ro6_B Putative chloromuconate cycloisomerase; TIM barrel; 2.20A {Methylococcus capsulatus} PDB: 3rit_A Back     alignment and structure
>3fcp_A L-Ala-D/L-Glu epimerase, A muconate lactonizing enzyme; structural genomics, nysgrc,target 9450E, PSI-2; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3my9_A Muconate cycloisomerase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics, nysgx; 2.20A {Azorhizobium caulinodans} Back     alignment and structure
>3fv9_G Mandelate racemase/muconate lactonizing enzyme; structural genomics, mandelate racemase/muconatelactonizing hydrolase, PSI-2; 1.90A {Roseovarius nubinhibens ism} PDB: 2pce_A Back     alignment and structure
>3ik4_A Mandelate racemase/muconate lactonizing protein; structural genomics, enolase, epimerase, PSI-2, protein STRU initiative; 2.10A {Herpetosiphon aurantiacus atcc 23779} Back     alignment and structure
>3gd6_A Muconate cycloisomerase; structural genomics, NYSGXRC, target 9375A, divergent enolase, lyase, PSI-2; 1.60A {Oceanobacillus iheyensis HTE831} PDB: 2oqy_A 3es8_A 3es7_A 3fyy_A 3hpf_A* Back     alignment and structure
>3mwc_A Mandelate racemase/muconate lactonizing protein; enolase, structural genomics, protein structure initiative, nysgrc; 1.80A {Kosmotoga olearia} Back     alignment and structure
>3dip_A Enolase; structural genomics, isomerase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, NYSGXRC, lyase; HET: SIC; 2.50A {Unidentified} Back     alignment and structure
>2okt_A OSB synthetase, O-succinylbenzoic acid synthetase; enolase, structural genom protein structure initiative, PSI, nysgrc; 1.30A {Staphylococcus aureus subsp} PDB: 2ola_A 3h70_A Back     alignment and structure
>3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* Back     alignment and structure
>3eez_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, unknown function, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} Back     alignment and structure
>3go2_A Putative L-alanine-DL-glutamate epimerase; structural genomics, isomerase, PSI-2; 1.70A {Burkholderia xenovorans} PDB: 2oo6_A 3sn0_A 3sn1_A* 3sn4_A* Back     alignment and structure
>3ekg_A Mandelate racemase/muconate lactonizing enzyme; structural genomics, nysgrc, L-rhamnonate dehydratase,target PSI-2; HET: TLA; 1.60A {Azotobacter vinelandii avop} PDB: 2oz3_A* Back     alignment and structure
>3tj4_A Mandelate racemase; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.50A {Agrobacterium tumefaciens} PDB: 4h19_A* Back     alignment and structure
>3ddm_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9284B, enolase family, PSI-2; 2.60A {Bordetella bronchiseptica} Back     alignment and structure
>3r4e_A Mandelate racemase/muconate lactonizing enzyme; enolase fold, mannonate dehydratase, D-mannonate, lyase; HET: CS2; 1.65A {Novosphingobium aromaticivorans} PDB: 2qjj_A 2qjn_A* 2qjm_A* Back     alignment and structure
>4e4f_A Mannonate dehydratase; magnesium binding, enzyme function initiative, isomerase; 2.00A {Pectobacterium carotovorum subsp} Back     alignment and structure
>3v3w_A Starvation sensing protein RSPA; enolase, enzyme function initiative, EFI, lyase; HET: NHE; 1.40A {Cellvibrio japonicus} PDB: 3v4b_A* 4f4r_A 3qkf_A* 3qke_A* 3p93_A* 3ow1_A 3pk7_A* 3rgt_A* 3bsm_A Back     alignment and structure
>3sjn_A Mandelate racemase/muconate lactonizing protein; enolase, magnesium binding site, lyase; 1.90A {Shewanella pealeana} Back     alignment and structure
>3s5s_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-biology, structural genomics, NEW YORK structural genomi research consortium; 2.40A {Sorangium cellulosum} Back     alignment and structure
>3sbf_A Mandelate racemase / muconate lactonizing enzyme; enolase fold, acid sugar dehydratase, D-araninonate, isomera; HET: EPE D8T; 1.50A {Vibrionales bacterium swat-3} PDB: 3r25_A 3dfh_A 4gis_A 4gir_A 4ggh_A 3gy1_A Back     alignment and structure
>4e8g_A Enolase, mandelate racemase/muconate lactonizing enzyme, N domain protein; putative racemase, nysgrc, structural genomics, PSI-biology; 2.00A {Paracoccus denitrificans} Back     alignment and structure
>4dxk_A Mandelate racemase / muconate lactonizing enzyme protein; enolase, mandelate racemase subgroup, enzyme function initia EFI; 1.25A {Agrobacterium tumefaciens} PDB: 4dx3_A 2pod_A Back     alignment and structure
>3rr1_A GALD, putative D-galactonate dehydratase; enolase, magnesium binding site, lyase; 1.95A {Ralstonia pickettii} PDB: 3rra_A Back     alignment and structure
>3mqt_A Mandelate racemase/muconate lactonizing protein; PSI-II, NYSGXRC, muconate lactonizing EN structural genomics, protein structure initiative; 2.10A {Shewanella pealeana} Back     alignment and structure
>3stp_A Galactonate dehydratase, putative; PSI biology, structural genomics, NEW YORK structural genomi research consortium; 1.88A {Labrenzia aggregata iam 12614} PDB: 3sqs_A 3ssz_A Back     alignment and structure
>3mkc_A Racemase; metabolic process, PSI2, NYSGXRC, structu genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.77A {Pseudovibrio SP} PDB: 3nzg_A Back     alignment and structure
>3r0u_A Enzyme of enolase superfamily; structural genomics, putative epimerase, PSI-biolog YORK structural genomics research consortium; HET: MSE TAR; 1.90A {Francisella philomiragia subsp} PDB: 3px5_A* 3r0k_A* 3r10_A 3r11_A 3r1z_A* Back     alignment and structure
>3toy_A Mandelate racemase/muconate lactonizing enzyme FA protein; enolase, magnesium binding site, lyase; HET: P4C; 1.80A {Bradyrhizobium SP} PDB: 3tte_A* Back     alignment and structure
>4dwd_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, EFI, enzyme function initiative, metal protein; HET: MSE; 1.50A {Paracoccus denitrificans} PDB: 3n4e_A* Back     alignment and structure
>3t6c_A RSPA, putative MAND family dehydratase; enolase, mannonate dehydratase related protein, enzyme funct intitiative, lyase, hydro-lyases; HET: GCO; 1.60A {Pantoea ananatis} PDB: 3tw9_A 3twa_A 3twb_A* Back     alignment and structure
>3tcs_A Racemase, putative; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, TIM barrel; HET: PG4; 1.88A {Roseobacter denitrificans} PDB: 3u4f_A 3t9p_A 3t8q_A Back     alignment and structure
>3vcn_A Mannonate dehydratase; enolase, magnesium binding site, enzyme function initiative, lyase; 1.45A {Caulobacter crescentus} PDB: 4gme_A* 4fi4_A 3thu_A Back     alignment and structure
>3u9i_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, PSI-biology; 2.90A {Roseiflexus SP} Back     alignment and structure
>4e5t_A Mandelate racemase / muconate lactonizing enzyme, terminal domain protein; aldolase, structural genomics, biology; 2.90A {Labrenzia alexandrii} Back     alignment and structure
>3vdg_A Probable glucarate dehydratase; enolase, magnesium binding site, lyase; 1.90A {Mycobacterium smegmatis str} PDB: 3vfc_A* Back     alignment and structure
>4e4u_A Mandalate racemase/muconate lactonizing enzyme; mandelate racemase, aldolase, structural genomics, biology; 1.35A {Unidentified} Back     alignment and structure
>3va8_A Probable dehydratase; enolase, magnesium binding site, lyase; 2.00A {Gibberella zeae} Back     alignment and structure
>3tji_A Mandelate racemase/muconate lactonizing enzyme, N domain protein; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.80A {Enterobacter SP} Back     alignment and structure
>3dg3_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding; 1.60A {Mycobacterium smegmatis} PDB: 3dg6_A* 3dg7_A* Back     alignment and structure
>4a35_A Mitochondrial enolase superfamily member 1; isomerase; 1.74A {Homo sapiens} Back     alignment and structure
>3rcy_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, protein structure initiative; HET: RIB; 1.99A {Roseovarius SP} PDB: 3t4w_A Back     alignment and structure
>3ugv_A Enolase; enzyme function initiative, EFI, lyase; 2.30A {Alpha proteobacterium BAL199} Back     alignment and structure
>3vc5_A Mandelate racemase/muconate lactonizing protein; dehydratase, magnesium binding, enzyme function initiative, enolase, isomerase; 1.50A {Thermobispora bispora} PDB: 3vc6_A 4dhg_A Back     alignment and structure
>3mzn_A Glucarate dehydratase; lyase, structural genomics, protein structure initiative, PS nysgrc; 1.85A {Chromohalobacter salexigens} PDB: 3nfu_A Back     alignment and structure
>2chr_A Chloromuconate cycloisomerase; 3.00A {Cupriavidus necator} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3pfr_A Mandelate racemase/muconate lactonizing protein; emolase superfamily fold, D-glucarate dehydratase, D-glucara isomerase; HET: GKR; 1.90A {Actinobacillus succinogenes} PDB: 3n6j_A 3n6h_A* 4gyp_C* Back     alignment and structure
>3v5c_A Mandelate racemase/muconate lactonizing protein; enolase fold, galacturonate dehydratase, double Mg site, LYA; 1.53A {Paenibacillus SP} PDB: 3v5f_A* 3p3b_A* 3ops_A* 3n4f_A* 3qpe_A* Back     alignment and structure
>3p0w_A Mandelate racemase/muconate lactonizing protein; structural genomics, PSI-2, protein structure initiative; HET: GKR; 1.71A {Ralstonia pickettii} PDB: 4hn8_A 3nxl_A Back     alignment and structure
>4hpn_A Putative uncharacterized protein; enolase, enzyme function initiative, EFI, structural genomic isomerase; 1.60A {Agrobacterium tumefaciens} PDB: 4ggb_A Back     alignment and structure
>3ijl_A Muconate cycloisomerase; enolase superfamily, dipeptide epimerase, L-Pro-D-Glu, nonpr binding; HET: DGL; 1.50A {Bacteroides thetaiotaomicron} PDB: 3iji_A* 3ijq_A* Back     alignment and structure
>3fxg_A Rhamnonate dehydratase; structural gemomics, enolase superfamily, NYSGXRC, target 9265J, lyase, structural genomics, PSI-2; 1.90A {Gibberella zeae ph-1} PDB: 2p0i_A Back     alignment and structure
>2opj_A O-succinylbenzoate-COA synthase; TIM barrel, structural genomics, protein structure initiative; 1.60A {Thermobifida fusca} PDB: 2qvh_A* Back     alignment and structure
>4gfi_A Mandelate racemase/muconate lactonizing enzyme FA protein; putative L-Ala-L/D-Glu epimerase; HET: GLU; 1.90A {Agrobacterium tumefaciens} Back     alignment and structure
>4h83_A Mandelate racemase/muconate lactonizing enzyme; structural genomics, enzyme function initiative; 2.09A {Marine actinobacterium PHSC20C1} PDB: 3no1_A 3msy_A Back     alignment and structure
>4h2h_A Mandelate racemase/muconate lactonizing enzyme; enolase, mandelate racemase subgroup, enzyme function initia EFI, structural genomics; HET: 0XW; 1.70A {Pelagibaca bermudensis} PDB: 2pmq_A* Back     alignment and structure
>4h1z_A Enolase Q92ZS5; dehydratase, magnesium binding site, enzyme function initiat isomerase; 2.01A {Sinorhizobium meliloti} PDB: 2ppg_A Back     alignment and structure
>3caw_A O-succinylbenzoate synthase; structural genomics, PSI-2, NYSGXRC, target 9462A, protein structure initiative; 1.87A {Bdellovibrio bacteriovorus HD100} Back     alignment and structure
>4g8t_A Glucarate dehydratase; enolase, enzyme function INI EFI, structural genomics, lyase; 1.70A {Actinobacillus succinogenes} PDB: 1ec7_A 1ec8_A* 1ec9_A* 1ecq_A* 1jdf_A* 3pwi_A* 1jct_A* 3pwg_A* 1bqg_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 133
d2akza1294 c.1.11.1 (A:140-433) Enolase {Human (Homo sapiens) 6e-62
d1w6ta1296 c.1.11.1 (A:138-433) Enolase {Streptococcus pneumo 6e-60
d2ptza1291 c.1.11.1 (A:139-429) Enolase {Trypanosoma brucei [ 1e-59
d2al1a1295 c.1.11.1 (A:142-436) Enolase {Baker's yeast (Sacch 3e-56
d2fyma1292 c.1.11.1 (A:140-431) Enolase {Escherichia coli [Ta 1e-55
d1kkoa1251 c.1.11.2 (A:161-411) beta-Methylaspartase {Citroba 6e-42
d1kcza1253 c.1.11.2 (A:161-413) beta-Methylaspartase {Clostri 2e-39
>d2akza1 c.1.11.1 (A:140-433) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Length = 294 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Enolase C-terminal domain-like
family: Enolase
domain: Enolase
species: Human (Homo sapiens), gamma isoform [TaxId: 9606]

 Score =  189 bits (481), Expect = 6e-62
 Identities = 101/119 (84%), Positives = 108/119 (90%)

Query: 14  IQIVGDDLTVTNPKRIATAVEKKACNCLLLKVNQIGSVTESIQAHLLAKQNGWGTMVSHR 73
           IQIVGDDLTVTNPKRI  AVE+KACNCLLLKVNQIGSVTE+IQA  LA++NGWG MVSHR
Sbjct: 173 IQIVGDDLTVTNPKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKLAQENGWGVMVSHR 232

Query: 74  SGETEDNFIADLVVGLSTGQIKTGAPCRSERLAKYNQILRIEEELGANAKFAGKNFRRP 132
           SGETED FIADLVVGL TGQIKTGAPCRSERLAKYNQ++RIEEELG  A+FAG NFR P
Sbjct: 233 SGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDEARFAGHNFRNP 291
>d1w6ta1 c.1.11.1 (A:138-433) Enolase {Streptococcus pneumoniae [TaxId: 1313]} Length = 296 Back     information, alignment and structure
>d2ptza1 c.1.11.1 (A:139-429) Enolase {Trypanosoma brucei [TaxId: 5691]} Length = 291 Back     information, alignment and structure
>d2al1a1 c.1.11.1 (A:142-436) Enolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 295 Back     information, alignment and structure
>d2fyma1 c.1.11.1 (A:140-431) Enolase {Escherichia coli [TaxId: 562]} Length = 292 Back     information, alignment and structure
>d1kkoa1 c.1.11.2 (A:161-411) beta-Methylaspartase {Citrobacter amalonaticus [TaxId: 35703]} Length = 251 Back     information, alignment and structure
>d1kcza1 c.1.11.2 (A:161-413) beta-Methylaspartase {Clostridium tetanomorphum [TaxId: 1553]} Length = 253 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query133
d2ptza1291 Enolase {Trypanosoma brucei [TaxId: 5691]} 100.0
d1w6ta1296 Enolase {Streptococcus pneumoniae [TaxId: 1313]} 100.0
d2akza1294 Enolase {Human (Homo sapiens), gamma isoform [TaxI 100.0
d2fyma1292 Enolase {Escherichia coli [TaxId: 562]} 100.0
d2al1a1295 Enolase {Baker's yeast (Saccharomyces cerevisiae) 100.0
d1kcza1253 beta-Methylaspartase {Clostridium tetanomorphum [T 99.95
d1kkoa1251 beta-Methylaspartase {Citrobacter amalonaticus [Ta 99.94
d1wufa1244 N-acylamino acid racemase {Listeria innocua [TaxId 97.61
d1wuea1241 N-acylamino acid racemase {Enterococcus faecalis [ 97.36
d1r0ma1243 N-acylamino acid racemase {Deinococcus radiodurans 97.31
d1muca1242 Muconate-lactonizing enzyme {Pseudomonas putida [T 97.26
d1nu5a1243 Chlormuconate cycloisomerase {Pseudomonas sp. p51 97.11
d2chra1244 Chlormuconate cycloisomerase {Alcaligenes eutrophu 96.89
d1jpma1234 L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 96.86
d1yeya1252 RTS beta protein {Xanthomonas campestris pv. campe 96.77
d2gdqa1256 Hypothetical protein YitF {Bacillus subtilis [TaxI 96.59
d1sjda1242 N-acylamino acid racemase {Amycolatopsis sp. [TaxI 96.27
d1jpdx1208 L-Ala-D/L-Glu epimerase {Escherichia coli [TaxId: 95.92
d1rvka1255 Hypothetical protein Atu3453 {Agrobacterium tumefa 95.75
d2mnra1227 Mandelate racemase {Pseudomonas putida [TaxId: 303 95.65
d1r6wa1221 O-succinylbenzoate synthase {Escherichia coli [Tax 93.45
d2gl5a1278 Putative dehydratase protein STM2273 {Salmonella t 93.39
d1tzza1247 Hypothetical protein Bll6730 {Bradyrhizobium japon 88.5
d1jdfa1309 D-glucarate dehydratase {Escherichia coli [TaxId: 85.62
>d2ptza1 c.1.11.1 (A:139-429) Enolase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Enolase C-terminal domain-like
family: Enolase
domain: Enolase
species: Trypanosoma brucei [TaxId: 5691]

Probab=100.00  E-value=2e-59  Score=385.43  Aligned_cols=126  Identities=63%  Similarity=0.953  Sum_probs=123.9

Q ss_pred             hhhhhhcCCCeEEecCcccccCHHHHHHHHhhcccccceehccccccHHHHHHHHHHHHHCCCcEEeecCCCCCCchhHH
Q psy12654          4 FQLNDFAPEPIQIVGDDLTVTNPKRIATAVEKKACNCLLLKVNQIGSVTESIQAHLLAKQNGWGTMVSHRSGETEDNFIA   83 (133)
Q Consensus         4 ~~~~~~~~~~iqivGDDl~vTn~~ri~~~i~~~~~na~llK~nQigTvTe~lea~~~a~~~g~~~vvS~rsGETeD~~ia   83 (133)
                      .+||+++|+++|||||||||||++||++++++++||++||||||||||||+++++++|+++||.+|||||||||||+|||
T Consensus       165 ~~lt~~~g~k~~iVGDDL~vTn~~rl~~gi~~~a~NaiLIK~NQiGTvtEt~ea~~la~~~g~~~iiShRSGETeD~~ia  244 (291)
T d2ptza1         165 AGITEALKGKTQIVGDDLTVTNTERIKMAIEKKACNSLLLKINQIGTISEAIASSKLCMENGWSVMVSHRSGETEDTYIA  244 (291)
T ss_dssp             HHHHHHTTTTSEEEESTTTTTCHHHHHHHHHTTCCSEEEECHHHHCCHHHHHHHHHHHHHTTCEEEEECCSBCCSCCHHH
T ss_pred             HHhhhccCceEEEecCcccccchHHHhhccccCCccceEecchhhhhHHHHHHHHHHHHHcCeeEEeeCCCCCcCcchHH
Confidence            57999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhhhccCceecCCCCchhHHHHHHHHHHHHHHhCCcccccCccC
Q psy12654         84 DLVVGLSTGQIKTGAPCRSERLAKYNQILRIEEELGANAKFAGKNF  129 (133)
Q Consensus        84 dLAVgl~a~~iK~G~p~r~Er~aKyN~LLrIeeelg~~~~~~g~~~  129 (133)
                      |||||++++|||+|+|+||||++||||||||||+|+++++|+++.|
T Consensus       245 DLAVg~~a~~iK~G~~~r~ER~aKyNrLLrIee~L~~~~~~~~~~~  290 (291)
T d2ptza1         245 DLVVALGSGQIKTGAPCRGERTAKLNQLLRIEEELGAHAKFGFPGW  290 (291)
T ss_dssp             HHHHHHTCSEEECCSSCSHHHHHHHHHHHHHHHHHCTTCEESCGGG
T ss_pred             HHHHHhCCCceecCCCcchHHHHHHHHHHHHHHHhccccCcCCCCC
Confidence            9999999999999999999999999999999999999999999776
>d1w6ta1 c.1.11.1 (A:138-433) Enolase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2akza1 c.1.11.1 (A:140-433) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d2fyma1 c.1.11.1 (A:140-431) Enolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2al1a1 c.1.11.1 (A:142-436) Enolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kcza1 c.1.11.2 (A:161-413) beta-Methylaspartase {Clostridium tetanomorphum [TaxId: 1553]} Back     information, alignment and structure
>d1kkoa1 c.1.11.2 (A:161-411) beta-Methylaspartase {Citrobacter amalonaticus [TaxId: 35703]} Back     information, alignment and structure
>d1wufa1 c.1.11.2 (A:1127-1370) N-acylamino acid racemase {Listeria innocua [TaxId: 1642]} Back     information, alignment and structure
>d1wuea1 c.1.11.2 (A:1127-1367) N-acylamino acid racemase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1r0ma1 c.1.11.2 (A:133-375) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1muca1 c.1.11.2 (A:131-372) Muconate-lactonizing enzyme {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nu5a1 c.1.11.2 (A:127-369) Chlormuconate cycloisomerase {Pseudomonas sp. p51 [TaxId: 65067]} Back     information, alignment and structure
>d2chra1 c.1.11.2 (A:127-370) Chlormuconate cycloisomerase {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure
>d1jpma1 c.1.11.2 (A:126-359) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yeya1 c.1.11.2 (A:184-435) RTS beta protein {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
>d2gdqa1 c.1.11.2 (A:119-374) Hypothetical protein YitF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sjda1 c.1.11.2 (A:126-367) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]} Back     information, alignment and structure
>d1jpdx1 c.1.11.2 (X:114-321) L-Ala-D/L-Glu epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rvka1 c.1.11.2 (A:127-381) Hypothetical protein Atu3453 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2mnra1 c.1.11.2 (A:133-359) Mandelate racemase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1r6wa1 c.1.11.2 (A:100-320) O-succinylbenzoate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gl5a1 c.1.11.2 (A:123-400) Putative dehydratase protein STM2273 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1tzza1 c.1.11.2 (A:1146-1392) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1jdfa1 c.1.11.2 (A:138-446) D-glucarate dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure