Psyllid ID: psy12745


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-----
MTDISETKRDTKKIIYWRRVDWNRSHAFSHTPFVKGLVIAYFIIPIKWTYPVFDFFLMCSWRIFLIVSTFPSLAGALLVFFIPESPKFLMTHGRSDDALDVFQSMYARNTGKPKDSYPVKSLMGAPPTSICALLMLFGLKELTVEERVITRPTSIQEIEEEGDDMTHSMVSGGCE
ccccccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHccccccHHHHHccccccHHHHHHHccccHHcccccccc
cccccccccccccEEEEEHHHHcHHHHHHHHHHHHHHHHHHHHcccccEEEEcccEEEcHHHHEHEHHHHHHHHHHHHHHHcccccHHHHHcccHHHHHHHHHHHHHHHcccccccccHHEEcccccccccccccEEEcccccEEEEEEEccccHHHHHcccccHHHHHHccccc
mtdisetkrdtKKIIYWRRVdwnrshafshtpfvKGLVIAYFIIpikwtypvfDFFLMCSWRIFLIVSTFPSLAGALLVFfipespkflmthgrsddaLDVFQSMYarntgkpkdsypvkslmgapptSICALLMLFGlkeltveervitrptsiQEIEEegddmthsmvsggce
mtdisetkrdtkkiiywrrvdwnrshAFSHTPFVKGLVIAYFIIPIKWTYPVFDFFLMCSWRIFLIVSTFPSLAGALLVFFIPESPKFLMTHGRSDDALDVFQSMYARNTGKPKDSYPVKSLMGAPPTSICALLMLFGLKeltveervitrptsiqeieeegddmthSMVSGGCE
MTDISETKRDTKKIIYWRRVDWNRSHAFSHTPFVKGLVIAYFIIPIKWTYPVFDFFLMCSWRIFLIVSTFPSLAGALLVFFIPESPKFLMTHGRSDDALDVFQSMYARNTGKPKDSYPVKSLMGAPPTSICALLMLFGLKELTVEERVITRPTSIQEIEEEGDDMTHSMVSGGCE
***********KKIIYWRRVDWNRSHAFSHTPFVKGLVIAYFIIPIKWTYPVFDFFLMCSWRIFLIVSTFPSLAGALLVFFIPESPKFLMTHGRSDDALDVFQSMY***************LMGAPPTSICALLMLFGLKELTVEERVIT*************************
MTDI***KRDTKKIIYWRRVDWNRSHAFSHTPFVKGLVIAYFIIPIKWTYPVFDFFLMCSWRIFLIVSTFPSLAGALLVFFIPESPKFLMTHGRSDDALDVFQSMYARNTGKPKDSYPV*************************************************MVSGG**
*********DTKKIIYWRRVDWNRSHAFSHTPFVKGLVIAYFIIPIKWTYPVFDFFLMCSWRIFLIVSTFPSLAGALLVFFIPESPKFLMTHGRSDDALDVFQSMYARNTGKPKDSYPVKSLMGAPPTSICALLMLFGLKELTVEERVITRPTSIQEIEEE**************
********RDTKKIIYWRRVDWNRSHAFSHTPFVKGLVIAYFIIPIKWTYPVFDFFLMCSWRIFLIVSTFPSLAGALLVFFIPESPKFLMTHGRSDDALDVFQSMYARNTGKPKDSYPVKSLMGAPPTSICALLMLFGLKELTVEERVITRPTSIQEIEE***************
iiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTDISETKRDTKKIIYWRRVDWNRSHAFSHTPFVKGLVIAYFIIPIKWTYPVFDFFLMCSWRIFLIVSTFPSLAGALLVFFIPESPKFLMTHGRSDDALDVFQSMYARNTGKPKDSYPVKSLMGAPPTSICALLMLFGLKELTVEERVITRPTSIQEIEEEGDDMTHSMVSGGCE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query175 2.2.26 [Sep-21-2011]
Q69ZS6 727 Synaptic vesicle glycopro yes N/A 0.485 0.116 0.303 5e-07
Q9Z2I6 727 Synaptic vesicle glycopro yes N/A 0.485 0.116 0.303 5e-07
Q496J9 727 Synaptic vesicle glycopro yes N/A 0.485 0.116 0.303 5e-07
Q63564 683 Synaptic vesicle glycopro no N/A 0.485 0.124 0.292 8e-06
Q8BG39 683 Synaptic vesicle glycopro no N/A 0.485 0.124 0.292 8e-06
Q7L1I2 683 Synaptic vesicle glycopro no N/A 0.485 0.124 0.292 9e-06
Q29397 742 Synaptic vesicle glycopro no N/A 0.491 0.115 0.3 2e-05
Q9JIS5 742 Synaptic vesicle glycopro no N/A 0.491 0.115 0.3 2e-05
Q4R4X3 742 Synaptic vesicle glycopro N/A N/A 0.491 0.115 0.3 2e-05
Q02563 742 Synaptic vesicle glycopro no N/A 0.491 0.115 0.3 2e-05
>sp|Q69ZS6|SV2C_MOUSE Synaptic vesicle glycoprotein 2C OS=Mus musculus GN=Sv2c PE=1 SV=2 Back     alignment and function desciption
 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 49/89 (55%), Gaps = 4/89 (4%)

Query: 38  VIAYFIIP-IKWTYPVFDFFLMCSWRIFLIVSTFPSLAGALLVFFIPESPKFLMTHGRSD 96
            +A+ IIP   W++ +   +   SWR+F+IV   P ++  + + F+PESP+FL+  G+ D
Sbjct: 295 AMAWAIIPHYGWSFSMGSAYQFHSWRVFVIVCALPCVSSVVALTFMPESPRFLLEVGKHD 354

Query: 97  DA---LDVFQSMYARNTGKPKDSYPVKSL 122
           +A   L +      R  G+P+  + V  +
Sbjct: 355 EAWMILKLIHDTNMRARGQPEKVFTVNKI 383




Receptor for the botulinium neurotoxin type A/BOTA.
Mus musculus (taxid: 10090)
>sp|Q9Z2I6|SV2C_RAT Synaptic vesicle glycoprotein 2C OS=Rattus norvegicus GN=Sv2c PE=1 SV=1 Back     alignment and function description
>sp|Q496J9|SV2C_HUMAN Synaptic vesicle glycoprotein 2C OS=Homo sapiens GN=SV2C PE=2 SV=1 Back     alignment and function description
>sp|Q63564|SV2B_RAT Synaptic vesicle glycoprotein 2B OS=Rattus norvegicus GN=Sv2b PE=1 SV=1 Back     alignment and function description
>sp|Q8BG39|SV2B_MOUSE Synaptic vesicle glycoprotein 2B OS=Mus musculus GN=Sv2b PE=1 SV=1 Back     alignment and function description
>sp|Q7L1I2|SV2B_HUMAN Synaptic vesicle glycoprotein 2B OS=Homo sapiens GN=SV2B PE=2 SV=1 Back     alignment and function description
>sp|Q29397|SV2A_BOVIN Synaptic vesicle glycoprotein 2A OS=Bos taurus GN=SV2A PE=2 SV=1 Back     alignment and function description
>sp|Q9JIS5|SV2A_MOUSE Synaptic vesicle glycoprotein 2A OS=Mus musculus GN=Sv2a PE=1 SV=1 Back     alignment and function description
>sp|Q4R4X3|SV2A_MACFA Synaptic vesicle glycoprotein 2A OS=Macaca fascicularis GN=SV2A PE=2 SV=1 Back     alignment and function description
>sp|Q02563|SV2A_RAT Synaptic vesicle glycoprotein 2A OS=Rattus norvegicus GN=Sv2a PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query175
345483310 521 PREDICTED: synaptic vesicle glycoprotein 0.56 0.188 0.46 8e-18
380030801 634 PREDICTED: synaptic vesicle glycoprotein 0.52 0.143 0.478 6e-17
195451649 572 GK13908 [Drosophila willistoni] gi|19416 0.52 0.159 0.417 2e-16
91076170 556 PREDICTED: similar to synaptic vesicle p 0.502 0.158 0.472 2e-16
307206948 500 Synaptic vesicle glycoprotein 2B [Harpeg 0.485 0.17 0.476 3e-16
328792189 534 PREDICTED: synaptic vesicle glycoprotein 0.52 0.170 0.467 3e-16
332374370 532 unknown [Dendroctonus ponderosae] 0.485 0.159 0.435 1e-15
156549453 516 PREDICTED: synaptic vesicle glycoprotein 0.48 0.162 0.494 1e-15
198471039 567 GA23013 [Drosophila pseudoobscura pseudo 0.52 0.160 0.445 2e-15
195055494 878 GH17356 [Drosophila grimshawi] gi|193892 0.514 0.102 0.439 2e-15
>gi|345483310|ref|XP_001606599.2| PREDICTED: synaptic vesicle glycoprotein 2B-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score = 95.5 bits (236), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 71/100 (71%), Gaps = 2/100 (2%)

Query: 34  VKGLVIAYFIIPIKWTYPVFDFFLMCSWRIFLIVSTFPSLAGALLVFFIPESPKFLMTHG 93
           + G V+A  IIP  W++ V+  F + SW+I+L VS  P+L G LL+ F PESPKFLM+ G
Sbjct: 185 IIGSVLALVIIPQDWSF-VYGNFYIRSWQIYLAVSGLPTLVGTLLLGFFPESPKFLMSQG 243

Query: 94  RSDDALDVFQSMYARNTGKPKDSYPVKSLMGAPPTSICAL 133
           R+D+AL +F+++Y+ N+G+ K++YP++ L+     S CAL
Sbjct: 244 RNDEALKIFRTIYSVNSGESKENYPIR-LLENETASGCAL 282




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|380030801|ref|XP_003699030.1| PREDICTED: synaptic vesicle glycoprotein 2B-like [Apis florea] Back     alignment and taxonomy information
>gi|195451649|ref|XP_002073016.1| GK13908 [Drosophila willistoni] gi|194169101|gb|EDW84002.1| GK13908 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|91076170|ref|XP_971503.1| PREDICTED: similar to synaptic vesicle protein [Tribolium castaneum] gi|270014563|gb|EFA11011.1| hypothetical protein TcasGA2_TC004597 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307206948|gb|EFN84792.1| Synaptic vesicle glycoprotein 2B [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|328792189|ref|XP_394182.4| PREDICTED: synaptic vesicle glycoprotein 2C-like [Apis mellifera] Back     alignment and taxonomy information
>gi|332374370|gb|AEE62326.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|156549453|ref|XP_001603639.1| PREDICTED: synaptic vesicle glycoprotein 2B-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|198471039|ref|XP_002133644.1| GA23013 [Drosophila pseudoobscura pseudoobscura] gi|198145738|gb|EDY72271.1| GA23013 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195055494|ref|XP_001994652.1| GH17356 [Drosophila grimshawi] gi|193892415|gb|EDV91281.1| GH17356 [Drosophila grimshawi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query175
FB|FBgn0051272 563 CG31272 [Drosophila melanogast 0.651 0.202 0.386 1.2e-16
FB|FBgn0040350 558 CG3690 [Drosophila melanogaste 0.714 0.224 0.359 4.3e-16
FB|FBgn0037829 522 CG14691 [Drosophila melanogast 0.508 0.170 0.388 3.5e-14
FB|FBgn0029896 632 CG3168 [Drosophila melanogaste 0.462 0.128 0.441 7.2e-13
ZFIN|ZDB-GENE-000607-80 541 id:ibd5037 "id:ibd5037" [Danio 0.502 0.162 0.393 2.1e-12
FB|FBgn0030331 545 CG15221 [Drosophila melanogast 0.474 0.152 0.321 1.5e-08
FB|FBgn0051103 506 CG31103 [Drosophila melanogast 0.537 0.185 0.294 2e-07
UNIPROTKB|F1NCT9 752 SV2C "Uncharacterized protein" 0.48 0.111 0.295 2.7e-07
UNIPROTKB|B3KT41 676 SV2C "cDNA FLJ37598 fis, clone 0.48 0.124 0.295 3e-07
UNIPROTKB|Q496J9 727 SV2C "Synaptic vesicle glycopr 0.48 0.115 0.295 3.3e-07
FB|FBgn0051272 CG31272 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 199 (75.1 bits), Expect = 1.2e-16, Sum P(2) = 1.2e-16
 Identities = 46/119 (38%), Positives = 67/119 (56%)

Query:    38 VIAYFIIPIKWTYPVFDFFLMCSWRIFLIVSTFPSLAGALLVFFIPESPKFLMTHGRSDD 97
             ++A+ I P  W +  +   +  SW+IFL V   PSL   L+   +PESP+FLM  GR+++
Sbjct:   202 LLAWGIFPRDWDFEFWGLQVH-SWQIFLFVLGIPSLISGLIFCSMPESPRFLMAQGRNEE 260

Query:    98 ALDVFQSMYARNTGKPKDSYPVKSLMGAPPTSICALLMLFGLKELTVEERVITRPTSIQ 156
             AL  F+ +Y  NT KPKDSYP+K+L+   P    A   +      T+EE+    PT  Q
Sbjct:   261 ALQAFKQIYHVNTRKPKDSYPIKALIQEVPNRKAAQNEVI----YTIEEKSGEVPTKRQ 315


GO:0030672 "synaptic vesicle membrane" evidence=ISS
GO:0006810 "transport" evidence=ISS
GO:0005215 "transporter activity" evidence=ISS
GO:0055085 "transmembrane transport" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0016298 "lipase activity" evidence=ISS
GO:0006629 "lipid metabolic process" evidence=ISS
FB|FBgn0040350 CG3690 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0037829 CG14691 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0029896 CG3168 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-000607-80 id:ibd5037 "id:ibd5037" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0030331 CG15221 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0051103 CG31103 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1NCT9 SV2C "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|B3KT41 SV2C "cDNA FLJ37598 fis, clone BRCOC2008642, highly similar to Synaptic vesicle glycoprotein 2C" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q496J9 SV2C "Synaptic vesicle glycoprotein 2C" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
TIGR01299 742 TIGR01299, synapt_SV2, synaptic vesicle protein SV 4e-09
TIGR00898 505 TIGR00898, 2A0119, cation transport protein 2e-08
pfam00083 449 pfam00083, Sugar_tr, Sugar (and other) transporter 2e-05
PRK10077 479 PRK10077, xylE, D-xylose transporter XylE; Provisi 0.001
TIGR00879 481 TIGR00879, SP, MFS transporter, sugar porter (SP) 0.001
>gnl|CDD|130366 TIGR01299, synapt_SV2, synaptic vesicle protein SV2 Back     alignment and domain information
 Score = 54.6 bits (131), Expect = 4e-09
 Identities = 26/85 (30%), Positives = 48/85 (56%), Gaps = 4/85 (4%)

Query: 39  IAYFIIP-IKWTYPVFDFFLMCSWRIFLIVSTFPSLAGALLVFFIPESPKFLMTHGRSDD 97
           +A+ IIP   W++ +   +   SWR+F+IV  FP +     + F+PESP+F + +G+ D+
Sbjct: 310 MAWAIIPHYGWSFQMGSAYQFHSWRVFVIVCAFPCVFAIGALTFMPESPRFFLENGKHDE 369

Query: 98  ALDVFQSMYARNT---GKPKDSYPV 119
           A  + + ++  N    G P+  + V
Sbjct: 370 AWMILKLIHDTNMRAKGHPEKVFSV 394


This model describes a tightly conserved subfamily of the larger family of sugar (and other) transporters described by PFAM model pfam00083. Members of this subfamily include closely related forms SV2A and SV2B of synaptic vesicle protein from vertebrates and a more distantly related homolog (below trusted cutoff) from Drosophila melanogaster. Members are predicted to have two sets of six transmembrane helices. Length = 742

>gnl|CDD|233176 TIGR00898, 2A0119, cation transport protein Back     alignment and domain information
>gnl|CDD|215702 pfam00083, Sugar_tr, Sugar (and other) transporter Back     alignment and domain information
>gnl|CDD|182225 PRK10077, xylE, D-xylose transporter XylE; Provisional Back     alignment and domain information
>gnl|CDD|233165 TIGR00879, SP, MFS transporter, sugar porter (SP) family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 175
KOG0569|consensus 485 99.79
KOG0254|consensus 513 99.67
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 99.59
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 99.33
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.33
KOG0253|consensus 528 99.13
KOG0255|consensus 521 99.07
TIGR00898 505 2A0119 cation transport protein. 99.05
PRK10077 479 xylE D-xylose transporter XylE; Provisional 98.96
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 98.66
PRK10642 490 proline/glycine betaine transporter; Provisional 98.6
PRK09952 438 shikimate transporter; Provisional 98.55
PRK10642490 proline/glycine betaine transporter; Provisional 98.53
PRK10406 432 alpha-ketoglutarate transporter; Provisional 98.28
KOG2533|consensus 495 98.15
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 98.11
TIGR00891 405 2A0112 putative sialic acid transporter. 97.95
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 97.79
PRK15075 434 citrate-proton symporter; Provisional 97.67
TIGR00895 398 2A0115 benzoate transport. 97.63
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 97.63
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 97.58
KOG0252|consensus 538 97.55
TIGR00901356 2A0125 AmpG-related permease. 97.48
PRK03893 496 putative sialic acid transporter; Provisional 97.46
PRK11902 402 ampG muropeptide transporter; Reviewed 97.43
PRK11010 491 ampG muropeptide transporter; Validated 97.38
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 97.34
PRK12307 426 putative sialic acid transporter; Provisional 97.33
TIGR00893 399 2A0114 d-galactonate transporter. 97.16
PRK11663 434 regulatory protein UhpC; Provisional 96.94
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 96.79
PRK03545 390 putative arabinose transporter; Provisional 96.76
PRK15403 413 multidrug efflux system protein MdtM; Provisional 96.65
PTZ00207 591 hypothetical protein; Provisional 96.51
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 96.51
PRK14995 495 methyl viologen resistance protein SmvA; Provision 96.5
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 96.42
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 96.39
PRK10091 382 MFS transport protein AraJ; Provisional 96.32
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 96.25
TIGR00880141 2_A_01_02 Multidrug resistance protein. 96.22
PRK10213 394 nepI ribonucleoside transporter; Reviewed 96.21
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 96.2
KOG2532|consensus 466 96.19
TIGR00900365 2A0121 H+ Antiporter protein. 96.19
PRK12382 392 putative transporter; Provisional 96.15
PRK10489 417 enterobactin exporter EntS; Provisional 95.98
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 95.93
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 95.88
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 95.88
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 95.8
PRK05122 399 major facilitator superfamily transporter; Provisi 95.78
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 95.71
TIGR00805 633 oat sodium-independent organic anion transporter. 95.69
PRK11043 401 putative transporter; Provisional 95.6
PRK10473 392 multidrug efflux system protein MdtL; Provisional 95.57
PRK11195 393 lysophospholipid transporter LplT; Provisional 95.41
PRK11652 394 emrD multidrug resistance protein D; Provisional 95.35
PRK09874 408 drug efflux system protein MdtG; Provisional 95.22
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 95.19
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 95.02
PRK11646 400 multidrug resistance protein MdtH; Provisional 94.97
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 94.65
PRK15011 393 sugar efflux transporter B; Provisional 94.43
TIGR02718 390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 94.33
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 94.0
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 93.92
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 93.88
PRK10077479 xylE D-xylose transporter XylE; Provisional 93.85
TIGR00889418 2A0110 nucleoside transporter. This family of prot 93.67
TIGR00892455 2A0113 monocarboxylate transporter 1. 93.66
PLN00028 476 nitrate transmembrane transporter; Provisional 93.65
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 93.57
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 93.52
PRK11128 382 putative 3-phenylpropionic acid transporter; Provi 93.43
PRK03699 394 putative transporter; Provisional 93.33
PRK15011393 sugar efflux transporter B; Provisional 93.14
KOG1330|consensus 493 92.98
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 92.97
PRK10504 471 putative transporter; Provisional 92.95
PRK05122399 major facilitator superfamily transporter; Provisi 91.92
PRK10054 395 putative transporter; Provisional 91.78
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 91.68
PF13347 428 MFS_2: MFS/sugar transport protein 91.45
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 91.34
TIGR00892 455 2A0113 monocarboxylate transporter 1. 91.16
TIGR00902 382 2A0127 phenyl proprionate permease family protein. 90.81
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 90.64
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 90.51
PRK10207 489 dipeptide/tripeptide permease B; Provisional 90.29
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 89.95
PRK09874408 drug efflux system protein MdtG; Provisional 89.69
PRK09584 500 tppB putative tripeptide transporter permease; Rev 89.29
TIGR01272 310 gluP glucose/galactose transporter. Disruption of 89.08
KOG2615|consensus 451 88.91
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 88.68
PF03137 539 OATP: Organic Anion Transporter Polypeptide (OATP) 88.38
TIGR00898505 2A0119 cation transport protein. 88.34
TIGR00896355 CynX cyanate transporter. This family of proteins 87.57
KOG3626|consensus 735 87.49
TIGR00897 402 2A0118 polyol permease family. This family of prot 87.34
PRK12382392 putative transporter; Provisional 86.95
PRK09705 393 cynX putative cyanate transporter; Provisional 86.57
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 86.47
TIGR00893399 2A0114 d-galactonate transporter. 86.14
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 85.77
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 85.69
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 85.59
TIGR00788 468 fbt folate/biopterin transporter. The only functio 85.5
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 85.46
PRK09528420 lacY galactoside permease; Reviewed 85.18
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 85.18
TIGR00897402 2A0118 polyol permease family. This family of prot 84.36
PRK03633381 putative MFS family transporter protein; Provision 84.01
PRK11462 460 putative transporter; Provisional 82.7
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 81.84
PRK10489417 enterobactin exporter EntS; Provisional 81.47
PRK09669 444 putative symporter YagG; Provisional 80.68
>KOG0569|consensus Back     alignment and domain information
Probab=99.79  E-value=1.4e-19  Score=151.21  Aligned_cols=144  Identities=17%  Similarity=0.223  Sum_probs=111.7

Q ss_pred             cccccCCCCchhhHHHhHHHHhhcCCccchhHHHHHHHHHHHhccccCCcccccccccchHHHHHHhhHHHHHHHHHHhh
Q psy12745          2 TDISETKRDTKKIIYWRRVDWNRSHAFSHTPFVKGLVIAYFIIPIKWTYPVFDFFLMCSWRIFLIVSTFPSLAGALLVFF   81 (175)
Q Consensus         2 ~~is~p~~~Rg~~~~~~~~~~~~G~~~~~~~~~l~~~i~~~~~~~~~~~~~~~~~~~~~Wr~~~~~~~i~~~~~~~~~~~   81 (175)
                      .|++ |++.||..+++.+++..+|.       +++..++.--        +.|  ++..|++.+.+..+|+++..+...+
T Consensus       142 ~E~s-P~~~RG~~g~~~~~~~~~g~-------ll~~~~~l~~--------ilG--t~~~W~~l~~~~~i~~~~~l~~l~~  203 (485)
T KOG0569|consen  142 TEIS-PKNLRGALGTLLQIGVVIGI-------LLGQVLGLPS--------LLG--TEDLWPYLLAFPLIPALLQLALLPF  203 (485)
T ss_pred             hhcC-hhhhccHHHHHHHHHHHHHH-------HHHHHHccHH--------hcC--CCcchHHHHHHHHHHHHHHHHHHhc
Confidence            4555 99999999999999999999       9887776654        233  5678999999999999999999999


Q ss_pred             cCCChHHHHh-cCChHHHHHHHHHHhhccCCCCCC----------------cccccccccCCchhHH--HHHHHHhccee
Q psy12745         82 IPESPKFLMT-HGRSDDALDVFQSMYARNTGKPKD----------------SYPVKSLMGAPPTSIC--ALLMLFGLKEL  142 (175)
Q Consensus        82 lpESP~~L~~-~g~~~~a~~~l~~l~~~~~~~~~~----------------~~~~~~l~~~~~~~~~--~~~~~~~~~~~  142 (175)
                      +|||||||+. |||.|+|++.++++++.++++.+.                ..++.++++.+..++.  ..+++...||+
T Consensus       204 ~PESPk~Ll~~k~~~~~A~~sl~~y~G~~~~~~~~e~~~~e~~~~~~~~~~~~sl~~~~~~~~lR~~~~i~~~v~~~qq~  283 (485)
T KOG0569|consen  204 LPESPKYLLIKKGDEEEARKALKFYRGKEDVEAEIEEMLREIEEEELEKKKQISLRQLLKNPTLRRPLLIGIVVSFAQQF  283 (485)
T ss_pred             CCCCcchHHHHcCCHHHHHHHHHHHhCCCcchhHHHHHHHHHHHhccccccCCcHHHHhcCcchhHHHHHHHHHHHHHHh
Confidence            9999999987 899999999999998876432211                1123344444333322  33445556999


Q ss_pred             ecceeEeechhhHHhhhc-cCC
Q psy12745        143 TVEERVITRPTSIQEIEE-EGD  163 (175)
Q Consensus       143 ~~~~~i~~~~~~i~~~~~-~~~  163 (175)
                      +|.+.+.+|.+.+++++| +.+
T Consensus       284 sGi~ai~~Yst~i~~~aG~~~~  305 (485)
T KOG0569|consen  284 SGINAIFFYSTSIFKTAGFTPE  305 (485)
T ss_pred             cCcceeHHHHHHHHHHcCCCHH
Confidence            999999999999999998 444



>KOG0254|consensus Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>KOG3626|consensus Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query175
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 99.47
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 96.98
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 96.84
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 96.84
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 95.13
2xut_A 524 Proton/peptide symporter family protein; transport 92.14
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 91.77
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 88.6
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 87.52
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
Probab=99.47  E-value=6e-15  Score=121.69  Aligned_cols=143  Identities=15%  Similarity=0.201  Sum_probs=101.1

Q ss_pred             CCCCchhhHHHhHHHHhhcCCccchhHHHHHHHHHHHhccccCCcccccccccchHHHHHHhhHHHHHHHHHHhhcCCCh
Q psy12745          7 TKRDTKKIIYWRRVDWNRSHAFSHTPFVKGLVIAYFIIPIKWTYPVFDFFLMCSWRIFLIVSTFPSLAGALLVFFIPESP   86 (175)
Q Consensus         7 p~~~Rg~~~~~~~~~~~~G~~~~~~~~~l~~~i~~~~~~~~~~~~~~~~~~~~~Wr~~~~~~~i~~~~~~~~~~~lpESP   86 (175)
                      |+++||+..++.+.++.+|.       +++.++++..........    .+.+.||+++.+..+++++.++.++++||||
T Consensus       156 p~~~rg~~~~~~~~~~~~g~-------~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~peSp  224 (491)
T 4gc0_A          156 PAHIRGKLVSFNQFAIIFGQ-------LLVYCVNYFIARSGDASW----LNTDGWRYMFASECIPALLFLMLLYTVPESP  224 (491)
T ss_dssp             CGGGHHHHHHHHHHHHHHHH-------HHHHHHHHHHHTTSCTTT----TTTTHHHHHHHTTHHHHHHHHHHGGGSCCCH
T ss_pred             CHHhhhhhHHhhhhhhhhhh-------hhhhhcchhhcccccccc----ccchhhHHHhhhhhhhhhhhhhhhhcCCCCh
Confidence            88899999999999999999       999999888754331111    2347899999999999999999999999999


Q ss_pred             HHHHhcCChHHHHHHHHHHhhccCCCCCCcccc----------cccccCCchhHHHHHHHHhcceeecceeEeechhhHH
Q psy12745         87 KFLMTHGRSDDALDVFQSMYARNTGKPKDSYPV----------KSLMGAPPTSICALLMLFGLKELTVEERVITRPTSIQ  156 (175)
Q Consensus        87 ~~L~~~g~~~~a~~~l~~l~~~~~~~~~~~~~~----------~~l~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~i~  156 (175)
                      |||..|++.|++++.+++...++..+.+.....          ....................+++.+.+.+.+|.+.++
T Consensus       225 ~~L~~~~~~~~a~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  304 (491)
T 4gc0_A          225 RWLMSRGKQEQAEGILRKIMGNTLATQAVQEIKHSLDHGRKTGGRLLMFGVGVIVIGVMLSIFQQFVGINVVLYYAPEVF  304 (491)
T ss_dssp             HHHHHTTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTHHHHSCCTHHHHHHHHHHHHHHTCHHHHHHHHHHHH
T ss_pred             HHHHHcCchhHHHHhHHHhcCCchhHHHHHHHHHHHHhhhhhhhHHHHhcccHHHHHHHHHHHHHHhhhhHHHhcchHHH
Confidence            999999999999999998866542211110000          0000111112222222333477788888888888888


Q ss_pred             hhhc
Q psy12745        157 EIEE  160 (175)
Q Consensus       157 ~~~~  160 (175)
                      +..+
T Consensus       305 ~~~~  308 (491)
T 4gc0_A          305 KTLG  308 (491)
T ss_dssp             HHSS
T ss_pred             HhcC
Confidence            7766



>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query175
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 96.65
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 93.02
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=96.65  E-value=0.00017  Score=55.65  Aligned_cols=64  Identities=9%  Similarity=0.162  Sum_probs=47.7

Q ss_pred             CCCCchhhHHHhHHHHhhcCCccchhHHHHHHHHHHHhccccCCcccccccccchHHHHHHhhHHHHHH-HHHHhhcCCC
Q psy12745          7 TKRDTKKIIYWRRVDWNRSHAFSHTPFVKGLVIAYFIIPIKWTYPVFDFFLMCSWRIFLIVSTFPSLAG-ALLVFFIPES   85 (175)
Q Consensus         7 p~~~Rg~~~~~~~~~~~~G~~~~~~~~~l~~~i~~~~~~~~~~~~~~~~~~~~~Wr~~~~~~~i~~~~~-~~~~~~lpES   85 (175)
                      |+++|++..++.+.++.+|.       ++++.++......           ..+||+.+++.+++.++. ++...+++|+
T Consensus       146 ~~~~r~~~~~~~~~~~~~g~-------~i~~~~~~~~~~~-----------~~~w~~~~~~~~~~~~~~~~~~~~~~~~~  207 (447)
T d1pw4a_         146 SQKERGGIVSVWNCAHNVGG-------GIPPLLFLLGMAW-----------FNDWHAALYMPAFCAILVALFAFAMMRDT  207 (447)
T ss_dssp             TTTHHHHHHHHHHHHHHHHH-------TSHHHHHHHHHHH-----------TCCSTTCTHHHHHHHHHHHHHHHHHCCCS
T ss_pred             Hhhcccccccccccccchhh-------hhhhhhhhhHhhh-----------hhcccccchhhhhhHHHHHHHHHHhcccc
Confidence            78899999999999999998       7777666554332           258999888887776664 4456667787


Q ss_pred             hHH
Q psy12745         86 PKF   88 (175)
Q Consensus        86 P~~   88 (175)
                      |+.
T Consensus       208 ~~~  210 (447)
T d1pw4a_         208 PQS  210 (447)
T ss_dssp             STT
T ss_pred             hhh
Confidence            754



>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure