Psyllid ID: psy12758

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MSYESNQNGTGLEQQLAGLDLSAKKESAPGSNPRVYVPPHLRNQPSGGRNSTDTFLLPLPPQFDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAFLVPILNQMYERGPLPTPPAGRGYPSRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVYGGSNVGDQMRDLDRGCHLLVATPGRLVDMLERGKIGLANCRFLVLDEADRMLDMGFEPQIRCIVQENGMPRTGDRQTLMFSATFPKEIQ
ccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEcccHHHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHccccEEEEcccHHHHHHHcccccccccEEEEEEccccccccccHHHHHHHHccccccccccccEEEEEcccccccc
cccccccccccccccccccccccccHccccccccccccccccccccccEEEccccccccccccccccHHHHHHHHHHHccccccccHHHcEHHHHHccccHHHEccccccHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEcccHHHHHHHHHHHHHHHHHccccccccccccccEEEEEccHHHHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHccccEEEEccccHHHHHHcccccHHHHHEEEHHHHHHHHHccccHHHHHHEcccccccccccEEEEEEccccHHcc
msyesnqngtglEQQLAGldlsakkesapgsnprvyvpphlrnqpsggrnstdtfllplppqfddiqMTEIITNNialarydkptpvqkyaIPVIIsgrdvmacaqtgsgktaAFLVPILNQmyergplptppagrgypsrkkvfplglvlapTRELATQIYDEAKKFAyrsqlrpcvvrkkvfplglvlapTRELATQIYDEAKKFAyrsqlrpcvvyggsnvgdqmrdldrgchllvatpgRLVDMLERgkiglancrFLVLDEADRMLDMGFEPQIRCivqengmprtgdrqtlmfsatfpkeiq
msyesnqngtglEQQLAGLDLSAKKESAPGSNPRVYVPPHLRNQPSGGRNSTDTFLLPLPPQFDDIQMTEIITNNIalarydkptpvQKYAIPVIISGRDVMACAQTGSGKTAAFLVPILNQMYERGPLPTPPAGRGYPSRKKVFPLGLVLAPTRELATQIYDEAKKfayrsqlrpcvvrKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVYGGSNVGDQMRDLDRGCHLLVATPGRLVDMLERGKIGLANCRFLVLDEADRMLDMGFEPQIRCIvqengmprtgdrqtlmfsatfpkeiq
MSYESNQNGTGLEQQLAGLDLSAKKESAPGSNPRVYVPPHLRNQPSGGRNSTDTFLLPLPPQFDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAFLVPILNQMYERGPLPTPPAGRGYPSRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVYGGSNVGDQMRDLDRGCHLLVATPGRLVDMLERGKIGLANCRFLVLDEADRMLDMGFEPQIRCIVQENGMPRTGDRQTLMFSATFPKEIQ
*****************************************************TFLLPLPPQFDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAFLVPILNQMYER**************RKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVYGGSNVGDQMRDLDRGCHLLVATPGRLVDMLERGKIGLANCRFLVLDEADRMLDMGFEPQIRCIVQE***********************
************************************VPPHL************TFLLPLPPQFDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAFLVPILNQMYERG**************KKVFPLGLVLAPTRELATQIYDEAKK**********VVRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVYGGSNVGDQMRDLDRGCHLLVATPGRLVDMLERGKIGLANCRFLVLDEADRMLDMGFEPQIRCIVQENGMPRTGDRQTLMFSATFPKEIQ
**********GLEQQLAGLDLS*********NPRVYVPPHLRNQPSGGRNSTDTFLLPLPPQFDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAFLVPILNQMYERGPLPTPPAGRGYPSRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVYGGSNVGDQMRDLDRGCHLLVATPGRLVDMLERGKIGLANCRFLVLDEADRMLDMGFEPQIRCIVQENGMPRTGDRQTLMFSATFPKEIQ
*********************************RVYVPPHLRNQPSGGRNSTDTFLLPLPPQFDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAFLVPILNQMYERGPL************KKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVYGGSNVGDQMRDLDRGCHLLVATPGRLVDMLERGKIGLANCRFLVLDEADRMLDMGFEPQIRCIVQENGMPRTGDRQTLMFSATFPKEIQ
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSYESNQNGTGLEQQLAGLDLSAKKESAPGSNPRVYVPPHLRNQPSGGRNSTDTFLLPLPPQFDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAFLVPILNQMYERGPLPTPPAGRGYPSRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVYGGSNVGDQMRDLDRGCHLLVATPGRLVDMLERGKIGLANCRFLVLDEADRMLDMGFEPQIRCIVQENGMPRTGDRQTLMFSATFPKEIQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query308 2.2.26 [Sep-21-2011]
Q9VHP0 798 ATP-dependent RNA helicas yes N/A 0.681 0.263 0.640 2e-87
P24346 697 Putative ATP-dependent RN N/A N/A 0.694 0.307 0.597 2e-79
P16381 660 Putative ATP-dependent RN yes N/A 0.694 0.324 0.585 4e-78
Q5RF43 658 ATP-dependent RNA helicas no N/A 0.717 0.335 0.548 5e-78
O15523 660 ATP-dependent RNA helicas no N/A 0.717 0.334 0.548 6e-78
O00571 662 ATP-dependent RNA helicas yes N/A 0.694 0.323 0.581 6e-78
Q6GVM6 660 ATP-dependent RNA helicas yes N/A 0.717 0.334 0.548 1e-77
Q62167 662 ATP-dependent RNA helicas no N/A 0.694 0.323 0.581 2e-77
Q62095 658 ATP-dependent RNA helicas no N/A 0.694 0.325 0.581 1e-76
Q6CB69 618 ATP-dependent RNA helicas yes N/A 0.652 0.325 0.561 2e-74
>sp|Q9VHP0|DDX3_DROME ATP-dependent RNA helicase bel OS=Drosophila melanogaster GN=bel PE=1 SV=1 Back     alignment and function desciption
 Score =  322 bits (826), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 162/253 (64%), Positives = 188/253 (74%), Gaps = 43/253 (16%)

Query: 59  LPPQ---FDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAF 115
           +PP    FDD+Q+TEII NN+ALARYDKPTPVQK+AIP+II+GRD+MACAQTGSGKTAAF
Sbjct: 290 VPPNITSFDDVQLTEIIRNNVALARYDKPTPVQKHAIPIIINGRDLMACAQTGSGKTAAF 349

Query: 116 LVPILNQMYERGPLPTPPAGRGYPSRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLR 175
           LVPILNQMYE G +P P + R Y                                     
Sbjct: 350 LVPILNQMYELGHVPPPQSTRQYS------------------------------------ 373

Query: 176 PCVVRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVYGGSNVGDQMRDLDRGC 235
               R+K +PLGLVLAPTRELATQI++EAKKFAYRS++RP V+YGG+N  +QMR+LDRGC
Sbjct: 374 ----RRKQYPLGLVLAPTRELATQIFEEAKKFAYRSRMRPAVLYGGNNTSEQMRELDRGC 429

Query: 236 HLLVATPGRLVDMLERGKIGLANCRFLVLDEADRMLDMGFEPQIRCIVQENGMPRTGDRQ 295
           HL+VATPGRL DM+ RGK+GL N RFLVLDEADRMLDMGFEPQIR IV++  MP TG RQ
Sbjct: 430 HLIVATPGRLEDMITRGKVGLENIRFLVLDEADRMLDMGFEPQIRRIVEQLNMPPTGQRQ 489

Query: 296 TLMFSATFPKEIQ 308
           TLMFSATFPK+IQ
Sbjct: 490 TLMFSATFPKQIQ 502
ATP-dependent RNA helicase that is essential and required for cellular function, larval growth, and for male and female fertility. Also required for RNA interference (RNAi), double-stranded RNA induces potent and specific gene silencing, by acting downstream of dsRNA internalization. RNAi is mediated by the RNA-induced silencing complex (RISC), a sequence-specific, multicomponent nuclease that destroys or silences messenger RNAs homologous to the silencing trigger.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|P24346|DDX3_XENLA Putative ATP-dependent RNA helicase an3 OS=Xenopus laevis GN=an3 PE=2 SV=1 Back     alignment and function description
>sp|P16381|DDX3L_MOUSE Putative ATP-dependent RNA helicase Pl10 OS=Mus musculus GN=D1Pas1 PE=1 SV=1 Back     alignment and function description
>sp|Q5RF43|DDX3Y_PONAB ATP-dependent RNA helicase DDX3Y OS=Pongo abelii GN=DDX3Y PE=2 SV=1 Back     alignment and function description
>sp|O15523|DDX3Y_HUMAN ATP-dependent RNA helicase DDX3Y OS=Homo sapiens GN=DDX3Y PE=1 SV=2 Back     alignment and function description
>sp|O00571|DDX3X_HUMAN ATP-dependent RNA helicase DDX3X OS=Homo sapiens GN=DDX3X PE=1 SV=3 Back     alignment and function description
>sp|Q6GVM6|DDX3Y_PANTR ATP-dependent RNA helicase DDX3Y OS=Pan troglodytes GN=DDX3Y PE=2 SV=1 Back     alignment and function description
>sp|Q62167|DDX3X_MOUSE ATP-dependent RNA helicase DDX3X OS=Mus musculus GN=Ddx3x PE=1 SV=3 Back     alignment and function description
>sp|Q62095|DDX3Y_MOUSE ATP-dependent RNA helicase DDX3Y OS=Mus musculus GN=Ddx3y PE=1 SV=2 Back     alignment and function description
>sp|Q6CB69|DED1_YARLI ATP-dependent RNA helicase DED1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DED1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query308
322794838 586 hypothetical protein SINV_13785 [Solenop 0.681 0.358 0.675 7e-90
332028827 704 ATP-dependent RNA helicase bel [Acromyrm 0.681 0.298 0.675 2e-89
307200175 611 ATP-dependent RNA helicase bel [Harpegna 0.665 0.335 0.678 1e-88
383847715 711 PREDICTED: putative ATP-dependent RNA he 0.681 0.295 0.671 1e-88
110760457 701 PREDICTED: putative ATP-dependent RNA he 0.675 0.296 0.667 2e-88
307182555 692 ATP-dependent RNA helicase bel [Camponot 0.681 0.303 0.667 3e-88
380017597 701 PREDICTED: LOW QUALITY PROTEIN: putative 0.675 0.296 0.667 4e-88
350408815 700 PREDICTED: putative ATP-dependent RNA he 0.675 0.297 0.664 6e-88
340719243 700 PREDICTED: putative ATP-dependent RNA he 0.675 0.297 0.664 1e-87
321459317 738 hypothetical protein DAPPUDRAFT_328137 [ 0.668 0.279 0.668 4e-87
>gi|322794838|gb|EFZ17785.1| hypothetical protein SINV_13785 [Solenopsis invicta] Back     alignment and taxonomy information
 Score =  336 bits (862), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 171/253 (67%), Positives = 188/253 (74%), Gaps = 43/253 (16%)

Query: 59  LPPQ---FDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAF 115
           +PP    FD++++TEII N+IALA YDKPTPVQKYAIP+II  RDVMACAQTGSGKTAAF
Sbjct: 164 IPPHITSFDEVKLTEIIKNSIALAGYDKPTPVQKYAIPIIIERRDVMACAQTGSGKTAAF 223

Query: 116 LVPILNQMYERGPLPTPPAGRGYPSRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLR 175
           LVPILNQ+YE GP P PP                                          
Sbjct: 224 LVPILNQIYESGPRPPPPQAN--------------------------------------- 244

Query: 176 PCVVRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVYGGSNVGDQMRDLDRGC 235
               R+K +PLGLVLAPTRELATQIYDEA+KFAYRS++RP VVYGGSN+ DQMR+LDRGC
Sbjct: 245 -SSSRRKQYPLGLVLAPTRELATQIYDEARKFAYRSRMRPAVVYGGSNIVDQMRELDRGC 303

Query: 236 HLLVATPGRLVDMLERGKIGLANCRFLVLDEADRMLDMGFEPQIRCIVQENGMPRTGDRQ 295
           HLLVATPGRLVDML RGKIGL NCRFLVLDEADRMLDMGFEPQIR IVQE+ MP TG+RQ
Sbjct: 304 HLLVATPGRLVDMLGRGKIGLHNCRFLVLDEADRMLDMGFEPQIRRIVQEDNMPPTGERQ 363

Query: 296 TLMFSATFPKEIQ 308
           TLMFSATFPKEIQ
Sbjct: 364 TLMFSATFPKEIQ 376

Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|332028827|gb|EGI68856.1| ATP-dependent RNA helicase bel [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307200175|gb|EFN80473.1| ATP-dependent RNA helicase bel [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383847715|ref|XP_003699498.1| PREDICTED: putative ATP-dependent RNA helicase an3-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|110760457|ref|XP_391829.3| PREDICTED: putative ATP-dependent RNA helicase Pl10 [Apis mellifera] Back     alignment and taxonomy information
>gi|307182555|gb|EFN69748.1| ATP-dependent RNA helicase bel [Camponotus floridanus] Back     alignment and taxonomy information
>gi|380017597|ref|XP_003692739.1| PREDICTED: LOW QUALITY PROTEIN: putative ATP-dependent RNA helicase Pl10-like [Apis florea] Back     alignment and taxonomy information
>gi|350408815|ref|XP_003488524.1| PREDICTED: putative ATP-dependent RNA helicase Pl10-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340719243|ref|XP_003398065.1| PREDICTED: putative ATP-dependent RNA helicase Pl10-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|321459317|gb|EFX70372.1| hypothetical protein DAPPUDRAFT_328137 [Daphnia pulex] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query308
FB|FBgn0263231 798 bel "belle" [Drosophila melano 0.418 0.161 0.775 2.1e-60
ZFIN|ZDB-GENE-030131-1565 709 ddx3 "DEAD (Asp-Glu-Ala-Asp) b 0.422 0.183 0.776 2.9e-60
MGI|MGI:91842 660 D1Pas1 "DNA segment, Chr 1, Pa 0.493 0.230 0.666 4.8e-60
UNIPROTKB|G5E631 661 DDX3X "Uncharacterized protein 0.493 0.229 0.666 7.8e-60
UNIPROTKB|E2RRQ7 706 DDX3X "Uncharacterized protein 0.493 0.215 0.666 7.8e-60
UNIPROTKB|J9P0V9 662 DDX3X "Uncharacterized protein 0.493 0.229 0.666 7.8e-60
UNIPROTKB|O00571 662 DDX3X "ATP-dependent RNA helic 0.493 0.229 0.666 7.8e-60
UNIPROTKB|F1RX16 661 DDX3X "Uncharacterized protein 0.493 0.229 0.666 7.8e-60
MGI|MGI:103064 662 Ddx3x "DEAD/H (Asp-Glu-Ala-Asp 0.493 0.229 0.666 1.6e-59
RGD|1564771 662 Ddx3x "DEAD (Asp-Glu-Ala-Asp) 0.493 0.229 0.666 2e-59
FB|FBgn0263231 bel "belle" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 533 (192.7 bits), Expect = 2.1e-60, Sum P(2) = 2.1e-60
 Identities = 100/129 (77%), Positives = 116/129 (89%)

Query:   180 RKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVYGGSNVGDQMRDLDRGCHLLV 239
             R+K +PLGLVLAPTRELATQI++EAKKFAYRS++RP V+YGG+N  +QMR+LDRGCHL+V
Sbjct:   374 RRKQYPLGLVLAPTRELATQIFEEAKKFAYRSRMRPAVLYGGNNTSEQMRELDRGCHLIV 433

Query:   240 ATPGRLVDMLERGKIGLANCRFLVLDEADRMLDMGFEPQIRCIVQENGMPRTGDRQTLMF 299
             ATPGRL DM+ RGK+GL N RFLVLDEADRMLDMGFEPQIR IV++  MP TG RQTLMF
Sbjct:   434 ATPGRLEDMITRGKVGLENIRFLVLDEADRMLDMGFEPQIRRIVEQLNMPPTGQRQTLMF 493

Query:   300 SATFPKEIQ 308
             SATFPK+IQ
Sbjct:   494 SATFPKQIQ 502
GO:0007286 "spermatid development" evidence=IMP
GO:0008026 "ATP-dependent helicase activity" evidence=ISS
GO:0004004 "ATP-dependent RNA helicase activity" evidence=ISS;IMP
GO:0005524 "ATP binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0043186 "P granule" evidence=IDA
GO:0007283 "spermatogenesis" evidence=IMP
GO:0002168 "instar larval development" evidence=IMP
GO:0048477 "oogenesis" evidence=IMP
GO:0016442 "RNA-induced silencing complex" evidence=IDA
GO:0016246 "RNA interference" evidence=IMP
GO:0005811 "lipid particle" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0043025 "neuronal cell body" evidence=IDA
GO:0010468 "regulation of gene expression" evidence=IMP
GO:0000070 "mitotic sister chromatid segregation" evidence=IMP
ZFIN|ZDB-GENE-030131-1565 ddx3 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:91842 D1Pas1 "DNA segment, Chr 1, Pasteur Institute 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|G5E631 DDX3X "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RRQ7 DDX3X "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P0V9 DDX3X "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O00571 DDX3X "ATP-dependent RNA helicase DDX3X" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RX16 DDX3X "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:103064 Ddx3x "DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 3, X-linked" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1564771 Ddx3x "DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6GVM6DDX3Y_PANTR3, ., 6, ., 4, ., 1, 30.54800.71750.3348yesN/A
P0CQ74DED1_CRYNJ3, ., 6, ., 4, ., 1, 30.54650.68500.3312yesN/A
Q9VHP0DDX3_DROME3, ., 6, ., 4, ., 1, 30.64030.68180.2631yesN/A
Q6BU54DED1_DEBHA3, ., 6, ., 4, ., 1, 30.54200.64280.3142yesN/A
Q75B50DED1_ASHGO3, ., 6, ., 4, ., 1, 30.53110.64930.3210yesN/A
Q6CLR3DED1_KLULA3, ., 6, ., 4, ., 1, 30.53130.63960.3141yesN/A
A2QI25DED1_ASPNC3, ., 6, ., 4, ., 1, 30.53250.68180.3097yesN/A
Q6CB69DED1_YARLI3, ., 6, ., 4, ., 1, 30.56190.65250.3252yesN/A
Q2UGK3DED1_ASPOR3, ., 6, ., 4, ., 1, 30.53650.68180.3111yesN/A
P16381DDX3L_MOUSE3, ., 6, ., 4, ., 1, 30.58560.69480.3242yesN/A
Q6FP38DBP1_CANGA3, ., 6, ., 4, ., 1, 30.54350.65250.3327yesN/A
A3LQ01DED1_PICST3, ., 6, ., 4, ., 1, 30.53520.65250.3106yesN/A
Q4I7K4DED1_GIBZE3, ., 6, ., 4, ., 1, 30.52630.67850.3096yesN/A
O13370DED1_SCHPO3, ., 6, ., 4, ., 1, 30.52320.62980.3050yesN/A
Q54QS3DDX3_DICDI3, ., 6, ., 4, ., 1, 30.50400.66880.2893yesN/A
P24784DBP1_YEAST3, ., 6, ., 4, ., 1, 30.54350.65250.3257yesN/A
Q4WP13DED1_ASPFU3, ., 6, ., 4, ., 1, 30.53650.68180.3115yesN/A
O00571DDX3X_HUMAN3, ., 6, ., 4, ., 1, 30.58160.69480.3232yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.40.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query308
cd00268203 cd00268, DEADc, DEAD-box helicases 2e-89
COG0513 513 COG0513, SrmB, Superfamily II DNA and RNA helicase 6e-76
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 2e-54
PTZ00110 545 PTZ00110, PTZ00110, helicase; Provisional 2e-50
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 2e-46
PRK11776 460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 5e-46
PRK10590 456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 7e-45
PRK11192 434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 1e-39
PLN00206 518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 8e-39
PRK01297 475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 9e-39
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 2e-37
PRK04837 423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 1e-36
PRK04537 572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 3e-35
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 2e-33
PTZ00424 401 PTZ00424, PTZ00424, helicase 45; Provisional 5e-30
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 8e-13
PRK13767 876 PRK13767, PRK13767, ATP-dependent helicase; Provis 1e-09
COG1204 766 COG1204, COG1204, Superfamily II helicase [General 2e-07
COG1205 851 COG1205, COG1205, Distinct helicase family with a 8e-07
pfam04851100 pfam04851, ResIII, Type III restriction enzyme, re 8e-04
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information 
 Score =  265 bits (679), Expect = 2e-89
 Identities = 102/246 (41%), Positives = 142/246 (57%), Gaps = 57/246 (23%)

Query: 63  FDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAFLVPILNQ 122
           F+++ ++  +   I    ++KPTP+Q  AIP ++SGRDV+  AQTGSGKTAAFL+PIL +
Sbjct: 1   FEELGLSPELLRGIYALGFEKPTPIQARAIPPLLSGRDVIGQAQTGSGKTAAFLIPILEK 60

Query: 123 MYERGPLPTPPAGRGYPSRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVRKK 182
           +        P A                                                
Sbjct: 61  LDPSPKKDGPQA------------------------------------------------ 72

Query: 183 VFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVYGGSNVGDQMRDLDRGCHLLVATP 242
                L+LAPTRELA QI + A+K    + L+  V+YGG+++  Q+R L RG H++VATP
Sbjct: 73  -----LILAPTRELALQIAEVARKLGKHTNLKVVVIYGGTSIDKQIRKLKRGPHIVVATP 127

Query: 243 GRLVDMLERGKIGLANCRFLVLDEADRMLDMGFEPQIRCIVQENGMPRTGDRQTLMFSAT 302
           GRL+D+LERGK+ L+  ++LVLDEADRMLDMGFE QIR I++   +P+  DRQTL+FSAT
Sbjct: 128 GRLLDLLERGKLDLSKVKYLVLDEADRMLDMGFEDQIREILKL--LPK--DRQTLLFSAT 183

Query: 303 FPKEIQ 308
            PKE++
Sbjct: 184 MPKEVR 189

A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP- binding region. Length = 203
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|237497 PRK13767, PRK13767, ATP-dependent helicase; Provisional Back     alignment and domain information
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|218292 pfam04851, ResIII, Type III restriction enzyme, res subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 308
KOG0331|consensus 519 100.0
KOG0330|consensus 476 100.0
KOG0338|consensus 691 100.0
KOG0335|consensus 482 100.0
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
PTZ00110 545 helicase; Provisional 100.0
KOG0342|consensus 543 100.0
KOG0339|consensus 731 100.0
KOG0345|consensus 567 100.0
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0348|consensus 708 100.0
KOG0336|consensus 629 100.0
KOG0341|consensus 610 100.0
KOG0343|consensus 758 100.0
PLN00206 518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
KOG0340|consensus 442 100.0
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 100.0
KOG0347|consensus 731 100.0
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 100.0
KOG0346|consensus 569 100.0
KOG0333|consensus 673 100.0
KOG0326|consensus 459 100.0
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 100.0
KOG0328|consensus 400 100.0
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 100.0
KOG0334|consensus 997 100.0
PRK01297 475 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0337|consensus 529 100.0
PTZ00424 401 helicase 45; Provisional 100.0
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 100.0
KOG4284|consensus 980 100.0
KOG0327|consensus 397 100.0
KOG0329|consensus 387 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
PRK02362 737 ski2-like helicase; Provisional 99.97
KOG0350|consensus 620 99.97
PRK00254 720 ski2-like helicase; Provisional 99.97
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.97
PRK13767 876 ATP-dependent helicase; Provisional 99.96
KOG0332|consensus 477 99.96
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.96
PRK01172 674 ski2-like helicase; Provisional 99.96
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.95
KOG0344|consensus 593 99.95
PRK09401 1176 reverse gyrase; Reviewed 99.95
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.93
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.93
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.93
PRK14701 1638 reverse gyrase; Provisional 99.92
KOG0349|consensus 725 99.92
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.92
COG1205 851 Distinct helicase family with a unique C-terminal 99.92
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.91
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.91
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 99.91
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 99.9
PRK10689 1147 transcription-repair coupling factor; Provisional 99.9
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 99.9
COG1204 766 Superfamily II helicase [General function predicti 99.9
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.9
smart00487201 DEXDc DEAD-like helicases superfamily. 99.88
COG1202 830 Superfamily II helicase, archaea-specific [General 99.86
PHA02558 501 uvsW UvsW helicase; Provisional 99.86
KOG0952|consensus 1230 99.85
PHA02653 675 RNA helicase NPH-II; Provisional 99.85
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.81
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.8
TIGR01587 358 cas3_core CRISPR-associated helicase Cas3. This mo 99.8
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.79
PRK13766 773 Hef nuclease; Provisional 99.79
TIGR03158 357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.79
PRK05580 679 primosome assembly protein PriA; Validated 99.78
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 99.78
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.78
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.76
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.76
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.76
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.75
KOG0354|consensus 746 99.73
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.72
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.71
KOG0947|consensus 1248 99.65
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.65
PRK09694 878 helicase Cas3; Provisional 99.65
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.64
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 99.64
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.63
KOG0951|consensus 1674 99.6
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.58
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.57
KOG0352|consensus 641 99.56
TIGR00595 505 priA primosomal protein N'. All proteins in this f 99.54
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 99.53
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 99.52
KOG0351|consensus 941 99.51
KOG0948|consensus 1041 99.51
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.51
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.5
smart00488289 DEXDc2 DEAD-like helicases superfamily. 99.49
smart00489289 DEXDc3 DEAD-like helicases superfamily. 99.49
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 99.47
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.46
KOG0950|consensus 1008 99.45
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.43
KOG0353|consensus 695 99.42
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 99.39
KOG0949|consensus 1330 99.35
TIGR00348 667 hsdR type I site-specific deoxyribonuclease, HsdR 99.35
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.26
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.23
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.22
COG4098 441 comFA Superfamily II DNA/RNA helicase required for 99.22
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 99.21
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 99.18
PRK12326 764 preprotein translocase subunit SecA; Reviewed 99.13
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 99.12
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.11
PF00176 299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 99.11
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 99.1
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 99.08
COG4096 875 HsdR Type I site-specific restriction-modification 99.07
COG1198 730 PriA Primosomal protein N' (replication factor Y) 99.0
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 99.0
CHL00122 870 secA preprotein translocase subunit SecA; Validate 98.99
PRK04914 956 ATP-dependent helicase HepA; Validated 98.87
KOG1132|consensus 945 98.87
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 98.86
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 98.83
KOG0920|consensus 924 98.83
PRK15483 986 type III restriction-modification system StyLTI en 98.77
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 98.68
KOG0951|consensus 1674 98.66
KOG2340|consensus 698 98.66
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 98.62
COG4889 1518 Predicted helicase [General function prediction on 98.58
KOG0922|consensus 674 98.51
KOG0926|consensus 1172 98.5
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 98.42
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 98.42
KOG1123|consensus 776 98.4
COG0610 962 Type I site-specific restriction-modification syst 98.37
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 98.29
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 98.29
PRK14873 665 primosome assembly protein PriA; Provisional 98.27
PF06862 442 DUF1253: Protein of unknown function (DUF1253); In 98.25
KOG0385|consensus 971 98.2
COG3587 985 Restriction endonuclease [Defense mechanisms] 98.15
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 98.15
KOG0952|consensus 1230 98.12
PF09848 352 DUF2075: Uncharacterized conserved protein (DUF207 98.11
KOG0925|consensus 699 98.08
KOG0390|consensus 776 98.08
KOG0923|consensus 902 98.01
KOG0924|consensus 1042 98.01
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 97.99
PRK10536262 hypothetical protein; Provisional 97.98
PRK10875 615 recD exonuclease V subunit alpha; Provisional 97.98
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 97.96
KOG1133|consensus 821 97.95
KOG0387|consensus 923 97.93
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 97.87
TIGR01447 586 recD exodeoxyribonuclease V, alpha subunit. This f 97.87
KOG1803|consensus 649 97.81
TIGR00376 637 DNA helicase, putative. The gene product may repre 97.8
TIGR01448 720 recD_rel helicase, putative, RecD/TraA family. Thi 97.74
KOG0384|consensus 1373 97.71
KOG0389|consensus 941 97.66
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 97.61
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 97.61
KOG4439|consensus 901 97.59
KOG1802|consensus 935 97.58
PF1324576 AAA_19: Part of AAA domain 97.56
KOG1131|consensus 755 97.55
KOG0392|consensus 1549 97.53
KOG1002|consensus 791 97.45
PRK13889 988 conjugal transfer relaxase TraA; Provisional 97.43
KOG1000|consensus 689 97.42
PRK06526254 transposase; Provisional 97.37
KOG0391|consensus 1958 97.37
TIGR02768 744 TraA_Ti Ti-type conjugative transfer relaxase TraA 97.36
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.36
KOG0331|consensus519 97.34
PF00580 315 UvrD-helicase: UvrD/REP helicase N-terminal domain 97.33
PRK06893229 DNA replication initiation factor; Validated 97.3
PF05970 364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 97.29
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.22
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.21
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 97.18
PRK08727233 hypothetical protein; Validated 97.15
PRK05642234 DNA replication initiation factor; Validated 97.13
KOG4150|consensus 1034 97.07
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 97.04
PRK08181269 transposase; Validated 97.03
PRK08084235 DNA replication initiation factor; Provisional 97.03
PRK06835329 DNA replication protein DnaC; Validated 96.98
KOG0989|consensus346 96.98
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 96.98
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 96.97
KOG1805|consensus 1100 96.96
PRK06921266 hypothetical protein; Provisional 96.86
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.86
PRK13826 1102 Dtr system oriT relaxase; Provisional 96.85
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 96.83
PRK08903227 DnaA regulatory inactivator Hda; Validated 96.82
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 96.79
PRK04296190 thymidine kinase; Provisional 96.78
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 96.77
PRK12377248 putative replication protein; Provisional 96.77
PHA02533 534 17 large terminase protein; Provisional 96.75
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 96.73
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 96.66
PRK04195 482 replication factor C large subunit; Provisional 96.66
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 96.62
PF00004132 AAA: ATPase family associated with various cellula 96.61
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 96.6
PRK07952244 DNA replication protein DnaC; Validated 96.6
PRK11331459 5-methylcytosine-specific restriction enzyme subun 96.59
smart00382148 AAA ATPases associated with a variety of cellular 96.58
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 96.57
PHA02544316 44 clamp loader, small subunit; Provisional 96.57
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 96.53
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 96.52
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 96.49
PLN03025319 replication factor C subunit; Provisional 96.46
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 96.45
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 96.43
PRK12402337 replication factor C small subunit 2; Reviewed 96.42
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 96.41
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 96.39
PRK08116268 hypothetical protein; Validated 96.38
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 96.36
PRK05707328 DNA polymerase III subunit delta'; Validated 96.35
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 96.35
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 96.34
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 96.33
KOG0991|consensus333 96.33
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 96.32
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 96.31
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 96.29
PF03354 477 Terminase_1: Phage Terminase ; InterPro: IPR005021 96.27
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 96.26
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 96.26
PRK12422 445 chromosomal replication initiation protein; Provis 96.23
KOG0742|consensus630 96.22
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 96.22
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 96.22
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 96.2
PRK14087 450 dnaA chromosomal replication initiation protein; P 96.19
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 96.15
PRK00149450 dnaA chromosomal replication initiation protein; R 96.14
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 96.13
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.12
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 96.06
PRK00411 394 cdc6 cell division control protein 6; Reviewed 96.05
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 96.04
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 96.04
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 96.04
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 96.02
PRK14086 617 dnaA chromosomal replication initiation protein; P 96.02
PTZ00112 1164 origin recognition complex 1 protein; Provisional 96.02
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 96.01
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 95.96
TIGR01547 396 phage_term_2 phage terminase, large subunit, PBSX 95.96
KOG0388|consensus 1185 95.94
cd01124187 KaiC KaiC is a circadian clock protein primarily f 95.93
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 95.93
TIGR00362405 DnaA chromosomal replication initiator protein Dna 95.93
COG1484254 DnaC DNA replication protein [DNA replication, rec 95.92
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 95.9
PRK14974336 cell division protein FtsY; Provisional 95.88
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 95.86
PRK14088 440 dnaA chromosomal replication initiation protein; P 95.85
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.82
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 95.81
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 95.74
PRK09183259 transposase/IS protein; Provisional 95.72
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 95.71
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 95.69
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 95.69
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 95.68
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 95.67
KOG0921|consensus 1282 95.63
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 95.63
COG0553 866 HepA Superfamily II DNA/RNA helicases, SNF2 family 95.57
COG1444 758 Predicted P-loop ATPase fused to an acetyltransfer 95.49
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 95.47
PRK07940 394 DNA polymerase III subunit delta'; Validated 95.47
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 95.44
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 95.39
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 95.38
KOG0741|consensus744 95.37
COG0593 408 DnaA ATPase involved in DNA replication initiation 95.37
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 95.35
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 95.35
PRK13894319 conjugal transfer ATPase TrbB; Provisional 95.35
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 95.34
KOG0953|consensus 700 95.33
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 95.3
PRK11054 684 helD DNA helicase IV; Provisional 95.22
KOG0344|consensus593 95.2
PRK00440319 rfc replication factor C small subunit; Reviewed 95.2
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 95.19
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 95.14
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 95.13
PF13173128 AAA_14: AAA domain 95.1
PRK05298 652 excinuclease ABC subunit B; Provisional 95.08
PRK07471 365 DNA polymerase III subunit delta'; Validated 95.06
PRK08939306 primosomal protein DnaI; Reviewed 95.01
PRK07993334 DNA polymerase III subunit delta'; Validated 95.01
PF03969 362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 94.99
COG0470325 HolB ATPase involved in DNA replication [DNA repli 94.95
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 94.93
PRK06964 342 DNA polymerase III subunit delta'; Validated 94.92
PHA03333 752 putative ATPase subunit of terminase; Provisional 94.88
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 94.86
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 94.83
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 94.82
PRK13833323 conjugal transfer protein TrbB; Provisional 94.81
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 94.69
PRK08699325 DNA polymerase III subunit delta'; Validated 94.66
TIGR02688449 conserved hypothetical protein TIGR02688. Members 94.64
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 94.6
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 94.59
PRK09112351 DNA polymerase III subunit delta'; Validated 94.57
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 94.56
KOG0298|consensus 1394 94.55
PRK06871325 DNA polymerase III subunit delta'; Validated 94.48
CHL00181287 cbbX CbbX; Provisional 94.47
KOG0386|consensus 1157 94.46
PRK11823 446 DNA repair protein RadA; Provisional 94.43
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 94.31
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 94.31
PRK06090319 DNA polymerase III subunit delta'; Validated 94.29
PRK08533230 flagellar accessory protein FlaH; Reviewed 94.29
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 94.25
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 94.25
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 94.24
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 94.23
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 94.21
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 94.17
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 94.14
PHA03368 738 DNA packaging terminase subunit 1; Provisional 94.12
KOG0338|consensus 691 94.12
COG3973 747 Superfamily I DNA and RNA helicases [General funct 94.1
cd01126 384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 94.04
PRK10689 1147 transcription-repair coupling factor; Provisional 94.01
KOG0733|consensus802 93.95
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 93.92
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 93.89
PRK13764 602 ATPase; Provisional 93.88
KOG0732|consensus 1080 93.86
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 93.84
PRK13342 413 recombination factor protein RarA; Reviewed 93.82
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 93.81
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 93.75
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 93.65
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 93.64
PRK03992389 proteasome-activating nucleotidase; Provisional 93.63
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 93.58
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 93.57
PRK10436462 hypothetical protein; Provisional 93.56
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 93.51
PF02534 469 T4SS-DNA_transf: Type IV secretory system Conjugat 93.49
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 93.47
COG4626 546 Phage terminase-like protein, large subunit [Gener 93.42
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 93.38
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 93.33
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 93.32
PF03237 384 Terminase_6: Terminase-like family; InterPro: IPR0 93.31
PF05876 557 Terminase_GpA: Phage terminase large subunit (GpA) 93.26
PF10412 386 TrwB_AAD_bind: Type IV secretion-system coupling p 93.25
KOG0339|consensus 731 93.24
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 93.24
PRK07399 314 DNA polymerase III subunit delta'; Validated 93.16
TIGR00643630 recG ATP-dependent DNA helicase RecG. 93.02
PHA00729226 NTP-binding motif containing protein 92.92
PRK13341 725 recombination factor protein RarA/unknown domain f 92.92
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 92.88
TIGR00064272 ftsY signal recognition particle-docking protein F 92.78
PF05729166 NACHT: NACHT domain 92.76
PRK00771 437 signal recognition particle protein Srp54; Provisi 92.75
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 92.71
PRK05973237 replicative DNA helicase; Provisional 92.67
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 92.63
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 92.58
PRK08769319 DNA polymerase III subunit delta'; Validated 92.49
PRK06067234 flagellar accessory protein FlaH; Validated 92.47
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 92.39
PRK13897 606 type IV secretion system component VirD4; Provisio 92.31
COG5008375 PilU Tfp pilus assembly protein, ATPase PilU [Cell 92.26
CHL00176 638 ftsH cell division protein; Validated 92.24
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 92.23
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 92.21
KOG0058|consensus716 92.14
COG2256 436 MGS1 ATPase related to the helicase subunit of the 92.11
PF12846 304 AAA_10: AAA-like domain 92.1
KOG0333|consensus673 91.95
TIGR02237209 recomb_radB DNA repair and recombination protein R 91.91
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 91.9
COG1485 367 Predicted ATPase [General function prediction only 91.81
PRK13850 670 type IV secretion system protein VirD4; Provisiona 91.8
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 91.75
KOG0744|consensus423 91.72
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 91.65
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 91.64
PRK13700 732 conjugal transfer protein TraD; Provisional 91.63
KOG0731|consensus 774 91.58
KOG0060|consensus659 91.54
KOG3089|consensus271 91.53
TIGR00959 428 ffh signal recognition particle protein. This mode 91.52
PRK13851344 type IV secretion system protein VirB11; Provision 91.42
PRK10867 433 signal recognition particle protein; Provisional 91.41
PTZ00293211 thymidine kinase; Provisional 91.08
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 90.97
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [P 90.96
TIGR02533486 type_II_gspE general secretory pathway protein E. 90.87
PRK10865 857 protein disaggregation chaperone; Provisional 90.83
cd01127 410 TrwB Bacterial conjugation protein TrwB, ATP bindi 90.81
PRK10263 1355 DNA translocase FtsK; Provisional 90.72
PHA03372 668 DNA packaging terminase subunit 1; Provisional 90.71
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 90.71
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 90.6
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 90.6
PRK10416318 signal recognition particle-docking protein FtsY; 90.57
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 90.56
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 90.56
KOG1001|consensus 674 90.55
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 90.4
PRK06620214 hypothetical protein; Validated 90.38
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 90.32
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 90.28
cd03239178 ABC_SMC_head The structural maintenance of chromos 90.23
PRK09087226 hypothetical protein; Validated 90.2
PRK08058 329 DNA polymerase III subunit delta'; Validated 90.16
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 90.06
TIGR00767415 rho transcription termination factor Rho. Members 90.05
KOG1015|consensus 1567 90.03
PRK13876 663 conjugal transfer coupling protein TraG; Provision 90.02
PRK13822 641 conjugal transfer coupling protein TraG; Provision 89.92
PTZ00110545 helicase; Provisional 89.78
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 89.64
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 89.55
COG2255332 RuvB Holliday junction resolvasome, helicase subun 89.49
TIGR02784 1141 addA_alphas double-strand break repair helicase Ad 89.45
PF13479213 AAA_24: AAA domain 89.34
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 89.28
PRK04328249 hypothetical protein; Provisional 89.28
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 89.19
TIGR03743 634 SXT_TraD conjugative coupling factor TraD, SXT/TOL 89.1
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 89.06
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 88.96
PRK13695174 putative NTPase; Provisional 88.91
KOG0335|consensus 482 88.88
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 88.8
cd03115173 SRP The signal recognition particle (SRP) mediates 88.76
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 88.59
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 88.55
PRK06904472 replicative DNA helicase; Validated 88.24
KOG1806|consensus 1320 88.23
PRK10789569 putative multidrug transporter membrane\ATP-bindin 88.21
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 88.16
TIGR00665434 DnaB replicative DNA helicase. This model describe 88.11
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 88.11
PF1355562 AAA_29: P-loop containing region of AAA domain 88.08
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 88.06
TIGR03754 643 conj_TOL_TraD conjugative coupling factor TraD, TO 88.04
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 87.91
PRK09376416 rho transcription termination factor Rho; Provisio 87.83
COG1074 1139 RecB ATP-dependent exoDNAse (exonuclease V) beta s 87.81
cd01394218 radB RadB. The archaeal protein radB shares simila 87.58
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 87.52
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 87.42
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 87.4
PRK04841 903 transcriptional regulator MalT; Provisional 87.29
COG1119257 ModF ABC-type molybdenum transport system, ATPase 87.26
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 87.2
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 87.17
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 87.08
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 87.03
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 86.89
KOG2228|consensus 408 86.82
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 86.81
PLN032321495 ABC transporter C family member; Provisional 86.78
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 86.64
COG2842297 Uncharacterized ATPase, putative transposase [Gene 86.45
COG0606490 Predicted ATPase with chaperone activity [Posttran 86.41
PHA00012 361 I assembly protein 86.36
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 86.26
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 86.2
KOG2227|consensus 529 86.11
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 86.0
PRK13767 876 ATP-dependent helicase; Provisional 85.8
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 85.68
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 85.61
TIGR02759 566 TraD_Ftype type IV conjugative transfer system cou 85.6
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 85.6
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 85.56
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 85.53
PTZ002431560 ABC transporter; Provisional 85.19
>KOG0331|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.7e-47  Score=357.24  Aligned_cols=196  Identities=48%  Similarity=0.808  Sum_probs=181.7

Q ss_pred             CCccCCCCCHHHHHHHHHCCCCCCcHHHHHHHhhHhcCCCEEEEccCCCchhHHhHHHHHHHHHhcCCCCCCCCCCCCCC
Q psy12758         61 PQFDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAFLVPILNQMYERGPLPTPPAGRGYPS  140 (308)
Q Consensus        61 ~~f~~l~l~~~l~~~L~~~~~~~pt~iQ~~~ip~i~~g~d~lv~a~TGsGKTla~llpil~~l~~~~~~~~~~~~~~~~~  140 (308)
                      ..|++++|++.+..+|+..||+.|||||++.||.+++|+|+++.|.||||||++|++|++.++.+...            
T Consensus        91 ~~f~~~~ls~~~~~~lk~~g~~~PtpIQaq~wp~~l~GrD~v~iA~TGSGKTLay~lP~i~~l~~~~~------------  158 (519)
T KOG0331|consen   91 AAFQELGLSEELMKALKEQGFEKPTPIQAQGWPIALSGRDLVGIARTGSGKTLAYLLPAIVHLNNEQG------------  158 (519)
T ss_pred             hhhhcccccHHHHHHHHhcCCCCCchhhhcccceeccCCceEEEeccCCcchhhhhhHHHHHHHhccc------------
Confidence            37999999999999999999999999999999999999999999999999999999999999986321            


Q ss_pred             CCcccccccccccchHHHHHHHHHHHHHHhhhcCCccccccccccccccccCCHHhHHHHHHHHHHhhhcCCCceEEEec
Q psy12758        141 RKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVYG  220 (308)
Q Consensus       141 ~~~~~~~~li~~pt~~l~~q~~~~~~~~~~~~~~~~~~~~~~~~~~~lil~PtreL~~qi~~~~~~~~~~~~~~~~~~~g  220 (308)
                                                           .......|.+|||+||||||.|+.+++..++....++++|+||
T Consensus       159 -------------------------------------~~~~~~~P~vLVL~PTRELA~QV~~~~~~~~~~~~~~~~cvyG  201 (519)
T KOG0331|consen  159 -------------------------------------KLSRGDGPIVLVLAPTRELAVQVQAEAREFGKSLRLRSTCVYG  201 (519)
T ss_pred             -------------------------------------cccCCCCCeEEEEcCcHHHHHHHHHHHHHHcCCCCccEEEEeC
Confidence                                                 1123334999999999999999999999999999999999999


Q ss_pred             CCchhHhHHhhcCCCeEEEECcHHHHHHHHcCCcCCCCCceEEechhhhcccCCCHHHHHHHHHhcCCCCCCCceEEEEe
Q psy12758        221 GSNVGDQMRDLDRGCHLLVATPGRLVDMLERGKIGLANCRFLVLDEADRMLDMGFEPQIRCIVQENGMPRTGDRQTLMFS  300 (308)
Q Consensus       221 g~~~~~~~~~l~~~~~IlV~TP~~L~~~l~~~~~~l~~~~~lViDEad~ll~~~f~~~l~~i~~~l~~~~~~~~q~i~~S  300 (308)
                      |.....|.+.+.++++|+|||||||.++++.+.++++++.|||+||||+|+|+||+++++.|+.+++.   ..+|++|||
T Consensus       202 G~~~~~Q~~~l~~gvdiviaTPGRl~d~le~g~~~l~~v~ylVLDEADrMldmGFe~qI~~Il~~i~~---~~rQtlm~s  278 (519)
T KOG0331|consen  202 GAPKGPQLRDLERGVDVVIATPGRLIDLLEEGSLNLSRVTYLVLDEADRMLDMGFEPQIRKILSQIPR---PDRQTLMFS  278 (519)
T ss_pred             CCCccHHHHHHhcCCcEEEeCChHHHHHHHcCCccccceeEEEeccHHhhhccccHHHHHHHHHhcCC---CcccEEEEe
Confidence            99999999999999999999999999999999999999999999999999999999999999999842   356999999


Q ss_pred             ecCCCCCC
Q psy12758        301 ATFPKEIQ  308 (308)
Q Consensus       301 ATl~~~v~  308 (308)
                      ||||.+|+
T Consensus       279 aTwp~~v~  286 (519)
T KOG0331|consen  279 ATWPKEVR  286 (519)
T ss_pred             eeccHHHH
Confidence            99998763

>KOG0330|consensus Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG1132|consensus Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>KOG2340|consensus Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>KOG1133|consensus Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>KOG1131|consensus Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1805|consensus Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0742|consensus Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK13897 type IV secretion system component VirD4; Provisional Back     alignment and domain information
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>KOG0058|consensus Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK13850 type IV secretion system protein VirD4; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK13700 conjugal transfer protein TraD; Provisional Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>KOG0060|consensus Back     alignment and domain information
>KOG3089|consensus Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain Back     alignment and domain information
>PRK10263 DNA translocase FtsK; Provisional Back     alignment and domain information
>PHA03372 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>PRK13876 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>PRK13822 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>TIGR03743 SXT_TraD conjugative coupling factor TraD, SXT/TOL subfamily Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>KOG1806|consensus Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>TIGR03754 conj_TOL_TraD conjugative coupling factor TraD, TOL family Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>KOG2228|consensus Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>COG2842 Uncharacterized ATPase, putative transposase [General function prediction only] Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA00012 I assembly protein Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG2227|consensus Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>TIGR02759 TraD_Ftype type IV conjugative transfer system coupling protein TraD Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query308
2i4i_A 417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 7e-79
1wrb_A253 Crystal Structure Of The N-Terminal Reca-Like Domai 6e-64
2db3_A 434 Structural Basis For Rna Unwinding By The Dead-Box 4e-48
4a4d_A253 Crystal Structure Of The N-Terminal Domain Of The H 9e-37
3fe2_A242 Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D 1e-36
3iuy_A228 Crystal Structure Of Ddx53 Dead-Box Domain Length = 1e-28
3ber_A249 Human Dead-Box Rna-Helicase Ddx47, Conserved Domain 3e-28
2gxq_A207 Hera N-Terminal Domain In Complex With Amp, Crystal 4e-26
3mwj_A207 Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap 1e-25
1s2m_A 400 Crystal Structure Of The Dead Box Protein Dhh1p Len 5e-25
2j0q_A 410 The Crystal Structure Of The Exon Junction Complex 2e-24
2xb2_A 411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 2e-24
2hyi_C 413 Structure Of The Human Exon Junction Complex With A 3e-24
2hxy_A 391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 3e-24
1vec_A206 Crystal Structure Of The N-Terminal Domain Of RckP5 5e-24
1hv8_A 367 Crystal Structure Of A Dead Box Protein From The Hy 9e-23
3bor_A237 Crystal Structure Of The Deadc Domain Of Human Tran 7e-22
2pl3_A236 Human Dead-Box Rna Helicase Ddx10, Dead Domain In C 8e-22
3eiq_A 414 Crystal Structure Of Pdcd4-eif4a Length = 414 1e-21
3ly5_A262 Ddx18 Dead-Domain Length = 262 1e-20
3dkp_A245 Human Dead-Box Rna-Helicase Ddx52, Conserved Domain 2e-20
2z0m_A 337 Crystal Structure Of Hypothetical Atp-Dependent Rna 5e-19
2g9n_A221 Structure Of The Dead Domain Of Human Eukaryotic In 9e-19
2j0u_A 374 The Crystal Structure Of Eif4aiii-Barentsz Complex 1e-18
2oxc_A230 Human Dead-Box Rna Helicase Ddx20, Dead Domain In C 6e-18
2j0u_B 374 The Crystal Structure Of Eif4aiii-Barentsz Complex 6e-18
2vso_A 395 Crystal Structure Of A Translation Initiation Compl 4e-17
1qva_A223 Yeast Initiation Factor 4a N-Terminal Domain Length 4e-17
1qde_A224 Crystal Structure Of The Atpase Domain Of Translati 4e-17
1xtk_A 390 Structure Of Decd To Dead Mutation Of Human Uap56 L 5e-17
1xti_A 391 Structure Of Wildtype Human Uap56 Length = 391 2e-16
1xtj_A 386 Structure Of Human Uap56 In Complex With Adp Length 2e-16
1fuu_A 394 Yeast Initiation Factor 4a Length = 394 6e-16
1t6n_A220 Crystal Structure Of The N-Terminal Domain Of Human 6e-16
1q0u_A219 Crystal Structure Of The Bstdead N-Terminal Domain 7e-16
3sqw_A 579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 5e-15
2zu6_A 388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 2e-14
3i5x_A 563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 4e-14
3sqx_A 512 Structure Of Mss116p (Nte And C-Tail Double Deletio 5e-14
3pew_A 395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 3e-12
2kbe_A226 Solution Structure Of Amino-Terminal Domain Of Dbp5 3e-12
3pey_A 395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 3e-12
3fho_B 508 Structure Of S. Pombe Dbp5 Length = 508 1e-10
3fmo_B300 Crystal Structure Of The Nucleoporin Nup214 In Comp 3e-08
3fhc_B235 Crystal Structure Of Human Dbp5 In Complex With Nup 4e-08
3fmp_B 479 Crystal Structure Of The Nucleoporin Nup214 In Comp 4e-08
3g0h_A 424 Human Dead-box Rna Helicase Ddx19, In Complex With 4e-08
3fht_A 412 Crystal Structure Of Human Dbp5 In Complex With Amp 5e-08
3ews_A 445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 5e-08
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure 
Iteration: 1

 Score =  290 bits (742), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 146/251 (58%), Positives = 177/251 (70%), Gaps = 37/251 (14%)
Query: 58  PLPPQFDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAFLV 117
           P    F D++M EII  NI L RY +PTPVQK+AIP+I   RD+MACAQTGSGKTAAFL+
Sbjct: 12  PHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLL 71
Query: 118 PILNQMYERGPLPTPPAGRGYPSRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPC 177
           PIL+Q+Y  GP      G    + K+    G                             
Sbjct: 72  PILSQIYSDGP------GEALRAMKENGRYG----------------------------- 96
Query: 178 VVRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVYGGSNVGDQMRDLDRGCHL 237
             R+K +P+ LVLAPTRELA QIY+EA+KF+YRS++RPCVVYGG+++G Q+RDL+RGCHL
Sbjct: 97  --RRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHL 154
Query: 238 LVATPGRLVDMLERGKIGLANCRFLVLDEADRMLDMGFEPQIRCIVQENGMPRTGDRQTL 297
           LVATPGRLVDM+ERGKIGL  C++LVLDEADRMLDMGFEPQIR IV+++ MP  G R T+
Sbjct: 155 LVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTM 214
Query: 298 MFSATFPKEIQ 308
           MFSATFPKEIQ
Sbjct: 215 MFSATFPKEIQ 225
>pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 Back     alignment and structure
>pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 Back     alignment and structure
>pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 Back     alignment and structure
>pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 Back     alignment and structure
>pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 Back     alignment and structure
>pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 Back     alignment and structure
>pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 Back     alignment and structure
>pdb|3DKP|A Chain A, Human Dead-Box Rna-Helicase Ddx52, Conserved Domain I In Complex With Adp Length = 245 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|2G9N|A Chain A, Structure Of The Dead Domain Of Human Eukaryotic Initiation Factor 4a, Eif4a Length = 221 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2OXC|A Chain A, Human Dead-Box Rna Helicase Ddx20, Dead Domain In Complex With Adp Length = 230 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|1QVA|A Chain A, Yeast Initiation Factor 4a N-Terminal Domain Length = 223 Back     alignment and structure
>pdb|1QDE|A Chain A, Crystal Structure Of The Atpase Domain Of Translation Initiation Factor 4a From Saccharomyces Cerevisiae-The Prototype Of The Dead Box Protein Family Length = 224 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|1T6N|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Uap56 Length = 220 Back     alignment and structure
>pdb|1Q0U|A Chain A, Crystal Structure Of The Bstdead N-Terminal Domain Length = 219 Back     alignment and structure
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|2KBE|A Chain A, Solution Structure Of Amino-Terminal Domain Of Dbp5p Length = 226 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3FMO|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 300 Back     alignment and structure
>pdb|3FHC|B Chain B, Crystal Structure Of Human Dbp5 In Complex With Nup214 Length = 235 Back     alignment and structure
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query308
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 1e-129
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 1e-128
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 1e-123
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 1e-108
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 3e-97
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 1e-95
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 2e-76
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 2e-75
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 1e-71
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 4e-70
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 6e-70
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 1e-69
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 1e-68
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 2e-68
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 2e-68
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 6e-68
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 4e-66
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 3e-64
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 3e-64
3bor_A237 Human initiation factor 4A-II; translation initiat 6e-64
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 8e-64
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 9e-64
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 1e-63
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 3e-63
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 5e-63
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 6e-62
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 1e-55
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 2e-53
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 1e-52
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 6e-52
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 8e-52
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 9e-15
3b6e_A216 Interferon-induced helicase C domain-containing P; 4e-09
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 1e-07
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 2e-07
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 3e-06
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 4e-06
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 2e-05
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 3e-05
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 5e-05
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 6e-05
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 4e-04
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 6e-04
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 7e-04
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
 Score =  374 bits (963), Expect = e-129
 Identities = 143/246 (58%), Positives = 173/246 (70%), Gaps = 37/246 (15%)

Query: 63  FDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAFLVPILNQ 122
           F D++M EII  NI L RY +PTPVQK+AIP+I   RD+MACAQTGSGKTAAFL+PIL+Q
Sbjct: 17  FSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQ 76

Query: 123 MYERGPLPTPPAGRGYPSRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVRKK 182
           +Y  GP     A +                                           R+K
Sbjct: 77  IYSDGPGEALRAMKENGRYG-------------------------------------RRK 99

Query: 183 VFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVYGGSNVGDQMRDLDRGCHLLVATP 242
            +P+ LVLAPTRELA QIY+EA+KF+YRS++RPCVVYGG+++G Q+RDL+RGCHLLVATP
Sbjct: 100 QYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATP 159

Query: 243 GRLVDMLERGKIGLANCRFLVLDEADRMLDMGFEPQIRCIVQENGMPRTGDRQTLMFSAT 302
           GRLVDM+ERGKIGL  C++LVLDEADRMLDMGFEPQIR IV+++ MP  G R T+MFSAT
Sbjct: 160 GRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSAT 219

Query: 303 FPKEIQ 308
           FPKEIQ
Sbjct: 220 FPKEIQ 225
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Length = 1108 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Length = 1010 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query308
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 100.0
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 100.0
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 100.0
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 100.0
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 100.0
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 100.0
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 100.0
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 100.0
3bor_A237 Human initiation factor 4A-II; translation initiat 100.0
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 100.0
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 100.0
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 100.0
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 100.0
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 100.0
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 99.98
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 99.96
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.96
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.96
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.96
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.96
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.95
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.95
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 99.95
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 99.95
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.95
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.95
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.95
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.94
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 99.94
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 99.94
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.94
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.94
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.94
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.93
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.93
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.93
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.92
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.92
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.92
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.9
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.9
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.9
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 99.9
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 99.89
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.88
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.88
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 99.88
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.86
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.86
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.84
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 99.84
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.83
1yks_A 440 Genome polyprotein [contains: flavivirin protease 99.81
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.8
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 99.79
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.78
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.78
3h1t_A 590 Type I site-specific restriction-modification syst 99.77
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.76
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.7
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.69
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.61
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.58
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.51
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 99.43
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.38
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.31
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 99.23
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 98.53
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 98.25
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 98.24
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 98.16
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 98.12
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 98.11
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 98.03
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 97.9
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 97.63
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.37
3cpe_A 592 Terminase, DNA packaging protein GP17; large termi 97.26
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 96.68
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.64
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 96.5
3vkw_A 446 Replicase large subunit; alpha/beta domain, helica 96.47
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 96.42
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 96.4
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 96.35
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 96.25
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 96.22
2chg_A226 Replication factor C small subunit; DNA-binding pr 96.2
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 96.19
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 96.0
3bos_A242 Putative DNA replication factor; P-loop containing 96.0
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 95.98
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 95.96
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 95.93
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 95.91
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 95.89
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 95.81
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 95.79
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 95.72
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 95.72
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 95.71
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 95.67
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 95.44
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 95.35
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 95.33
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 95.32
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 95.3
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 95.27
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 95.14
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 95.11
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 94.82
2qgz_A308 Helicase loader, putative primosome component; str 94.78
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 94.77
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 94.56
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 94.51
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 94.39
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 94.24
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 93.29
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 93.06
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 93.0
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 92.96
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 92.82
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 92.59
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 92.52
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 92.09
3co5_A143 Putative two-component system transcriptional RES 92.06
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 91.98
2r6a_A454 DNAB helicase, replicative helicase; replication, 91.86
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 91.71
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 91.54
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 91.37
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 91.19
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 91.09
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 90.89
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 90.43
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 90.35
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 90.17
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 89.45
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 89.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 88.81
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 88.7
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 88.69
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 88.62
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 88.56
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 88.43
1e9r_A 437 Conjugal transfer protein TRWB; coupling protein, 88.33
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 87.92
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 87.86
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 87.82
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 87.56
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 87.26
1yks_A 440 Genome polyprotein [contains: flavivirin protease 87.25
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 87.22
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 87.13
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 87.11
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 86.93
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 86.79
3hjh_A 483 Transcription-repair-coupling factor; MFD, mutatio 86.74
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 86.67
2oap_1511 GSPE-2, type II secretion system protein; hexameri 86.45
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 86.35
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 86.1
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 86.05
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 85.83
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 85.67
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 85.67
2l8b_A189 Protein TRAI, DNA helicase I; RECD, hydrolase; NMR 85.54
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 85.52
1xp8_A366 RECA protein, recombinase A; recombination, radior 85.21
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 84.58
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 84.53
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 84.53
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 84.52
1p9r_A418 General secretion pathway protein E; bacterial typ 84.32
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 84.27
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 84.22
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 84.15
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 84.01
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 83.82
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 83.78
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 83.76
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 83.52
2r44_A331 Uncharacterized protein; putative ATPase, structur 83.52
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 83.37
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 83.31
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 83.25
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 83.25
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 82.33
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 82.28
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 81.94
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 81.92
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 81.89
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 81.83
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 81.78
2chq_A319 Replication factor C small subunit; DNA-binding pr 81.64
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 81.56
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 81.11
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 80.99
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 80.88
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 80.82
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 80.75
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 80.7
3nwn_A359 Kinesin-like protein KIF9; motor domain, ADP, stru 80.63
1ojl_A304 Transcriptional regulatory protein ZRAR; response 80.36
1bg2_A325 Kinesin; motor protein, ATPase, microtubule associ 80.29
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 80.29
2gno_A 305 DNA polymerase III, gamma subunit-related protein; 80.26
3dc4_A344 Kinesin-like protein NOD; catalytic domain, ATPase 80.19
1f9v_A347 Kinesin-like protein KAR3; kinesin-related protein 80.16
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
Probab=100.00  E-value=9.8e-42  Score=299.06  Aligned_cols=193  Identities=47%  Similarity=0.751  Sum_probs=176.9

Q ss_pred             CCccCCCCCHHHHHHHHHCCCCCCcHHHHHHHhhHhcCCCEEEEccCCCchhHHhHHHHHHHHHhcCCCCCCCCCCCCCC
Q psy12758         61 PQFDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAFLVPILNQMYERGPLPTPPAGRGYPS  140 (308)
Q Consensus        61 ~~f~~l~l~~~l~~~L~~~~~~~pt~iQ~~~ip~i~~g~d~lv~a~TGsGKTla~llpil~~l~~~~~~~~~~~~~~~~~  140 (308)
                      .+|+++++++.++++|.+.||.+|+++|.++|+.+++|+|++++||||||||++|++|++..+......           
T Consensus        29 ~~f~~~~l~~~l~~~l~~~g~~~~~~~Q~~~i~~~~~g~~~l~~apTGsGKT~~~~l~~l~~l~~~~~~-----------   97 (242)
T 3fe2_A           29 LNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFL-----------   97 (242)
T ss_dssp             SSTTTTTCCHHHHHHHHTTTCCSCCHHHHHHHHHHHHTCCEEEEECTTSCHHHHHHHHHHHHHHTSCCC-----------
T ss_pred             CCHhhcCCCHHHHHHHHHCCCCCCCHHHHHHHHHHhCCCCEEEECCCcCHHHHHHHHHHHHHHHhcccc-----------
Confidence            589999999999999999999999999999999999999999999999999999999999988754310           


Q ss_pred             CCcccccccccccchHHHHHHHHHHHHHHhhhcCCccccccccccccccccCCHHhHHHHHHHHHHhhhcCCCceEEEec
Q psy12758        141 RKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVYG  220 (308)
Q Consensus       141 ~~~~~~~~li~~pt~~l~~q~~~~~~~~~~~~~~~~~~~~~~~~~~~lil~PtreL~~qi~~~~~~~~~~~~~~~~~~~g  220 (308)
                                                             ....++++||++||++|+.|+++.++.+....++++..++|
T Consensus        98 ---------------------------------------~~~~~~~~lil~Pt~~L~~Q~~~~~~~~~~~~~~~~~~~~g  138 (242)
T 3fe2_A           98 ---------------------------------------ERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYG  138 (242)
T ss_dssp             ---------------------------------------CTTCCCSEEEECSSHHHHHHHHHHHHHHHHHTTCCEEEECT
T ss_pred             ---------------------------------------ccCCCCEEEEEeCcHHHHHHHHHHHHHHHhhcCceEEEEEC
Confidence                                                   01123789999999999999999999999999999999999


Q ss_pred             CCchhHhHHhhcCCCeEEEECcHHHHHHHHcCCcCCCCCceEEechhhhcccCCCHHHHHHHHHhcCCCCCCCceEEEEe
Q psy12758        221 GSNVGDQMRDLDRGCHLLVATPGRLVDMLERGKIGLANCRFLVLDEADRMLDMGFEPQIRCIVQENGMPRTGDRQTLMFS  300 (308)
Q Consensus       221 g~~~~~~~~~l~~~~~IlV~TP~~L~~~l~~~~~~l~~~~~lViDEad~ll~~~f~~~l~~i~~~l~~~~~~~~q~i~~S  300 (308)
                      |.....+...+..+++|+|+||++|.+++.++...++++++|||||||++++++|...+..++..+    +.++|+++||
T Consensus       139 ~~~~~~~~~~~~~~~~I~v~Tp~~l~~~l~~~~~~~~~~~~lViDEah~l~~~~~~~~~~~i~~~~----~~~~q~~~~S  214 (242)
T 3fe2_A          139 GAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQI----RPDRQTLMWS  214 (242)
T ss_dssp             TSCHHHHHHHHHHCCSEEEECHHHHHHHHHHTSCCCTTCCEEEETTHHHHHHTTCHHHHHHHHTTS----CSSCEEEEEE
T ss_pred             CCChHHHHHHhcCCCCEEEECHHHHHHHHHcCCCCcccccEEEEeCHHHHhhhCcHHHHHHHHHhC----CccceEEEEE
Confidence            999998888888899999999999999999988889999999999999999999999999999887    4578999999


Q ss_pred             ecCCCCC
Q psy12758        301 ATFPKEI  307 (308)
Q Consensus       301 ATl~~~v  307 (308)
                      ||+|+++
T Consensus       215 AT~~~~~  221 (242)
T 3fe2_A          215 ATWPKEV  221 (242)
T ss_dssp             SCCCHHH
T ss_pred             eecCHHH
Confidence            9999764
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2l8b_A Protein TRAI, DNA helicase I; RECD, hydrolase; NMR {Escherichia coli} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 308
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 1e-40
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 1e-40
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 8e-33
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 1e-31
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 1e-30
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 3e-30
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 3e-29
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 4e-28
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 4e-24
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 1e-22
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 1e-20
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 2e-20
d2bmfa2 305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 3e-17
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 3e-10
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: putative ATP-dependent RNA helicase VlgB
species: Flatworm (Dugesia japonica) [TaxId: 6161]

 Score =  139 bits (351), Expect = 1e-40
 Identities = 120/246 (48%), Positives = 153/246 (62%), Gaps = 46/246 (18%)

Query: 63  FDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAFLVPILNQ 122
           FD++++   I NNI LA Y +PTP+QK AIP I+  RD+MACAQTGSGKTAAFL+PI+N 
Sbjct: 23  FDELKLDPTIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINH 82

Query: 123 MYERGPLPTPPAGRGYPSRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVRKK 182
           +  +       +                                              K 
Sbjct: 83  LVCQDLNQQRYS----------------------------------------------KT 96

Query: 183 VFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVYGGSNVGDQMRDLDRGCHLLVATP 242
            +P  L+LAPTRELA QI  E++KF+  + LR CVVYGG++   Q+R++  GCHLLVATP
Sbjct: 97  AYPKCLILAPTRELAIQILSESQKFSLNTPLRSCVVYGGADTHSQIREVQMGCHLLVATP 156

Query: 243 GRLVDMLERGKIGLANCRFLVLDEADRMLDMGFEPQIRCIVQENGMPRTGDRQTLMFSAT 302
           GRLVD +E+ KI L  C+++VLDEADRMLDMGFEPQIR I++E+ MP   +RQTLMFSAT
Sbjct: 157 GRLVDFIEKNKISLEFCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSAT 216

Query: 303 FPKEIQ 308
           FPKEIQ
Sbjct: 217 FPKEIQ 222
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query308
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 100.0
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 100.0
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 100.0
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 100.0
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 100.0
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 100.0
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 100.0
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 100.0
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 100.0
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.97
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.96
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.96
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.93
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.81
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.76
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.73
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.73
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.72
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.71
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.6
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.03
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 99.0
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 98.96
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.88
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 98.16
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 97.44
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 97.24
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 96.95
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 96.92
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 96.91
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 96.83
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 96.71
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 96.55
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 96.48
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 96.42
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 96.35
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 96.33
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 95.95
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 95.92
d2qy9a2211 GTPase domain of the signal recognition particle r 95.87
d1vmaa2213 GTPase domain of the signal recognition particle r 95.7
d1okkd2207 GTPase domain of the signal recognition particle r 95.61
d1t5la1 413 Nucleotide excision repair enzyme UvrB {Bacillus c 95.53
d1ls1a2207 GTPase domain of the signal sequence recognition p 95.35
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 95.33
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 94.65
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 94.31
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 94.21
d1j8yf2211 GTPase domain of the signal sequence recognition p 94.04
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 93.82
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 93.7
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 93.42
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 93.28
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 93.23
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 92.99
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 92.67
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 92.28
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 92.06
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 91.85
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 91.77
d1w36b1 485 Exodeoxyribonuclease V beta chain (RecB), N-termin 91.41
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 91.41
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 91.27
d1c4oa1 408 Nucleotide excision repair enzyme UvrB {Thermus th 91.03
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 90.98
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 90.95
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 90.88
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 90.78
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 90.71
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 90.57
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 90.5
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 90.18
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 89.73
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 89.62
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 88.72
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 88.7
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 88.24
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 88.2
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 88.19
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 87.74
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 87.74
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 86.71
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 86.19
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 85.65
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 84.9
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 84.85
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 84.84
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 84.65
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 83.84
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 83.78
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 83.3
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 83.08
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 82.47
d1bg2a_323 Kinesin {Human (Homo sapiens) [TaxId: 9606]} 81.93
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 81.47
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 80.14
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=2.5e-49  Score=340.73  Aligned_cols=189  Identities=39%  Similarity=0.589  Sum_probs=177.6

Q ss_pred             CCCccCCCCCHHHHHHHHHCCCCCCcHHHHHHHhhHhcCCCEEEEccCCCchhHHhHHHHHHHHHhcCCCCCCCCCCCCC
Q psy12758         60 PPQFDDIQMTEIITNNIALARYDKPTPVQKYAIPVIISGRDVMACAQTGSGKTAAFLVPILNQMYERGPLPTPPAGRGYP  139 (308)
Q Consensus        60 ~~~f~~l~l~~~l~~~L~~~~~~~pt~iQ~~~ip~i~~g~d~lv~a~TGsGKTla~llpil~~l~~~~~~~~~~~~~~~~  139 (308)
                      -++|++|||++.++++|.++||.+||++|.++||.+++|+|++++|+||||||+||++|+++.+....            
T Consensus        16 ~~sF~~l~L~~~l~~~L~~~g~~~pt~IQ~~aIp~il~g~dvi~~a~TGSGKTlayllPil~~l~~~~------------   83 (222)
T d2j0sa1          16 TPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQV------------   83 (222)
T ss_dssp             CCSGGGGCCCHHHHHHHHHHTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHTCCTTS------------
T ss_pred             CCCHHHCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCeEEEcCcchhhhhhhcccccccccccc------------
Confidence            36899999999999999999999999999999999999999999999999999999999998764332            


Q ss_pred             CCCcccccccccccchHHHHHHHHHHHHHHhhhcCCccccccccccccccccCCHHhHHHHHHHHHHhhhcCCCceEEEe
Q psy12758        140 SRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVRKKVFPLGLVLAPTRELATQIYDEAKKFAYRSQLRPCVVY  219 (308)
Q Consensus       140 ~~~~~~~~~li~~pt~~l~~q~~~~~~~~~~~~~~~~~~~~~~~~~~~lil~PtreL~~qi~~~~~~~~~~~~~~~~~~~  219 (308)
                                                                 ..++++|++|||||+.|+++.++.+++..++++..++
T Consensus        84 -------------------------------------------~~~~~lil~PtreLa~Qi~~~~~~l~~~~~i~~~~~~  120 (222)
T d2j0sa1          84 -------------------------------------------RETQALILAPTRELAVQIQKGLLALGDYMNVQCHACI  120 (222)
T ss_dssp             -------------------------------------------CSCCEEEECSSHHHHHHHHHHHHHHTTTTTCCEEEEC
T ss_pred             -------------------------------------------cCceeEEecchHHHHHHHHHHHHHHhCccceeEEEEe
Confidence                                                       1278999999999999999999999999999999999


Q ss_pred             cCCchhHhHHhhcCCCeEEEECcHHHHHHHHcCCcCCCCCceEEechhhhcccCCCHHHHHHHHHhcCCCCCCCceEEEE
Q psy12758        220 GGSNVGDQMRDLDRGCHLLVATPGRLVDMLERGKIGLANCRFLVLDEADRMLDMGFEPQIRCIVQENGMPRTGDRQTLMF  299 (308)
Q Consensus       220 gg~~~~~~~~~l~~~~~IlV~TP~~L~~~l~~~~~~l~~~~~lViDEad~ll~~~f~~~l~~i~~~l~~~~~~~~q~i~~  299 (308)
                      ||.....+...+..+++|+|+|||||.+++.++.+.++++++||+||||+|++.||.+++..|++.+    +.++|+++|
T Consensus       121 g~~~~~~~~~~l~~~~~Ilv~TPgrl~~~~~~~~~~~~~l~~lVlDEaD~ll~~~f~~~i~~I~~~l----~~~~Q~ilf  196 (222)
T d2j0sa1         121 GGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYL----PPATQVVLI  196 (222)
T ss_dssp             TTSCHHHHHHHHHHCCSEEEECHHHHHHHHHTTSSCCTTCCEEEEETHHHHTSTTTHHHHHHHHTTS----CTTCEEEEE
T ss_pred             ecccchhhHHHhccCCeEEeCCCCcHHhcccccccccccceeeeecchhHhhhcCcHHHHHHHHHhC----CCCCEEEEE
Confidence            9999999999998899999999999999999999999999999999999999999999999999987    568999999


Q ss_pred             eecCCCCC
Q psy12758        300 SATFPKEI  307 (308)
Q Consensus       300 SATl~~~v  307 (308)
                      |||+|++|
T Consensus       197 SAT~~~~v  204 (222)
T d2j0sa1         197 SATLPHEI  204 (222)
T ss_dssp             ESCCCHHH
T ss_pred             EEeCCHHH
Confidence            99999865
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure