Psyllid ID: psy12745
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 175 | ||||||
| 345483310 | 521 | PREDICTED: synaptic vesicle glycoprotein | 0.56 | 0.188 | 0.46 | 8e-18 | |
| 380030801 | 634 | PREDICTED: synaptic vesicle glycoprotein | 0.52 | 0.143 | 0.478 | 6e-17 | |
| 195451649 | 572 | GK13908 [Drosophila willistoni] gi|19416 | 0.52 | 0.159 | 0.417 | 2e-16 | |
| 91076170 | 556 | PREDICTED: similar to synaptic vesicle p | 0.502 | 0.158 | 0.472 | 2e-16 | |
| 307206948 | 500 | Synaptic vesicle glycoprotein 2B [Harpeg | 0.485 | 0.17 | 0.476 | 3e-16 | |
| 328792189 | 534 | PREDICTED: synaptic vesicle glycoprotein | 0.52 | 0.170 | 0.467 | 3e-16 | |
| 332374370 | 532 | unknown [Dendroctonus ponderosae] | 0.485 | 0.159 | 0.435 | 1e-15 | |
| 156549453 | 516 | PREDICTED: synaptic vesicle glycoprotein | 0.48 | 0.162 | 0.494 | 1e-15 | |
| 198471039 | 567 | GA23013 [Drosophila pseudoobscura pseudo | 0.52 | 0.160 | 0.445 | 2e-15 | |
| 195055494 | 878 | GH17356 [Drosophila grimshawi] gi|193892 | 0.514 | 0.102 | 0.439 | 2e-15 |
| >gi|345483310|ref|XP_001606599.2| PREDICTED: synaptic vesicle glycoprotein 2B-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Score = 95.5 bits (236), Expect = 8e-18, Method: Compositional matrix adjust.
Identities = 46/100 (46%), Positives = 71/100 (71%), Gaps = 2/100 (2%)
Query: 34 VKGLVIAYFIIPIKWTYPVFDFFLMCSWRIFLIVSTFPSLAGALLVFFIPESPKFLMTHG 93
+ G V+A IIP W++ V+ F + SW+I+L VS P+L G LL+ F PESPKFLM+ G
Sbjct: 185 IIGSVLALVIIPQDWSF-VYGNFYIRSWQIYLAVSGLPTLVGTLLLGFFPESPKFLMSQG 243
Query: 94 RSDDALDVFQSMYARNTGKPKDSYPVKSLMGAPPTSICAL 133
R+D+AL +F+++Y+ N+G+ K++YP++ L+ S CAL
Sbjct: 244 RNDEALKIFRTIYSVNSGESKENYPIR-LLENETASGCAL 282
|
Source: Nasonia vitripennis Species: Nasonia vitripennis Genus: Nasonia Family: Pteromalidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|380030801|ref|XP_003699030.1| PREDICTED: synaptic vesicle glycoprotein 2B-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|195451649|ref|XP_002073016.1| GK13908 [Drosophila willistoni] gi|194169101|gb|EDW84002.1| GK13908 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|91076170|ref|XP_971503.1| PREDICTED: similar to synaptic vesicle protein [Tribolium castaneum] gi|270014563|gb|EFA11011.1| hypothetical protein TcasGA2_TC004597 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|307206948|gb|EFN84792.1| Synaptic vesicle glycoprotein 2B [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|328792189|ref|XP_394182.4| PREDICTED: synaptic vesicle glycoprotein 2C-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|332374370|gb|AEE62326.1| unknown [Dendroctonus ponderosae] | Back alignment and taxonomy information |
|---|
| >gi|156549453|ref|XP_001603639.1| PREDICTED: synaptic vesicle glycoprotein 2B-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|198471039|ref|XP_002133644.1| GA23013 [Drosophila pseudoobscura pseudoobscura] gi|198145738|gb|EDY72271.1| GA23013 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
| >gi|195055494|ref|XP_001994652.1| GH17356 [Drosophila grimshawi] gi|193892415|gb|EDV91281.1| GH17356 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 175 | ||||||
| FB|FBgn0051272 | 563 | CG31272 [Drosophila melanogast | 0.651 | 0.202 | 0.386 | 1.2e-16 | |
| FB|FBgn0040350 | 558 | CG3690 [Drosophila melanogaste | 0.714 | 0.224 | 0.359 | 4.3e-16 | |
| FB|FBgn0037829 | 522 | CG14691 [Drosophila melanogast | 0.508 | 0.170 | 0.388 | 3.5e-14 | |
| FB|FBgn0029896 | 632 | CG3168 [Drosophila melanogaste | 0.462 | 0.128 | 0.441 | 7.2e-13 | |
| ZFIN|ZDB-GENE-000607-80 | 541 | id:ibd5037 "id:ibd5037" [Danio | 0.502 | 0.162 | 0.393 | 2.1e-12 | |
| FB|FBgn0030331 | 545 | CG15221 [Drosophila melanogast | 0.474 | 0.152 | 0.321 | 1.5e-08 | |
| FB|FBgn0051103 | 506 | CG31103 [Drosophila melanogast | 0.537 | 0.185 | 0.294 | 2e-07 | |
| UNIPROTKB|F1NCT9 | 752 | SV2C "Uncharacterized protein" | 0.48 | 0.111 | 0.295 | 2.7e-07 | |
| UNIPROTKB|B3KT41 | 676 | SV2C "cDNA FLJ37598 fis, clone | 0.48 | 0.124 | 0.295 | 3e-07 | |
| UNIPROTKB|Q496J9 | 727 | SV2C "Synaptic vesicle glycopr | 0.48 | 0.115 | 0.295 | 3.3e-07 |
| FB|FBgn0051272 CG31272 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 199 (75.1 bits), Expect = 1.2e-16, Sum P(2) = 1.2e-16
Identities = 46/119 (38%), Positives = 67/119 (56%)
Query: 38 VIAYFIIPIKWTYPVFDFFLMCSWRIFLIVSTFPSLAGALLVFFIPESPKFLMTHGRSDD 97
++A+ I P W + + + SW+IFL V PSL L+ +PESP+FLM GR+++
Sbjct: 202 LLAWGIFPRDWDFEFWGLQVH-SWQIFLFVLGIPSLISGLIFCSMPESPRFLMAQGRNEE 260
Query: 98 ALDVFQSMYARNTGKPKDSYPVKSLMGAPPTSICALLMLFGLKELTVEERVITRPTSIQ 156
AL F+ +Y NT KPKDSYP+K+L+ P A + T+EE+ PT Q
Sbjct: 261 ALQAFKQIYHVNTRKPKDSYPIKALIQEVPNRKAAQNEVI----YTIEEKSGEVPTKRQ 315
|
|
| FB|FBgn0040350 CG3690 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0037829 CG14691 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0029896 CG3168 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-000607-80 id:ibd5037 "id:ibd5037" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0030331 CG15221 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0051103 CG31103 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NCT9 SV2C "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B3KT41 SV2C "cDNA FLJ37598 fis, clone BRCOC2008642, highly similar to Synaptic vesicle glycoprotein 2C" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q496J9 SV2C "Synaptic vesicle glycoprotein 2C" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 175 | |||
| TIGR01299 | 742 | TIGR01299, synapt_SV2, synaptic vesicle protein SV | 4e-09 | |
| TIGR00898 | 505 | TIGR00898, 2A0119, cation transport protein | 2e-08 | |
| pfam00083 | 449 | pfam00083, Sugar_tr, Sugar (and other) transporter | 2e-05 | |
| PRK10077 | 479 | PRK10077, xylE, D-xylose transporter XylE; Provisi | 0.001 | |
| TIGR00879 | 481 | TIGR00879, SP, MFS transporter, sugar porter (SP) | 0.001 |
| >gnl|CDD|130366 TIGR01299, synapt_SV2, synaptic vesicle protein SV2 | Back alignment and domain information |
|---|
Score = 54.6 bits (131), Expect = 4e-09
Identities = 26/85 (30%), Positives = 48/85 (56%), Gaps = 4/85 (4%)
Query: 39 IAYFIIP-IKWTYPVFDFFLMCSWRIFLIVSTFPSLAGALLVFFIPESPKFLMTHGRSDD 97
+A+ IIP W++ + + SWR+F+IV FP + + F+PESP+F + +G+ D+
Sbjct: 310 MAWAIIPHYGWSFQMGSAYQFHSWRVFVIVCAFPCVFAIGALTFMPESPRFFLENGKHDE 369
Query: 98 ALDVFQSMYARNT---GKPKDSYPV 119
A + + ++ N G P+ + V
Sbjct: 370 AWMILKLIHDTNMRAKGHPEKVFSV 394
|
This model describes a tightly conserved subfamily of the larger family of sugar (and other) transporters described by PFAM model pfam00083. Members of this subfamily include closely related forms SV2A and SV2B of synaptic vesicle protein from vertebrates and a more distantly related homolog (below trusted cutoff) from Drosophila melanogaster. Members are predicted to have two sets of six transmembrane helices. Length = 742 |
| >gnl|CDD|233176 TIGR00898, 2A0119, cation transport protein | Back alignment and domain information |
|---|
| >gnl|CDD|215702 pfam00083, Sugar_tr, Sugar (and other) transporter | Back alignment and domain information |
|---|
| >gnl|CDD|182225 PRK10077, xylE, D-xylose transporter XylE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233165 TIGR00879, SP, MFS transporter, sugar porter (SP) family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 175 | |||
| KOG0569|consensus | 485 | 99.79 | ||
| KOG0254|consensus | 513 | 99.67 | ||
| PF00083 | 451 | Sugar_tr: Sugar (and other) transporter; InterPro: | 99.59 | |
| TIGR00887 | 502 | 2A0109 phosphate:H+ symporter. This model represen | 99.33 | |
| TIGR01299 | 742 | synapt_SV2 synaptic vesicle protein SV2. This mode | 99.33 | |
| KOG0253|consensus | 528 | 99.13 | ||
| KOG0255|consensus | 521 | 99.07 | ||
| TIGR00898 | 505 | 2A0119 cation transport protein. | 99.05 | |
| PRK10077 | 479 | xylE D-xylose transporter XylE; Provisional | 98.96 | |
| TIGR00879 | 481 | SP MFS transporter, sugar porter (SP) family. This | 98.66 | |
| PRK10642 | 490 | proline/glycine betaine transporter; Provisional | 98.6 | |
| PRK09952 | 438 | shikimate transporter; Provisional | 98.55 | |
| PRK10642 | 490 | proline/glycine betaine transporter; Provisional | 98.53 | |
| PRK10406 | 432 | alpha-ketoglutarate transporter; Provisional | 98.28 | |
| KOG2533|consensus | 495 | 98.15 | ||
| TIGR00903 | 368 | 2A0129 major facilitator 4 family protein. This fa | 98.11 | |
| TIGR00891 | 405 | 2A0112 putative sialic acid transporter. | 97.95 | |
| TIGR00883 | 394 | 2A0106 metabolite-proton symporter. This model rep | 97.79 | |
| PRK15075 | 434 | citrate-proton symporter; Provisional | 97.67 | |
| TIGR00895 | 398 | 2A0115 benzoate transport. | 97.63 | |
| TIGR02332 | 412 | HpaX 4-hydroxyphenylacetate permease. This protein | 97.63 | |
| PRK11551 | 406 | putative 3-hydroxyphenylpropionic transporter MhpT | 97.58 | |
| KOG0252|consensus | 538 | 97.55 | ||
| TIGR00901 | 356 | 2A0125 AmpG-related permease. | 97.48 | |
| PRK03893 | 496 | putative sialic acid transporter; Provisional | 97.46 | |
| PRK11902 | 402 | ampG muropeptide transporter; Reviewed | 97.43 | |
| PRK11010 | 491 | ampG muropeptide transporter; Validated | 97.38 | |
| TIGR00894 | 465 | 2A0114euk Na(+)-dependent inorganic phosphate cotr | 97.34 | |
| PRK12307 | 426 | putative sialic acid transporter; Provisional | 97.33 | |
| TIGR00893 | 399 | 2A0114 d-galactonate transporter. | 97.16 | |
| PRK11663 | 434 | regulatory protein UhpC; Provisional | 96.94 | |
| COG2814 | 394 | AraJ Arabinose efflux permease [Carbohydrate trans | 96.79 | |
| PRK03545 | 390 | putative arabinose transporter; Provisional | 96.76 | |
| PRK15403 | 413 | multidrug efflux system protein MdtM; Provisional | 96.65 | |
| PTZ00207 | 591 | hypothetical protein; Provisional | 96.51 | |
| TIGR00899 | 375 | 2A0120 sugar efflux transporter. This family of pr | 96.51 | |
| PRK14995 | 495 | methyl viologen resistance protein SmvA; Provision | 96.5 | |
| COG2271 | 448 | UhpC Sugar phosphate permease [Carbohydrate transp | 96.42 | |
| TIGR00712 | 438 | glpT glycerol-3-phosphate transporter. This model | 96.39 | |
| PRK10091 | 382 | MFS transport protein AraJ; Provisional | 96.32 | |
| PF06609 | 599 | TRI12: Fungal trichothecene efflux pump (TRI12); I | 96.25 | |
| TIGR00880 | 141 | 2_A_01_02 Multidrug resistance protein. | 96.22 | |
| PRK10213 | 394 | nepI ribonucleoside transporter; Reviewed | 96.21 | |
| TIGR00710 | 385 | efflux_Bcr_CflA drug resistance transporter, Bcr/C | 96.2 | |
| KOG2532|consensus | 466 | 96.19 | ||
| TIGR00900 | 365 | 2A0121 H+ Antiporter protein. | 96.19 | |
| PRK12382 | 392 | putative transporter; Provisional | 96.15 | |
| PRK10489 | 417 | enterobactin exporter EntS; Provisional | 95.98 | |
| PRK11102 | 377 | bicyclomycin/multidrug efflux system; Provisional | 95.93 | |
| TIGR00792 | 437 | gph sugar (Glycoside-Pentoside-Hexuronide) transpo | 95.88 | |
| PF07690 | 352 | MFS_1: Major Facilitator Superfamily; InterPro: IP | 95.88 | |
| PRK15402 | 406 | multidrug efflux system translocase MdfA; Provisio | 95.8 | |
| PRK05122 | 399 | major facilitator superfamily transporter; Provisi | 95.78 | |
| TIGR00711 | 485 | efflux_EmrB drug resistance transporter, EmrB/QacA | 95.71 | |
| TIGR00805 | 633 | oat sodium-independent organic anion transporter. | 95.69 | |
| PRK11043 | 401 | putative transporter; Provisional | 95.6 | |
| PRK10473 | 392 | multidrug efflux system protein MdtL; Provisional | 95.57 | |
| PRK11195 | 393 | lysophospholipid transporter LplT; Provisional | 95.41 | |
| PRK11652 | 394 | emrD multidrug resistance protein D; Provisional | 95.35 | |
| PRK09874 | 408 | drug efflux system protein MdtG; Provisional | 95.22 | |
| PRK11273 | 452 | glpT sn-glycerol-3-phosphate transporter; Provisio | 95.19 | |
| TIGR00881 | 379 | 2A0104 phosphoglycerate transporter family protein | 95.02 | |
| PRK11646 | 400 | multidrug resistance protein MdtH; Provisional | 94.97 | |
| TIGR00890 | 377 | 2A0111 Oxalate/Formate Antiporter. | 94.65 | |
| PRK15011 | 393 | sugar efflux transporter B; Provisional | 94.43 | |
| TIGR02718 | 390 | sider_RhtX_FptX siderophore transporter, RhtX/FptX | 94.33 | |
| PRK08633 | 1146 | 2-acyl-glycerophospho-ethanolamine acyltransferase | 94.0 | |
| PRK06814 | 1140 | acylglycerophosphoethanolamine acyltransferase; Pr | 93.92 | |
| cd06174 | 352 | MFS The Major Facilitator Superfamily (MFS) is a l | 93.88 | |
| PRK10077 | 479 | xylE D-xylose transporter XylE; Provisional | 93.85 | |
| TIGR00889 | 418 | 2A0110 nucleoside transporter. This family of prot | 93.67 | |
| TIGR00892 | 455 | 2A0113 monocarboxylate transporter 1. | 93.66 | |
| PLN00028 | 476 | nitrate transmembrane transporter; Provisional | 93.65 | |
| PRK09556 | 467 | uhpT sugar phosphate antiporter; Reviewed | 93.57 | |
| TIGR00886 | 366 | 2A0108 nitrite extrusion protein (nitrite facilita | 93.52 | |
| PRK11128 | 382 | putative 3-phenylpropionic acid transporter; Provi | 93.43 | |
| PRK03699 | 394 | putative transporter; Provisional | 93.33 | |
| PRK15011 | 393 | sugar efflux transporter B; Provisional | 93.14 | |
| KOG1330|consensus | 493 | 92.98 | ||
| TIGR01299 | 742 | synapt_SV2 synaptic vesicle protein SV2. This mode | 92.97 | |
| PRK10504 | 471 | putative transporter; Provisional | 92.95 | |
| PRK05122 | 399 | major facilitator superfamily transporter; Provisi | 91.92 | |
| PRK10054 | 395 | putative transporter; Provisional | 91.78 | |
| TIGR00885 | 410 | fucP L-fucose:H+ symporter permease. This family d | 91.68 | |
| PF13347 | 428 | MFS_2: MFS/sugar transport protein | 91.45 | |
| PRK11273 | 452 | glpT sn-glycerol-3-phosphate transporter; Provisio | 91.34 | |
| TIGR00892 | 455 | 2A0113 monocarboxylate transporter 1. | 91.16 | |
| TIGR00902 | 382 | 2A0127 phenyl proprionate permease family protein. | 90.81 | |
| cd06174 | 352 | MFS The Major Facilitator Superfamily (MFS) is a l | 90.64 | |
| TIGR00879 | 481 | SP MFS transporter, sugar porter (SP) family. This | 90.51 | |
| PRK10207 | 489 | dipeptide/tripeptide permease B; Provisional | 90.29 | |
| TIGR00806 | 511 | rfc RFC reduced folate carrier. Proteins of the RF | 89.95 | |
| PRK09874 | 408 | drug efflux system protein MdtG; Provisional | 89.69 | |
| PRK09584 | 500 | tppB putative tripeptide transporter permease; Rev | 89.29 | |
| TIGR01272 | 310 | gluP glucose/galactose transporter. Disruption of | 89.08 | |
| KOG2615|consensus | 451 | 88.91 | ||
| TIGR01301 | 477 | GPH_sucrose GPH family sucrose/H+ symporter. This | 88.68 | |
| PF03137 | 539 | OATP: Organic Anion Transporter Polypeptide (OATP) | 88.38 | |
| TIGR00898 | 505 | 2A0119 cation transport protein. | 88.34 | |
| TIGR00896 | 355 | CynX cyanate transporter. This family of proteins | 87.57 | |
| KOG3626|consensus | 735 | 87.49 | ||
| TIGR00897 | 402 | 2A0118 polyol permease family. This family of prot | 87.34 | |
| PRK12382 | 392 | putative transporter; Provisional | 86.95 | |
| PRK09705 | 393 | cynX putative cyanate transporter; Provisional | 86.57 | |
| TIGR00899 | 375 | 2A0120 sugar efflux transporter. This family of pr | 86.47 | |
| TIGR00893 | 399 | 2A0114 d-galactonate transporter. | 86.14 | |
| TIGR00887 | 502 | 2A0109 phosphate:H+ symporter. This model represen | 85.77 | |
| TIGR00890 | 377 | 2A0111 Oxalate/Formate Antiporter. | 85.69 | |
| PRK11551 | 406 | putative 3-hydroxyphenylpropionic transporter MhpT | 85.59 | |
| TIGR00788 | 468 | fbt folate/biopterin transporter. The only functio | 85.5 | |
| TIGR00924 | 475 | yjdL_sub1_fam amino acid/peptide transporter (Pept | 85.46 | |
| PRK09528 | 420 | lacY galactoside permease; Reviewed | 85.18 | |
| COG2223 | 417 | NarK Nitrate/nitrite transporter [Inorganic ion tr | 85.18 | |
| TIGR00897 | 402 | 2A0118 polyol permease family. This family of prot | 84.36 | |
| PRK03633 | 381 | putative MFS family transporter protein; Provision | 84.01 | |
| PRK11462 | 460 | putative transporter; Provisional | 82.7 | |
| TIGR00882 | 396 | 2A0105 oligosaccharide:H+ symporter. | 81.84 | |
| PRK10489 | 417 | enterobactin exporter EntS; Provisional | 81.47 | |
| PRK09669 | 444 | putative symporter YagG; Provisional | 80.68 |
| >KOG0569|consensus | Back alignment and domain information |
|---|
Probab=99.79 E-value=1.4e-19 Score=151.21 Aligned_cols=144 Identities=17% Similarity=0.223 Sum_probs=111.7
Q ss_pred cccccCCCCchhhHHHhHHHHhhcCCccchhHHHHHHHHHHHhccccCCcccccccccchHHHHHHhhHHHHHHHHHHhh
Q psy12745 2 TDISETKRDTKKIIYWRRVDWNRSHAFSHTPFVKGLVIAYFIIPIKWTYPVFDFFLMCSWRIFLIVSTFPSLAGALLVFF 81 (175)
Q Consensus 2 ~~is~p~~~Rg~~~~~~~~~~~~G~~~~~~~~~l~~~i~~~~~~~~~~~~~~~~~~~~~Wr~~~~~~~i~~~~~~~~~~~ 81 (175)
.|++ |++.||..+++.+++..+|. +++..++.-- +.| ++..|++.+.+..+|+++..+...+
T Consensus 142 ~E~s-P~~~RG~~g~~~~~~~~~g~-------ll~~~~~l~~--------ilG--t~~~W~~l~~~~~i~~~~~l~~l~~ 203 (485)
T KOG0569|consen 142 TEIS-PKNLRGALGTLLQIGVVIGI-------LLGQVLGLPS--------LLG--TEDLWPYLLAFPLIPALLQLALLPF 203 (485)
T ss_pred hhcC-hhhhccHHHHHHHHHHHHHH-------HHHHHHccHH--------hcC--CCcchHHHHHHHHHHHHHHHHHHhc
Confidence 4555 99999999999999999999 9887776654 233 5678999999999999999999999
Q ss_pred cCCChHHHHh-cCChHHHHHHHHHHhhccCCCCCC----------------cccccccccCCchhHH--HHHHHHhccee
Q psy12745 82 IPESPKFLMT-HGRSDDALDVFQSMYARNTGKPKD----------------SYPVKSLMGAPPTSIC--ALLMLFGLKEL 142 (175)
Q Consensus 82 lpESP~~L~~-~g~~~~a~~~l~~l~~~~~~~~~~----------------~~~~~~l~~~~~~~~~--~~~~~~~~~~~ 142 (175)
+|||||||+. |||.|+|++.++++++.++++.+. ..++.++++.+..++. ..+++...||+
T Consensus 204 ~PESPk~Ll~~k~~~~~A~~sl~~y~G~~~~~~~~e~~~~e~~~~~~~~~~~~sl~~~~~~~~lR~~~~i~~~v~~~qq~ 283 (485)
T KOG0569|consen 204 LPESPKYLLIKKGDEEEARKALKFYRGKEDVEAEIEEMLREIEEEELEKKKQISLRQLLKNPTLRRPLLIGIVVSFAQQF 283 (485)
T ss_pred CCCCcchHHHHcCCHHHHHHHHHHHhCCCcchhHHHHHHHHHHHhccccccCCcHHHHhcCcchhHHHHHHHHHHHHHHh
Confidence 9999999987 899999999999998876432211 1123344444333322 33445556999
Q ss_pred ecceeEeechhhHHhhhc-cCC
Q psy12745 143 TVEERVITRPTSIQEIEE-EGD 163 (175)
Q Consensus 143 ~~~~~i~~~~~~i~~~~~-~~~ 163 (175)
+|.+.+.+|.+.+++++| +.+
T Consensus 284 sGi~ai~~Yst~i~~~aG~~~~ 305 (485)
T KOG0569|consen 284 SGINAIFFYSTSIFKTAGFTPE 305 (485)
T ss_pred cCcceeHHHHHHHHHHcCCCHH
Confidence 999999999999999998 444
|
|
| >KOG0254|consensus | Back alignment and domain information |
|---|
| >PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters | Back alignment and domain information |
|---|
| >TIGR00887 2A0109 phosphate:H+ symporter | Back alignment and domain information |
|---|
| >TIGR01299 synapt_SV2 synaptic vesicle protein SV2 | Back alignment and domain information |
|---|
| >KOG0253|consensus | Back alignment and domain information |
|---|
| >KOG0255|consensus | Back alignment and domain information |
|---|
| >TIGR00898 2A0119 cation transport protein | Back alignment and domain information |
|---|
| >PRK10077 xylE D-xylose transporter XylE; Provisional | Back alignment and domain information |
|---|
| >TIGR00879 SP MFS transporter, sugar porter (SP) family | Back alignment and domain information |
|---|
| >PRK10642 proline/glycine betaine transporter; Provisional | Back alignment and domain information |
|---|
| >PRK09952 shikimate transporter; Provisional | Back alignment and domain information |
|---|
| >PRK10642 proline/glycine betaine transporter; Provisional | Back alignment and domain information |
|---|
| >PRK10406 alpha-ketoglutarate transporter; Provisional | Back alignment and domain information |
|---|
| >KOG2533|consensus | Back alignment and domain information |
|---|
| >TIGR00903 2A0129 major facilitator 4 family protein | Back alignment and domain information |
|---|
| >TIGR00891 2A0112 putative sialic acid transporter | Back alignment and domain information |
|---|
| >TIGR00883 2A0106 metabolite-proton symporter | Back alignment and domain information |
|---|
| >PRK15075 citrate-proton symporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00895 2A0115 benzoate transport | Back alignment and domain information |
|---|
| >TIGR02332 HpaX 4-hydroxyphenylacetate permease | Back alignment and domain information |
|---|
| >PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional | Back alignment and domain information |
|---|
| >KOG0252|consensus | Back alignment and domain information |
|---|
| >TIGR00901 2A0125 AmpG-related permease | Back alignment and domain information |
|---|
| >PRK03893 putative sialic acid transporter; Provisional | Back alignment and domain information |
|---|
| >PRK11902 ampG muropeptide transporter; Reviewed | Back alignment and domain information |
|---|
| >PRK11010 ampG muropeptide transporter; Validated | Back alignment and domain information |
|---|
| >TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter | Back alignment and domain information |
|---|
| >PRK12307 putative sialic acid transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00893 2A0114 d-galactonate transporter | Back alignment and domain information |
|---|
| >PRK11663 regulatory protein UhpC; Provisional | Back alignment and domain information |
|---|
| >COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK03545 putative arabinose transporter; Provisional | Back alignment and domain information |
|---|
| >PRK15403 multidrug efflux system protein MdtM; Provisional | Back alignment and domain information |
|---|
| >PTZ00207 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00899 2A0120 sugar efflux transporter | Back alignment and domain information |
|---|
| >PRK14995 methyl viologen resistance protein SmvA; Provisional | Back alignment and domain information |
|---|
| >COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00712 glpT glycerol-3-phosphate transporter | Back alignment and domain information |
|---|
| >PRK10091 MFS transport protein AraJ; Provisional | Back alignment and domain information |
|---|
| >PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins | Back alignment and domain information |
|---|
| >TIGR00880 2_A_01_02 Multidrug resistance protein | Back alignment and domain information |
|---|
| >PRK10213 nepI ribonucleoside transporter; Reviewed | Back alignment and domain information |
|---|
| >TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily | Back alignment and domain information |
|---|
| >KOG2532|consensus | Back alignment and domain information |
|---|
| >TIGR00900 2A0121 H+ Antiporter protein | Back alignment and domain information |
|---|
| >PRK12382 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK10489 enterobactin exporter EntS; Provisional | Back alignment and domain information |
|---|
| >PRK11102 bicyclomycin/multidrug efflux system; Provisional | Back alignment and domain information |
|---|
| >TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter | Back alignment and domain information |
|---|
| >PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms | Back alignment and domain information |
|---|
| >PRK15402 multidrug efflux system translocase MdfA; Provisional | Back alignment and domain information |
|---|
| >PRK05122 major facilitator superfamily transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily | Back alignment and domain information |
|---|
| >TIGR00805 oat sodium-independent organic anion transporter | Back alignment and domain information |
|---|
| >PRK11043 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK10473 multidrug efflux system protein MdtL; Provisional | Back alignment and domain information |
|---|
| >PRK11195 lysophospholipid transporter LplT; Provisional | Back alignment and domain information |
|---|
| >PRK11652 emrD multidrug resistance protein D; Provisional | Back alignment and domain information |
|---|
| >PRK09874 drug efflux system protein MdtG; Provisional | Back alignment and domain information |
|---|
| >PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00881 2A0104 phosphoglycerate transporter family protein | Back alignment and domain information |
|---|
| >PRK11646 multidrug resistance protein MdtH; Provisional | Back alignment and domain information |
|---|
| >TIGR00890 2A0111 Oxalate/Formate Antiporter | Back alignment and domain information |
|---|
| >PRK15011 sugar efflux transporter B; Provisional | Back alignment and domain information |
|---|
| >TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family | Back alignment and domain information |
|---|
| >PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters | Back alignment and domain information |
|---|
| >PRK10077 xylE D-xylose transporter XylE; Provisional | Back alignment and domain information |
|---|
| >TIGR00889 2A0110 nucleoside transporter | Back alignment and domain information |
|---|
| >TIGR00892 2A0113 monocarboxylate transporter 1 | Back alignment and domain information |
|---|
| >PLN00028 nitrate transmembrane transporter; Provisional | Back alignment and domain information |
|---|
| >PRK09556 uhpT sugar phosphate antiporter; Reviewed | Back alignment and domain information |
|---|
| >TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) | Back alignment and domain information |
|---|
| >PRK11128 putative 3-phenylpropionic acid transporter; Provisional | Back alignment and domain information |
|---|
| >PRK03699 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK15011 sugar efflux transporter B; Provisional | Back alignment and domain information |
|---|
| >KOG1330|consensus | Back alignment and domain information |
|---|
| >TIGR01299 synapt_SV2 synaptic vesicle protein SV2 | Back alignment and domain information |
|---|
| >PRK10504 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK05122 major facilitator superfamily transporter; Provisional | Back alignment and domain information |
|---|
| >PRK10054 putative transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00885 fucP L-fucose:H+ symporter permease | Back alignment and domain information |
|---|
| >PF13347 MFS_2: MFS/sugar transport protein | Back alignment and domain information |
|---|
| >PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00892 2A0113 monocarboxylate transporter 1 | Back alignment and domain information |
|---|
| >TIGR00902 2A0127 phenyl proprionate permease family protein | Back alignment and domain information |
|---|
| >cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters | Back alignment and domain information |
|---|
| >TIGR00879 SP MFS transporter, sugar porter (SP) family | Back alignment and domain information |
|---|
| >PRK10207 dipeptide/tripeptide permease B; Provisional | Back alignment and domain information |
|---|
| >TIGR00806 rfc RFC reduced folate carrier | Back alignment and domain information |
|---|
| >PRK09874 drug efflux system protein MdtG; Provisional | Back alignment and domain information |
|---|
| >PRK09584 tppB putative tripeptide transporter permease; Reviewed | Back alignment and domain information |
|---|
| >TIGR01272 gluP glucose/galactose transporter | Back alignment and domain information |
|---|
| >KOG2615|consensus | Back alignment and domain information |
|---|
| >TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter | Back alignment and domain information |
|---|
| >PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) | Back alignment and domain information |
|---|
| >TIGR00898 2A0119 cation transport protein | Back alignment and domain information |
|---|
| >TIGR00896 CynX cyanate transporter | Back alignment and domain information |
|---|
| >KOG3626|consensus | Back alignment and domain information |
|---|
| >TIGR00897 2A0118 polyol permease family | Back alignment and domain information |
|---|
| >PRK12382 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK09705 cynX putative cyanate transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00899 2A0120 sugar efflux transporter | Back alignment and domain information |
|---|
| >TIGR00893 2A0114 d-galactonate transporter | Back alignment and domain information |
|---|
| >TIGR00887 2A0109 phosphate:H+ symporter | Back alignment and domain information |
|---|
| >TIGR00890 2A0111 Oxalate/Formate Antiporter | Back alignment and domain information |
|---|
| >PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional | Back alignment and domain information |
|---|
| >TIGR00788 fbt folate/biopterin transporter | Back alignment and domain information |
|---|
| >TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial | Back alignment and domain information |
|---|
| >PRK09528 lacY galactoside permease; Reviewed | Back alignment and domain information |
|---|
| >COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00897 2A0118 polyol permease family | Back alignment and domain information |
|---|
| >PRK03633 putative MFS family transporter protein; Provisional | Back alignment and domain information |
|---|
| >PRK11462 putative transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00882 2A0105 oligosaccharide:H+ symporter | Back alignment and domain information |
|---|
| >PRK10489 enterobactin exporter EntS; Provisional | Back alignment and domain information |
|---|
| >PRK09669 putative symporter YagG; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 175 | |||
| 4gc0_A | 491 | D-xylose-proton symporter; MFS, transport protein; | 99.47 | |
| 3o7q_A | 438 | L-fucose-proton symporter; transporter, multi-PASS | 96.98 | |
| 1pw4_A | 451 | Glycerol-3-phosphate transporter; transmembrane, i | 96.84 | |
| 2gfp_A | 375 | EMRD, multidrug resistance protein D; membrane pro | 96.84 | |
| 4aps_A | 491 | DI-OR tripeptide H+ symporter; transport protein, | 95.13 | |
| 2xut_A | 524 | Proton/peptide symporter family protein; transport | 92.14 | |
| 4gc0_A | 491 | D-xylose-proton symporter; MFS, transport protein; | 91.77 | |
| 4aps_A | 491 | DI-OR tripeptide H+ symporter; transport protein, | 88.6 | |
| 1pw4_A | 451 | Glycerol-3-phosphate transporter; transmembrane, i | 87.52 |
| >4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* | Back alignment and structure |
|---|
Probab=99.47 E-value=6e-15 Score=121.69 Aligned_cols=143 Identities=15% Similarity=0.201 Sum_probs=101.1
Q ss_pred CCCCchhhHHHhHHHHhhcCCccchhHHHHHHHHHHHhccccCCcccccccccchHHHHHHhhHHHHHHHHHHhhcCCCh
Q psy12745 7 TKRDTKKIIYWRRVDWNRSHAFSHTPFVKGLVIAYFIIPIKWTYPVFDFFLMCSWRIFLIVSTFPSLAGALLVFFIPESP 86 (175)
Q Consensus 7 p~~~Rg~~~~~~~~~~~~G~~~~~~~~~l~~~i~~~~~~~~~~~~~~~~~~~~~Wr~~~~~~~i~~~~~~~~~~~lpESP 86 (175)
|+++||+..++.+.++.+|. +++.++++.......... .+.+.||+++.+..+++++.++.++++||||
T Consensus 156 p~~~rg~~~~~~~~~~~~g~-------~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~peSp 224 (491)
T 4gc0_A 156 PAHIRGKLVSFNQFAIIFGQ-------LLVYCVNYFIARSGDASW----LNTDGWRYMFASECIPALLFLMLLYTVPESP 224 (491)
T ss_dssp CGGGHHHHHHHHHHHHHHHH-------HHHHHHHHHHHTTSCTTT----TTTTHHHHHHHTTHHHHHHHHHHGGGSCCCH
T ss_pred CHHhhhhhHHhhhhhhhhhh-------hhhhhcchhhcccccccc----ccchhhHHHhhhhhhhhhhhhhhhhcCCCCh
Confidence 88899999999999999999 999999888754331111 2347899999999999999999999999999
Q ss_pred HHHHhcCChHHHHHHHHHHhhccCCCCCCcccc----------cccccCCchhHHHHHHHHhcceeecceeEeechhhHH
Q psy12745 87 KFLMTHGRSDDALDVFQSMYARNTGKPKDSYPV----------KSLMGAPPTSICALLMLFGLKELTVEERVITRPTSIQ 156 (175)
Q Consensus 87 ~~L~~~g~~~~a~~~l~~l~~~~~~~~~~~~~~----------~~l~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~i~ 156 (175)
|||..|++.|++++.+++...++..+.+..... ....................+++.+.+.+.+|.+.++
T Consensus 225 ~~L~~~~~~~~a~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 304 (491)
T 4gc0_A 225 RWLMSRGKQEQAEGILRKIMGNTLATQAVQEIKHSLDHGRKTGGRLLMFGVGVIVIGVMLSIFQQFVGINVVLYYAPEVF 304 (491)
T ss_dssp HHHHHTTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTHHHHSCCTHHHHHHHHHHHHHHTCHHHHHHHHHHHH
T ss_pred HHHHHcCchhHHHHhHHHhcCCchhHHHHHHHHHHHHhhhhhhhHHHHhcccHHHHHHHHHHHHHHhhhhHHHhcchHHH
Confidence 999999999999999998866542211110000 0000111112222222333477788888888888888
Q ss_pred hhhc
Q psy12745 157 EIEE 160 (175)
Q Consensus 157 ~~~~ 160 (175)
+..+
T Consensus 305 ~~~~ 308 (491)
T 4gc0_A 305 KTLG 308 (491)
T ss_dssp HHSS
T ss_pred HhcC
Confidence 7766
|
| >3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* | Back alignment and structure |
|---|
| >1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 | Back alignment and structure |
|---|
| >2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} | Back alignment and structure |
|---|
| >4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* | Back alignment and structure |
|---|
| >4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 175 | |||
| d1pw4a_ | 447 | Glycerol-3-phosphate transporter {Escherichia coli | 96.65 | |
| d1pv7a_ | 417 | Lactose permease {Escherichia coli [TaxId: 562]} | 93.02 |
| >d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: MFS general substrate transporter superfamily: MFS general substrate transporter family: Glycerol-3-phosphate transporter domain: Glycerol-3-phosphate transporter species: Escherichia coli [TaxId: 562]
Probab=96.65 E-value=0.00017 Score=55.65 Aligned_cols=64 Identities=9% Similarity=0.162 Sum_probs=47.7
Q ss_pred CCCCchhhHHHhHHHHhhcCCccchhHHHHHHHHHHHhccccCCcccccccccchHHHHHHhhHHHHHH-HHHHhhcCCC
Q psy12745 7 TKRDTKKIIYWRRVDWNRSHAFSHTPFVKGLVIAYFIIPIKWTYPVFDFFLMCSWRIFLIVSTFPSLAG-ALLVFFIPES 85 (175)
Q Consensus 7 p~~~Rg~~~~~~~~~~~~G~~~~~~~~~l~~~i~~~~~~~~~~~~~~~~~~~~~Wr~~~~~~~i~~~~~-~~~~~~lpES 85 (175)
|+++|++..++.+.++.+|. ++++.++...... ..+||+.+++.+++.++. ++...+++|+
T Consensus 146 ~~~~r~~~~~~~~~~~~~g~-------~i~~~~~~~~~~~-----------~~~w~~~~~~~~~~~~~~~~~~~~~~~~~ 207 (447)
T d1pw4a_ 146 SQKERGGIVSVWNCAHNVGG-------GIPPLLFLLGMAW-----------FNDWHAALYMPAFCAILVALFAFAMMRDT 207 (447)
T ss_dssp TTTHHHHHHHHHHHHHHHHH-------TSHHHHHHHHHHH-----------TCCSTTCTHHHHHHHHHHHHHHHHHCCCS
T ss_pred Hhhcccccccccccccchhh-------hhhhhhhhhHhhh-----------hhcccccchhhhhhHHHHHHHHHHhcccc
Confidence 78899999999999999998 7777666554332 258999888887776664 4456667787
Q ss_pred hHH
Q psy12745 86 PKF 88 (175)
Q Consensus 86 P~~ 88 (175)
|+.
T Consensus 208 ~~~ 210 (447)
T d1pw4a_ 208 PQS 210 (447)
T ss_dssp STT
T ss_pred hhh
Confidence 754
|
| >d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|