Psyllid ID: psy12793


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350--
MVLGLFLNVNKTLFPCLKSRKEGDRYLSTYLQIFVRAQFNYNPLDDDLIPCAQAGIAFQIGDILQIFVRAQFNYNPLDDDLIPCAQAGIAFQIGDILQIISKDDHNWWQARKDNVAGSAGLIPSPELQEWRTACSTIDKTKHEQVNCSIFGRKKKLYKDKYLAKHNAVFDQLDLVTYEEVVKLPSFKRKTLVLLGAHGVGRRHIKNTLINKFPDKYAYPVPQFITVCSVMFQIISKDDHNWWQARKDNVAGSAGLIPSPELQEWRTACSTIDKTKHEQGIYSSFSLPFSVYRRDTTRSPRSDEENGRAYYFISHDEMMSDIAANQYLEYGKSILTHPSQRHIVSCRKLVVNS
ccccEEEEEccccccccccccccccccHHHHHHHHHHcccccccEEEEEccccccccccccccEEEEEEEcccccccccccccccccccccccccEEEEEEcccccccEEEEccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccEEcccccccccEEEEEccccHHHHHHHHHHHHHcccccccccccccccccccEEEccccccEEEEcccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccEEccccccccEEEEEEEEEcc
cEEEEEEEccccHHHHHHccccccccHHHHHHHHHHHHHcccEEEEEEEEccccccccccccccEEEEEEEEcccccccccccHHHcccccccccEEEEEEccccccHEEEEccccccccccccHHHHHHHHHHcccccccccccccccccccccccccEEEcccccccccccEEEEHHHEccccccccEEEEEccccccHHHHHHHHHHccccccccccccEEEcHHHHHHHHHcccEEEEcccccccccccHHcHHHHHHcccEEEEEccHHHHEEcccEEcccccEEEEccccccccccccccccEEEccHHHHHHHHHHccEEEcccEEEccccHHHHHHcccEEEcc
MVLGLFLNVNktlfpclksrkegdRYLSTYLQIFVRAQfnynpldddlipcaqAGIAFQIGDILQIFVRAQfnynpldddlipcaqAGIAFQIGDILQIISKDDHNWWQARKdnvagsaglipspelqEWRTACSTIdktkheqvncsifgrkkkLYKDKYLAKhnavfdqldlVTYEEVVKLPSFKRKTLVLLGAhgvgrrhikntlinkfpdkyaypvpqFITVCSVMFQIISKDDHNWWQARKdnvagsaglipspelqEWRTACSTIDktkheqgiyssfslpfsvyrrdttrsprsdeengrayyfiSHDEMMSDIAANQYLEYgksilthpsqrhIVSCRKLVVNS
MVLGLFLNVNKTlfpclksrkegDRYLSTYLQIFVRAQFNYNPLDDDLIPCAQAGIAFQIGDILQIFVRAQFNYNPLDDDLIPCAQAGIAFQIGDILQIISKDDHNWWQARKDNVAGSaglipspelQEWRTACStidktkheqvncsifgrkkKLYKDKYLAKHnavfdqldlVTYEEVVKLPSFKRKTLVllgahgvgrrhikNTLINKFPDKYAYPVPQFITVCSVMFQIISKDDHNWWQARKDNVAGSaglipspelQEWRTACSTIDktkheqgiyssfslpfsvyrrdttrsprsdeengRAYYFISHDEMMSDIAANQYLEYGKSIlthpsqrhivscrklvvns
MVLGLFLNVNKTLFPCLKSRKEGDRYLSTYLQIFVRAQFNYNPLDDDLIPCAQAGIAFQIGDILQIFVRAQFNYNPLDDDLIPCAQAGIAFQIGDILQIISKDDHNWWQARKDNVAGSAGLIPSPELQEWRTACSTIDKTKHEQVNCSIFGRkkklykdkylakHNAVFDQLDLVTYEEVVKLPSFKRKTLVLLGAHGVGRRHIKNTLINKFPDKYAYPVPQFITVCSVMFQIISKDDHNWWQARKDNVAGSAGLIPSPELQEWRTACSTIDKTKHEQGIYSSFSLPFSVYRRDTTRSPRSDEENGRAYYFISHDEMMSDIAANQYLEYGKSILTHPSQRHIVSCRKLVVNS
*VLGLFLNVNKTLFPCLKSRKEGDRYLSTYLQIFVRAQFNYNPLDDDLIPCAQAGIAFQIGDILQIFVRAQFNYNPLDDDLIPCAQAGIAFQIGDILQIISKDDHNWWQARKDNVAGSAGLIPSPELQEWRTACSTIDKTKHEQVNCSIFGRKKKLYKDKYLAKHNAVFDQLDLVTYEEVVKLPSFKRKTLVLLGAHGVGRRHIKNTLINKFPDKYAYPVPQFITVCSVMFQIISKDDHNWWQARKDNVAGSAGLIPSPELQEWRTACSTIDKTKHEQGIYSSFSLPFSVY***************RAYYFISHDEMMSDIAANQYLEYGKSILTHPSQRHIVSCRKLV***
*VLGLFLNVNKTLFPC************TYLQIFVRAQFNYNP**********************IFVRAQFNYNPLDDDLIPCAQAGIAFQIGDILQIISKDDHNWWQARKDNVAGSAGLIPSPELQEWRTACSTIDKTKHEQVNCSIFGRK********************LVTYEEVVKLPSFKRKTLVLLGAHGVGRRHIKNTLINKFPDKYAYPVPQFITVCSV****ISKDDHNWWQARKDNVAGSAGLIPSPELQEWRTACSTIDKTKHEQGIYSSFSLPFSV*********************ISHDEMMSDIAANQYLEYGKSILTHPSQRHIVSCRKLVVN*
MVLGLFLNVNKTLFPCLKSRKEGDRYLSTYLQIFVRAQFNYNPLDDDLIPCAQAGIAFQIGDILQIFVRAQFNYNPLDDDLIPCAQAGIAFQIGDILQIISKDDHNWWQARKDNVAGSAGLIPSPELQEWRTACSTIDKTKHEQVNCSIFGRKKKLYKDKYLAKHNAVFDQLDLVTYEEVVKLPSFKRKTLVLLGAHGVGRRHIKNTLINKFPDKYAYPVPQFITVCSVMFQIISKDDHNWWQARKDNVAGSAGLIPSPELQEWRTACSTIDKTKHEQGIYSSFSLPFSVYRR**********ENGRAYYFISHDEMMSDIAANQYLEYGKSILTHPSQRHIVSCRKLVVNS
MVLGLFLNVNKTLFPCLKSRKEGDRYLSTYLQIFVRAQFNYNPLDDDLIPCAQAGIAFQIGDILQIFVRAQFNYNPLDDDLIPCAQAGIAFQIGDILQIISKDDHNWWQARKDNVAGSAGLIPSPELQEWRTACSTID*****QVNCSIFGRKKKLYKDKYLAKHNAVFDQLDLVTYEEVVKLPSFKRKTLVLLGAHGVGRRHIKNTLINKFPDKYAYPVPQFITVCSVMFQIISKDDHNWWQARKDNVAGSAGLIPSPELQEWRTACSTIDKTKHEQGIYSSFSLPFSVYRRDTTRSPRSDEENGRAYYFISHDEMMSDIAANQYLEYGKSILTHPSQRHIVSCRKLVVNS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLGLFLNVNKTLFPCLKSRKEGDRYLSTYLQIFVRAQFNYNPLDDDLIPCAQAGIAFQIGDILQIFVRAQFNYNPLDDDLIPCAQAGIAFQIGDILQIISKDDHNWWQARKDNVAGSAGLIPSPELQEWRTACSTIDKTKHEQVNCSIFGRKKKLYKDKYLAKHNAVFDQLDLVTYEEVVKLPSFKRKTLVLLGAHGVGRRHIKNTLINKFPDKYAYPVPQFITVCSVMFQIISKDDHNWWQARKDNVAGSAGLIPSPELQEWRTACSTIDKTKHEQGIYSSFSLPFSVYRRDTTRSPRSDEENGRAYYFISHDEMMSDIAANQYLEYGKSILTHPSQRHIVSCRKLVVNS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query352 2.2.26 [Sep-21-2011]
Q24210898 Peripheral plasma membran yes N/A 0.448 0.175 0.814 2e-77
O14936926 Peripheral plasma membran yes N/A 0.696 0.264 0.493 1e-63
O70589926 Peripheral plasma membran yes N/A 0.576 0.219 0.574 1e-63
Q62915909 Peripheral plasma membran yes N/A 0.565 0.218 0.542 1e-57
P54936961 Protein lin-2 OS=Caenorha no N/A 0.448 0.164 0.614 4e-54
P49697467 55 kDa erythrocyte membra N/A N/A 0.437 0.329 0.613 8e-52
P70290466 55 kDa erythrocyte membra no N/A 0.443 0.334 0.622 3e-50
Q5RDW4466 55 kDa erythrocyte membra no N/A 0.443 0.334 0.622 6e-50
Q5ZJ00468 55 kDa erythrocyte membra no N/A 0.443 0.333 0.616 7e-50
Q00013466 55 kDa erythrocyte membra no N/A 0.443 0.334 0.622 7e-50
>sp|Q24210|CSKP_DROME Peripheral plasma membrane protein CASK OS=Drosophila melanogaster GN=CASK PE=1 SV=4 Back     alignment and function desciption
 Score =  289 bits (739), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 148/162 (91%), Gaps = 4/162 (2%)

Query: 65  QIFVRAQFNYNPLDDDLIPCAQAGIAFQIGDILQIISKDDHNWWQARKDNVAGSAGLIPS 124
           +IFVRAQF+YNPLDD+LIPCAQAGI+FQ+GDILQIISKDDH+WWQAR D V GSAGLIPS
Sbjct: 584 EIFVRAQFDYNPLDDELIPCAQAGISFQVGDILQIISKDDHHWWQARLDTVGGSAGLIPS 643

Query: 125 PELQEWRTACSTIDKTKHEQVNCSIFGRKKKLYKDKYLAKHNAVFDQLDLVTYEEVVKL- 183
           PELQEWR AC T+DKTK EQVNCSIFGRKKK  +DKYLAKHNA+FD LD+VTYEEVVK+ 
Sbjct: 644 PELQEWRIACQTVDKTKQEQVNCSIFGRKKKQCRDKYLAKHNAIFDTLDVVTYEEVVKVP 703

Query: 184 ---PSFKRKTLVLLGAHGVGRRHIKNTLINKFPDKYAYPVPQ 222
              P+F+RKTLVLLGAHGVGRRHIKNTLI+K+PDKYAYP+P 
Sbjct: 704 VGDPNFQRKTLVLLGAHGVGRRHIKNTLISKYPDKYAYPIPH 745




May regulate transmembrane proteins that bind calcium, calmodulin, or nucleotides. Functionally modulates eag potassium channels; increases eag current and whole-cell conductance. Also regulates autophosphorylation of CaMKII.
Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1EC: 7
>sp|O14936|CSKP_HUMAN Peripheral plasma membrane protein CASK OS=Homo sapiens GN=CASK PE=1 SV=3 Back     alignment and function description
>sp|O70589|CSKP_MOUSE Peripheral plasma membrane protein CASK OS=Mus musculus GN=Cask PE=1 SV=2 Back     alignment and function description
>sp|Q62915|CSKP_RAT Peripheral plasma membrane protein CASK OS=Rattus norvegicus GN=Cask PE=1 SV=1 Back     alignment and function description
>sp|P54936|LIN2_CAEEL Protein lin-2 OS=Caenorhabditis elegans GN=lin-2 PE=1 SV=1 Back     alignment and function description
>sp|P49697|EM55_TAKRU 55 kDa erythrocyte membrane protein OS=Takifugu rubripes GN=mpp1 PE=3 SV=1 Back     alignment and function description
>sp|P70290|EM55_MOUSE 55 kDa erythrocyte membrane protein OS=Mus musculus GN=Mpp1 PE=1 SV=1 Back     alignment and function description
>sp|Q5RDW4|EM55_PONAB 55 kDa erythrocyte membrane protein OS=Pongo abelii GN=MPP1 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZJ00|EM55_CHICK 55 kDa erythrocyte membrane protein OS=Gallus gallus GN=MPP1 PE=2 SV=1 Back     alignment and function description
>sp|Q00013|EM55_HUMAN 55 kDa erythrocyte membrane protein OS=Homo sapiens GN=MPP1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query352
189235646 893 PREDICTED: similar to AGAP001683-PA [Tri 0.448 0.176 0.839 2e-76
270003442 966 hypothetical protein TcasGA2_TC002673 [T 0.446 0.162 0.844 2e-76
198450831 1027 GA19796 [Drosophila pseudoobscura pseudo 0.448 0.153 0.814 1e-75
195400208 1039 GJ14160 [Drosophila virilis] gi|19414227 0.446 0.151 0.826 1e-75
24648808 898 CASK ortholog, isoform B [Drosophila mel 0.448 0.175 0.814 2e-75
442620344 929 CASK ortholog, isoform H [Drosophila mel 0.448 0.170 0.814 2e-75
195453154 608 GK13019 [Drosophila willistoni] gi|19416 0.446 0.258 0.826 2e-75
195036272 596 GH18714 [Drosophila grimshawi] gi|193893 0.446 0.263 0.826 2e-75
28317033 833 RE09582p [Drosophila melanogaster] 0.448 0.189 0.814 2e-75
195110523 594 GI22862 [Drosophila mojavensis] gi|19391 0.446 0.264 0.826 3e-75
>gi|189235646|ref|XP_968349.2| PREDICTED: similar to AGAP001683-PA [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  292 bits (748), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 136/162 (83%), Positives = 149/162 (91%), Gaps = 4/162 (2%)

Query: 65  QIFVRAQFNYNPLDDDLIPCAQAGIAFQIGDILQIISKDDHNWWQARKDNVAGSAGLIPS 124
           +IFVRAQF+Y+PL+DDLIPCAQAGIAF+ GDILQIISKDDH+WWQARKDN AGSAGLIPS
Sbjct: 579 EIFVRAQFDYDPLEDDLIPCAQAGIAFKTGDILQIISKDDHHWWQARKDNSAGSAGLIPS 638

Query: 125 PELQEWRTACSTIDKTKHEQVNCSIFGRKKKLYKDKYLAKHNAVFDQLDLVTYEEVVKL- 183
           PELQEWR AC+ ++KTK EQVNCSIFGRKKK YKDKYLAKHNAVFDQLDLVTYEEVVKL 
Sbjct: 639 PELQEWRAACAAMEKTKQEQVNCSIFGRKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLP 698

Query: 184 ---PSFKRKTLVLLGAHGVGRRHIKNTLINKFPDKYAYPVPQ 222
              P+F+RKTLVLLGAHGVGRRHIKNTLI K PD+YAYP+P 
Sbjct: 699 MTDPAFQRKTLVLLGAHGVGRRHIKNTLIAKHPDQYAYPIPH 740




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270003442|gb|EEZ99889.1| hypothetical protein TcasGA2_TC002673 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|198450831|ref|XP_001358148.2| GA19796 [Drosophila pseudoobscura pseudoobscura] gi|198131210|gb|EAL27285.2| GA19796 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195400208|ref|XP_002058710.1| GJ14160 [Drosophila virilis] gi|194142270|gb|EDW58678.1| GJ14160 [Drosophila virilis] Back     alignment and taxonomy information
>gi|24648808|ref|NP_524441.2| CASK ortholog, isoform B [Drosophila melanogaster] gi|34223738|sp|Q24210.4|CSKP_DROME RecName: Full=Peripheral plasma membrane protein CASK; Short=dCASK; AltName: Full=Calcium/calmodulin-dependent protein kinase; Short=CAKI; Short=Camguk gi|23171917|gb|AAF55922.2| CASK ortholog, isoform B [Drosophila melanogaster] gi|209529753|gb|ACI49771.1| FI02017p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|442620344|ref|NP_001262811.1| CASK ortholog, isoform H [Drosophila melanogaster] gi|440217720|gb|AGB96191.1| CASK ortholog, isoform H [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195453154|ref|XP_002073662.1| GK13019 [Drosophila willistoni] gi|194169747|gb|EDW84648.1| GK13019 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195036272|ref|XP_001989595.1| GH18714 [Drosophila grimshawi] gi|193893791|gb|EDV92657.1| GH18714 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|28317033|gb|AAO39536.1| RE09582p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195110523|ref|XP_001999829.1| GI22862 [Drosophila mojavensis] gi|193916423|gb|EDW15290.1| GI22862 [Drosophila mojavensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query352
FB|FBgn0013759898 CASK "CASK ortholog" [Drosophi 0.446 0.174 0.763 2.5e-79
UNIPROTKB|F1RX15799 CASK "Uncharacterized protein" 0.446 0.196 0.691 1.2e-71
UNIPROTKB|J9NZ27897 CASK "Uncharacterized protein" 0.446 0.175 0.691 9.5e-71
UNIPROTKB|E1BWL4920 CASK "Uncharacterized protein" 0.446 0.170 0.691 1.5e-70
UNIPROTKB|O14936926 CASK "Peripheral plasma membra 0.446 0.169 0.691 1.6e-70
MGI|MGI:1309489926 Cask "calcium/calmodulin-depen 0.446 0.169 0.691 1.6e-70
UNIPROTKB|A5D7B9908 CASK "CASK protein" [Bos tauru 0.448 0.174 0.681 3.4e-70
UNIPROTKB|K7GSB2908 CASK "Uncharacterized protein" 0.448 0.174 0.681 3.4e-70
UNIPROTKB|D4A8M2920 Cask "Peripheral plasma membra 0.446 0.170 0.685 4.2e-70
UNIPROTKB|E2RLG1921 CASK "Uncharacterized protein" 0.431 0.165 0.660 8.8e-66
FB|FBgn0013759 CASK "CASK ortholog" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 664 (238.8 bits), Expect = 2.5e-79, Sum P(2) = 2.5e-79
 Identities = 123/161 (76%), Positives = 138/161 (85%)

Query:    65 QIFVRAQFNYNPLDDDLIPCAQAGIAFQIGDILQIISKDDHNWWQARKDNVAGSAGLIPS 124
             +IFVRAQF+YNPLDD+LIPCAQAGI+FQ+GDILQIISKDDH+WWQAR D V GSAGLIPS
Sbjct:   584 EIFVRAQFDYNPLDDELIPCAQAGISFQVGDILQIISKDDHHWWQARLDTVGGSAGLIPS 643

Query:   125 PELQEWRTACSTIDKTKHEQVNCSIFGRXXXXXXXXXXXXHNAVFDQLDLVTYEEVVKLP 184
             PELQEWR AC T+DKTK EQVNCSIFGR            HNA+FD LD+VTYEEVVK+P
Sbjct:   644 PELQEWRIACQTVDKTKQEQVNCSIFGRKKKQCRDKYLAKHNAIFDTLDVVTYEEVVKVP 703

Query:   185 ----SFKRKTLVLLGAHGVGRRHIKNTLINKFPDKYAYPVP 221
                 +F+RKTLVLLGAHGVGRRHIKNTLI+K+PDKYAYP+P
Sbjct:   704 VGDPNFQRKTLVLLGAHGVGRRHIKNTLISKYPDKYAYPIP 744


GO:0007628 "adult walking behavior" evidence=IMP
GO:0005954 "calcium- and calmodulin-dependent protein kinase complex" evidence=ISS
GO:0004683 "calmodulin-dependent protein kinase activity" evidence=ISS;IDA
GO:0016080 "synaptic vesicle targeting" evidence=NAS
GO:0007269 "neurotransmitter secretion" evidence=NAS
GO:0016081 "synaptic vesicle docking involved in exocytosis" evidence=NAS
GO:0004674 "protein serine/threonine kinase activity" evidence=NAS
GO:0006468 "protein phosphorylation" evidence=IEA;NAS
GO:0007163 "establishment or maintenance of cell polarity" evidence=NAS
GO:0007155 "cell adhesion" evidence=IMP
GO:0008360 "regulation of cell shape" evidence=IMP
GO:0005524 "ATP binding" evidence=IEA
GO:0046928 "regulation of neurotransmitter secretion" evidence=IDA
GO:0008344 "adult locomotory behavior" evidence=IMP
GO:0008049 "male courtship behavior" evidence=IMP
GO:0046331 "lateral inhibition" evidence=IMP
UNIPROTKB|F1RX15 CASK "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|J9NZ27 CASK "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BWL4 CASK "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|O14936 CASK "Peripheral plasma membrane protein CASK" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1309489 Cask "calcium/calmodulin-dependent serine protein kinase (MAGUK family)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|A5D7B9 CASK "CASK protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|K7GSB2 CASK "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|D4A8M2 Cask "Peripheral plasma membrane protein CASK" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RLG1 CASK "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q62915CSKP_RAT2, ., 7, ., 1, 1, ., 10.54230.56530.2189yesN/A
Q24210CSKP_DROME2, ., 7, ., 1, 1, ., 1, 70.81480.44880.1759yesN/A
O70589CSKP_MOUSE2, ., 7, ., 1, 1, ., 10.57440.57670.2192yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query352
cd1208162 cd12081, SH3_CASK, Src Homology 3 domain of Calciu 2e-36
cd1203562 cd12035, SH3_MPP1-like, Src Homology 3 domain of M 1e-34
cd1186261 cd11862, SH3_MPP, Src Homology 3 domain of Membran 3e-29
cd1208062 cd12080, SH3_MPP1, Src Homology 3 domain of Membra 2e-27
cd1203663 cd12036, SH3_MPP5, Src Homology 3 domain of Membra 2e-19
cd1203759 cd12037, SH3_MPP2, Src Homology 3 domain of Membra 8e-19
cd1203861 cd12038, SH3_MPP6, Src Homology 3 domain of Membra 1e-18
cd1203461 cd12034, SH3_MPP4, Src Homology 3 domain of Membra 4e-18
cd1203361 cd12033, SH3_MPP7, Src Homology 3 domain of Membra 7e-18
cd1203962 cd12039, SH3_MPP3, Src Homology 3 domain of Membra 1e-15
cd1208162 cd12081, SH3_CASK, Src Homology 3 domain of Calciu 7e-13
cd1203562 cd12035, SH3_MPP1-like, Src Homology 3 domain of M 2e-12
cd1186161 cd11861, SH3_DLG-like, Src Homology 3 domain of Di 1e-10
pfam00625183 pfam00625, Guanylate_kin, Guanylate kinase 4e-10
smart0032656 smart00326, SH3, Src homology 3 domains 4e-10
cd1175855 cd11758, SH3_CRK_N, N-terminal Src Homology 3 doma 5e-10
cd00071137 cd00071, GMPK, Guanosine monophosphate kinase (GMP 1e-09
cd1208062 cd12080, SH3_MPP1, Src Homology 3 domain of Membra 3e-09
TIGR03263179 TIGR03263, guanyl_kin, guanylate kinase 3e-09
cd1186261 cd11862, SH3_MPP, Src Homology 3 domain of Membran 6e-09
smart00072174 smart00072, GuKc, Guanylate kinase homologues 7e-09
cd1203274 cd12032, SH3_DLG2, Src Homology 3 domain of Disks 1e-08
pfam0765353 pfam07653, SH3_2, Variant SH3 domain 1e-08
cd1203167 cd12031, SH3_DLG1, Src Homology 3 domain of Disks 1e-08
PRK00300 205 PRK00300, gmk, guanylate kinase; Provisional 2e-08
COG0194191 COG0194, Gmk, Guanylate kinase [Nucleotide transpo 3e-08
cd0017451 cd00174, SH3, Src Homology 3 domain superfamily 3e-08
pfam00625183 pfam00625, Guanylate_kin, Guanylate kinase 7e-08
cd1202967 cd12029, SH3_DLG3, Src Homology 3 domain of Disks 1e-07
pfam0001847 pfam00018, SH3_1, SH3 domain 7e-07
cd1184053 cd11840, SH3_Intersectin_5, Fifth Src homology 3 d 3e-06
cd1185555 cd11855, SH3_Sho1p, Src homology 3 domain of High 3e-06
cd1186362 cd11863, SH3_CACNB, Src Homology 3 domain of Volta 6e-06
cd1204168 cd12041, SH3_CACNB1, Src Homology 3 domain of Volt 7e-06
cd1177253 cd11772, SH3_OSTF1, Src Homology 3 domain of metaz 2e-05
cd1184552 cd11845, SH3_Src_like, Src homology 3 domain of Sr 2e-05
cd1195153 cd11951, SH3_GRAP_C, C-terminal Src homology 3 dom 3e-05
cd1204069 cd12040, SH3_CACNB2, Src Homology 3 domain of Volt 4e-05
cd1203066 cd12030, SH3_DLG4, Src Homology 3 domain of Disks 5e-05
cd1176756 cd11767, SH3_Nck_3, Third Src Homology 3 domain of 9e-05
cd1204268 cd12042, SH3_CACNB3, Src Homology 3 domain of Volt 1e-04
cd1194953 cd11949, SH3_GRB2_C, C-terminal Src homology 3 dom 1e-04
cd1182453 cd11824, SH3_PSTPIP1, Src homology 3 domain of Pro 2e-04
cd1176957 cd11769, SH3_CSK, Src Homology 3 domain of C-termi 2e-04
cd1203861 cd12038, SH3_MPP6, Src Homology 3 domain of Membra 3e-04
cd1188355 cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25 3e-04
cd1182753 cd11827, SH3_MyoIe_If_like, Src homology 3 domain 4e-04
cd1204368 cd12043, SH3_CACNB4, Src Homology 3 domain of Volt 4e-04
cd1203663 cd12036, SH3_MPP5, Src Homology 3 domain of Membra 5e-04
cd1203759 cd12037, SH3_MPP2, Src Homology 3 domain of Membra 5e-04
cd1180553 cd11805, SH3_GRB2_like_C, C-terminal Src homology 5e-04
cd1177357 cd11773, SH3_Sla1p_1, First Src Homology 3 domain 6e-04
cd1177054 cd11770, SH3_Nephrocystin, Src Homology 3 domain o 7e-04
cd1203461 cd12034, SH3_MPP4, Src Homology 3 domain of Membra 0.001
cd1187555 cd11875, SH3_CD2AP-like_3, Third Src Homology 3 do 0.001
cd1199554 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 0.002
cd1206154 cd12061, SH3_betaPIX, Src Homology 3 domain of bet 0.002
cd1203361 cd12033, SH3_MPP7, Src Homology 3 domain of Membra 0.003
cd1205657 cd12056, SH3_CD2AP_3, Third Src Homology 3 domain 0.003
cd1185653 cd11856, SH3_p47phox_like, Src homology 3 domains 0.003
cd1180452 cd11804, SH3_GRB2_like_N, N-terminal Src homology 0.003
PLN02772 398 PLN02772, PLN02772, guanylate kinase 0.003
cd1214255 cd12142, SH3_D21-like, Src Homology 3 domain of SH 0.003
cd1175855 cd11758, SH3_CRK_N, N-terminal Src Homology 3 doma 0.004
cd1206058 cd12060, SH3_alphaPIX, Src Homology 3 domain of al 0.004
>gnl|CDD|213014 cd12081, SH3_CASK, Src Homology 3 domain of Calcium/calmodulin-dependent Serine protein Kinase Back     alignment and domain information
 Score =  125 bits (315), Expect = 2e-36
 Identities = 47/62 (75%), Positives = 54/62 (87%), Gaps = 1/62 (1%)

Query: 67  FVRAQFNYNPLDDDLIPCAQAGIAFQIGDILQIISKDDHNWWQARKDN-VAGSAGLIPSP 125
           +VRAQF Y+PL DDLIPC QAGI F++GDILQIISKDDHNWWQA+ +N   G+AGLIPSP
Sbjct: 1   YVRAQFEYDPLKDDLIPCKQAGIRFRVGDILQIISKDDHNWWQAKLENSKNGTAGLIPSP 60

Query: 126 EL 127
           EL
Sbjct: 61  EL 62


CASK is a scaffolding protein that is highly expressed in the mammalian nervous system and plays roles in synaptic protein targeting, neural development, and gene expression regulation. CASK interacts with many different binding partners including parkin, neurexin, syndecans, calcium channel proteins, caskin, among others, to perform specific functions in different subcellular locations. Disruption of the CASK gene in mice results in neonatal lethality while mutations in the human gene have been associated with X-linked mental retardation. Drosophila CASK is associated with both pre- and postsynaptic membranes and is crucial in synaptic transmission and vesicle cycling. CASK contains an N-terminal calmodulin-dependent kinase (CaMK)-like domain, two L27 domains, followed by the core of three domains characteristic of MAGUK (membrane-associated guanylate kinase) proteins: PDZ, SH3, and guanylate kinase (GuK). In addition, it also contains the Hook (Protein 4.1 Binding) motif in between the SH3 and GuK domains. The GuK domain in MAGUK proteins is enzymatically inactive; instead, the domain mediates protein-protein interactions and associates intramolecularly with the SH3 domain. SH3 domains are protein interaction domains that bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs. They play versatile and diverse roles in the cell including the regulation of enzymes, changing the subcellular localization of signaling pathway components, and mediating the formation of multiprotein complex assemblies. Length = 62

>gnl|CDD|212968 cd12035, SH3_MPP1-like, Src Homology 3 domain of Membrane Protein, Palmitoylated 1 (or MAGUK p55 subfamily member 1)-like proteins Back     alignment and domain information
>gnl|CDD|212796 cd11862, SH3_MPP, Src Homology 3 domain of Membrane Protein, Palmitoylated (or MAGUK p55 subfamily member) proteins Back     alignment and domain information
>gnl|CDD|213013 cd12080, SH3_MPP1, Src Homology 3 domain of Membrane Protein, Palmitoylated 1 (or MAGUK p55 subfamily member 1) Back     alignment and domain information
>gnl|CDD|212969 cd12036, SH3_MPP5, Src Homology 3 domain of Membrane Protein, Palmitoylated 5 (or MAGUK p55 subfamily member 5) Back     alignment and domain information
>gnl|CDD|212970 cd12037, SH3_MPP2, Src Homology 3 domain of Membrane Protein, Palmitoylated 2 (or MAGUK p55 subfamily member 2) Back     alignment and domain information
>gnl|CDD|212971 cd12038, SH3_MPP6, Src Homology 3 domain of Membrane Protein, Palmitoylated 6 (or MAGUK p55 subfamily member 6) Back     alignment and domain information
>gnl|CDD|212967 cd12034, SH3_MPP4, Src Homology 3 domain of Membrane Protein, Palmitoylated 4 (or MAGUK p55 subfamily member 4) Back     alignment and domain information
>gnl|CDD|212966 cd12033, SH3_MPP7, Src Homology 3 domain of Membrane Protein, Palmitoylated 7 (or MAGUK p55 subfamily member 7) Back     alignment and domain information
>gnl|CDD|212972 cd12039, SH3_MPP3, Src Homology 3 domain of Membrane Protein, Palmitoylated 3 (or MAGUK p55 subfamily member 3) Back     alignment and domain information
>gnl|CDD|213014 cd12081, SH3_CASK, Src Homology 3 domain of Calcium/calmodulin-dependent Serine protein Kinase Back     alignment and domain information
>gnl|CDD|212968 cd12035, SH3_MPP1-like, Src Homology 3 domain of Membrane Protein, Palmitoylated 1 (or MAGUK p55 subfamily member 1)-like proteins Back     alignment and domain information
>gnl|CDD|212795 cd11861, SH3_DLG-like, Src Homology 3 domain of Disks large homolog proteins Back     alignment and domain information
>gnl|CDD|201353 pfam00625, Guanylate_kin, Guanylate kinase Back     alignment and domain information
>gnl|CDD|214620 smart00326, SH3, Src homology 3 domains Back     alignment and domain information
>gnl|CDD|212692 cd11758, SH3_CRK_N, N-terminal Src Homology 3 domain of Ct10 Regulator of Kinase adaptor proteins Back     alignment and domain information
>gnl|CDD|238026 cd00071, GMPK, Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>gnl|CDD|213013 cd12080, SH3_MPP1, Src Homology 3 domain of Membrane Protein, Palmitoylated 1 (or MAGUK p55 subfamily member 1) Back     alignment and domain information
>gnl|CDD|213788 TIGR03263, guanyl_kin, guanylate kinase Back     alignment and domain information
>gnl|CDD|212796 cd11862, SH3_MPP, Src Homology 3 domain of Membrane Protein, Palmitoylated (or MAGUK p55 subfamily member) proteins Back     alignment and domain information
>gnl|CDD|214504 smart00072, GuKc, Guanylate kinase homologues Back     alignment and domain information
>gnl|CDD|212965 cd12032, SH3_DLG2, Src Homology 3 domain of Disks Large homolog 2 Back     alignment and domain information
>gnl|CDD|219499 pfam07653, SH3_2, Variant SH3 domain Back     alignment and domain information
>gnl|CDD|212964 cd12031, SH3_DLG1, Src Homology 3 domain of Disks Large homolog 1 Back     alignment and domain information
>gnl|CDD|234719 PRK00300, gmk, guanylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|223272 COG0194, Gmk, Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily Back     alignment and domain information
>gnl|CDD|201353 pfam00625, Guanylate_kin, Guanylate kinase Back     alignment and domain information
>gnl|CDD|212962 cd12029, SH3_DLG3, Src Homology 3 domain of Disks Large homolog 3 Back     alignment and domain information
>gnl|CDD|215659 pfam00018, SH3_1, SH3 domain Back     alignment and domain information
>gnl|CDD|212774 cd11840, SH3_Intersectin_5, Fifth Src homology 3 domain (or SH3E) of Intersectin Back     alignment and domain information
>gnl|CDD|212789 cd11855, SH3_Sho1p, Src homology 3 domain of High osmolarity signaling protein Sho1p Back     alignment and domain information
>gnl|CDD|212797 cd11863, SH3_CACNB, Src Homology 3 domain of Voltage-dependent L-type calcium channel subunit beta Back     alignment and domain information
>gnl|CDD|212974 cd12041, SH3_CACNB1, Src Homology 3 domain of Voltage-dependent L-type calcium channel subunit beta-1 Back     alignment and domain information
>gnl|CDD|212706 cd11772, SH3_OSTF1, Src Homology 3 domain of metazoan osteoclast stimulating factor 1 Back     alignment and domain information
>gnl|CDD|212779 cd11845, SH3_Src_like, Src homology 3 domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|212884 cd11951, SH3_GRAP_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein Back     alignment and domain information
>gnl|CDD|212973 cd12040, SH3_CACNB2, Src Homology 3 domain of Voltage-dependent L-type calcium channel subunit beta2 Back     alignment and domain information
>gnl|CDD|212963 cd12030, SH3_DLG4, Src Homology 3 domain of Disks Large homolog 4 Back     alignment and domain information
>gnl|CDD|212701 cd11767, SH3_Nck_3, Third Src Homology 3 domain of Nck adaptor proteins Back     alignment and domain information
>gnl|CDD|212975 cd12042, SH3_CACNB3, Src Homology 3 domain of Voltage-dependent L-type calcium channel subunit beta3 Back     alignment and domain information
>gnl|CDD|212882 cd11949, SH3_GRB2_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 Back     alignment and domain information
>gnl|CDD|212758 cd11824, SH3_PSTPIP1, Src homology 3 domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 1 Back     alignment and domain information
>gnl|CDD|212703 cd11769, SH3_CSK, Src Homology 3 domain of C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|212971 cd12038, SH3_MPP6, Src Homology 3 domain of Membrane Protein, Palmitoylated 6 (or MAGUK p55 subfamily member 6) Back     alignment and domain information
>gnl|CDD|212816 cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25/Cdc25 guanine nucleotide exchange factors Back     alignment and domain information
>gnl|CDD|212761 cd11827, SH3_MyoIe_If_like, Src homology 3 domain of Myosins Ie, If, and similar proteins Back     alignment and domain information
>gnl|CDD|212976 cd12043, SH3_CACNB4, Src Homology 3 domain of Voltage-dependent L-type calcium channel subunit beta4 Back     alignment and domain information
>gnl|CDD|212969 cd12036, SH3_MPP5, Src Homology 3 domain of Membrane Protein, Palmitoylated 5 (or MAGUK p55 subfamily member 5) Back     alignment and domain information
>gnl|CDD|212970 cd12037, SH3_MPP2, Src Homology 3 domain of Membrane Protein, Palmitoylated 2 (or MAGUK p55 subfamily member 2) Back     alignment and domain information
>gnl|CDD|212739 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins Back     alignment and domain information
>gnl|CDD|212707 cd11773, SH3_Sla1p_1, First Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p Back     alignment and domain information
>gnl|CDD|212704 cd11770, SH3_Nephrocystin, Src Homology 3 domain of Nephrocystin (or Nephrocystin-1) Back     alignment and domain information
>gnl|CDD|212967 cd12034, SH3_MPP4, Src Homology 3 domain of Membrane Protein, Palmitoylated 4 (or MAGUK p55 subfamily member 4) Back     alignment and domain information
>gnl|CDD|212808 cd11875, SH3_CD2AP-like_3, Third Src Homology 3 domain (SH3C) of CD2-associated protein and similar proteins Back     alignment and domain information
>gnl|CDD|212928 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-1 Back     alignment and domain information
>gnl|CDD|212994 cd12061, SH3_betaPIX, Src Homology 3 domain of beta-Pak Interactive eXchange factor Back     alignment and domain information
>gnl|CDD|212966 cd12033, SH3_MPP7, Src Homology 3 domain of Membrane Protein, Palmitoylated 7 (or MAGUK p55 subfamily member 7) Back     alignment and domain information
>gnl|CDD|212989 cd12056, SH3_CD2AP_3, Third Src Homology 3 domain (SH3C) of CD2-associated protein Back     alignment and domain information
>gnl|CDD|212790 cd11856, SH3_p47phox_like, Src homology 3 domains of the p47phox subunit of NADPH oxidase and similar domains Back     alignment and domain information
>gnl|CDD|212738 cd11804, SH3_GRB2_like_N, N-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins Back     alignment and domain information
>gnl|CDD|215414 PLN02772, PLN02772, guanylate kinase Back     alignment and domain information
>gnl|CDD|213018 cd12142, SH3_D21-like, Src Homology 3 domain of SH3 domain-containing protein 21 (SH3D21) and similar proteins Back     alignment and domain information
>gnl|CDD|212692 cd11758, SH3_CRK_N, N-terminal Src Homology 3 domain of Ct10 Regulator of Kinase adaptor proteins Back     alignment and domain information
>gnl|CDD|212993 cd12060, SH3_alphaPIX, Src Homology 3 domain of alpha-Pak Interactive eXchange factor Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 352
KOG0609|consensus 542 100.0
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 99.81
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 99.8
PRK14737186 gmk guanylate kinase; Provisional 99.78
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 99.74
PLN02772 398 guanylate kinase 99.73
KOG4792|consensus293 99.63
PRK14738206 gmk guanylate kinase; Provisional 99.59
KOG0708|consensus359 99.51
KOG0707|consensus231 99.5
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 99.5
KOG1029|consensus1118 99.45
PRK00300 205 gmk guanylate kinase; Provisional 99.22
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 99.2
KOG0609|consensus 542 99.09
PF1460449 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 99.03
PF0001848 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho 98.99
PF0765355 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 98.9
KOG3580|consensus 1027 98.89
KOG4226|consensus379 98.82
KOG2199|consensus462 98.78
KOG4225|consensus489 98.72
KOG4348|consensus 627 98.63
KOG4226|consensus 379 98.62
cd0017454 SH3 Src homology 3 domains; SH3 domains bind to pr 98.62
smart0032658 SH3 Src homology 3 domains. Src homology 3 (SH3) d 98.59
KOG1029|consensus1118 98.58
KOG3632|consensus1335 98.57
KOG1118|consensus366 98.54
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 98.52
KOG2070|consensus 661 98.39
PRK00091 307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 98.38
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 98.32
KOG4348|consensus 627 98.3
KOG3812|consensus 475 98.28
PRK08356 195 hypothetical protein; Provisional 98.17
KOG0162|consensus1106 97.85
KOG2856|consensus472 97.75
KOG3875|consensus362 97.75
KOG0515|consensus752 97.61
KOG3601|consensus222 97.52
KOG2996|consensus865 97.48
KOG3655|consensus484 97.47
KOG3601|consensus222 97.43
TIGR00174 287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 97.41
KOG3632|consensus1335 97.39
PF0001848 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho 97.31
KOG0197|consensus 468 97.17
KOG1264|consensus 1267 97.14
KOG4225|consensus489 97.07
KOG2546|consensus483 97.06
PF1460449 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 96.77
KOG1843|consensus473 96.73
PF0765355 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 96.72
KOG2199|consensus 462 96.72
KOG2996|consensus865 96.66
PLN02840 421 tRNA dimethylallyltransferase 96.5
COG3709192 Uncharacterized component of phosphonate metabolis 96.43
KOG4792|consensus293 96.01
KOG4575|consensus 874 95.98
KOG3557|consensus721 95.87
KOG1702|consensus264 95.65
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 95.53
PRK00098298 GTPase RsgA; Reviewed 95.29
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 95.27
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 95.15
smart0032658 SH3 Src homology 3 domains. Src homology 3 (SH3) d 94.69
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 94.36
KOG3771|consensus460 94.12
cd0017454 SH3 Src homology 3 domains; SH3 domains bind to pr 94.05
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 93.91
PRK06762166 hypothetical protein; Provisional 93.85
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 93.76
KOG4278|consensus 1157 93.74
smart00382148 AAA ATPases associated with a variety of cellular 93.36
PRK08233182 hypothetical protein; Provisional 93.25
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 93.23
KOG1118|consensus366 93.22
TIGR00235207 udk uridine kinase. Model contains a number of lon 93.09
PHA02530 300 pseT polynucleotide kinase; Provisional 93.0
PRK00131175 aroK shikimate kinase; Reviewed 92.97
KOG2222|consensus848 92.79
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 92.77
PRK08118167 topology modulation protein; Reviewed 92.74
PRK14527191 adenylate kinase; Provisional 92.35
PRK14531183 adenylate kinase; Provisional 92.33
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 92.11
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 92.05
PRK03839180 putative kinase; Provisional 91.99
PRK14530215 adenylate kinase; Provisional 91.99
PRK06217183 hypothetical protein; Validated 91.88
PF00004132 AAA: ATPase family associated with various cellula 91.86
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 91.82
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 91.72
PRK06761 282 hypothetical protein; Provisional 91.66
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 91.66
PLN02200234 adenylate kinase family protein 91.65
PRK05541176 adenylylsulfate kinase; Provisional 91.47
PF1355562 AAA_29: P-loop containing region of AAA domain 91.45
PRK07261171 topology modulation protein; Provisional 91.43
PRK14532188 adenylate kinase; Provisional 91.35
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 91.34
PRK00698205 tmk thymidylate kinase; Validated 91.28
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 91.21
PF05729166 NACHT: NACHT domain 91.2
COG1126240 GlnQ ABC-type polar amino acid transport system, A 91.18
PRK14729 300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 91.04
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 91.03
PF07931174 CPT: Chloramphenicol phosphotransferase-like prote 90.78
PRK05057172 aroK shikimate kinase I; Reviewed 90.76
PRK13947171 shikimate kinase; Provisional 90.75
PRK13975196 thymidylate kinase; Provisional 90.71
PRK06547172 hypothetical protein; Provisional 90.67
PLN02165 334 adenylate isopentenyltransferase 90.59
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 90.56
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 90.56
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 90.55
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 90.49
KOG2070|consensus 661 90.45
PF00005137 ABC_tran: ABC transporter This structure is on hol 90.33
PRK05480209 uridine/cytidine kinase; Provisional 90.3
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 90.28
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 90.21
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 90.2
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 90.19
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 90.11
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 89.89
PRK06696223 uridine kinase; Validated 89.67
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 89.61
PTZ00088229 adenylate kinase 1; Provisional 89.42
PF13173128 AAA_14: AAA domain 89.41
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 89.33
PTZ00301210 uridine kinase; Provisional 89.33
PRK04040188 adenylate kinase; Provisional 89.22
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 89.21
COG4525259 TauB ABC-type taurine transport system, ATPase com 89.14
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 88.96
PRK14528186 adenylate kinase; Provisional 88.93
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 88.93
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 88.92
PRK13949169 shikimate kinase; Provisional 88.91
PRK09825176 idnK D-gluconate kinase; Provisional 88.89
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 88.85
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 88.83
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 88.83
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 88.83
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 88.82
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 88.82
PRK00889175 adenylylsulfate kinase; Provisional 88.82
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 88.79
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 88.78
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 88.74
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 88.67
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 88.62
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 88.59
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 88.58
smart00763 361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 88.58
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 88.53
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 88.49
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 88.48
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 88.48
PRK00454196 engB GTP-binding protein YsxC; Reviewed 88.48
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 88.47
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 88.36
PRK02496184 adk adenylate kinase; Provisional 88.36
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 88.31
COG1136226 SalX ABC-type antimicrobial peptide transport syst 88.21
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 88.2
cd03269210 ABC_putative_ATPase This subfamily is involved in 88.16
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 88.14
KOG1451|consensus812 88.1
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 88.04
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 87.99
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 87.96
COG1162301 Predicted GTPases [General function prediction onl 87.88
PRK13946184 shikimate kinase; Provisional 87.85
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 87.84
PRK00279215 adk adenylate kinase; Reviewed 87.77
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 87.77
PRK03731171 aroL shikimate kinase II; Reviewed 87.76
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 87.7
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 87.68
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 87.68
PRK09270229 nucleoside triphosphate hydrolase domain-containin 87.66
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 87.64
PRK01184184 hypothetical protein; Provisional 87.63
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 87.6
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 87.55
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 87.53
PF1460389 hSH3: Helically-extended SH3 domain; PDB: 1RI9_A. 87.51
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 87.5
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 87.44
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 87.43
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 87.43
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 87.41
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 87.41
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 87.36
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 87.36
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 87.36
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 87.35
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 87.34
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 87.33
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 87.32
PLN02674244 adenylate kinase 87.29
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 87.25
cd00876160 Ras Ras family. The Ras family of the Ras superfam 87.23
PRK09087226 hypothetical protein; Validated 87.22
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 87.16
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 87.15
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 87.12
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 87.12
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 87.09
cd03246173 ABCC_Protease_Secretion This family represents the 87.09
cd03234226 ABCG_White The White subfamily represents ABC tran 87.08
KOG2546|consensus483 87.08
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 87.06
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 87.04
PRK12339197 2-phosphoglycerate kinase; Provisional 87.04
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 87.04
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 87.02
KOG2528|consensus 490 87.02
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 87.01
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 86.99
cd03239178 ABC_SMC_head The structural maintenance of chromos 86.99
PRK10908222 cell division protein FtsE; Provisional 86.98
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 86.98
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 86.96
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 86.95
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 86.89
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 86.83
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 86.81
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 86.77
KOG0058|consensus716 86.76
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 86.75
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 86.74
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 86.7
KOG3523|consensus695 86.64
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 86.64
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 86.62
KOG3875|consensus362 86.58
PF09439181 SRPRB: Signal recognition particle receptor beta s 86.56
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 86.54
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 86.54
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 86.53
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 86.52
PRK14242253 phosphate transporter ATP-binding protein; Provisi 86.49
cd03216163 ABC_Carb_Monos_I This family represents the domain 86.45
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 86.42
PF13476202 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V 86.42
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 86.41
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 86.38
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 86.38
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 86.35
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 86.34
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 86.32
PRK08903227 DnaA regulatory inactivator Hda; Validated 86.31
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 86.24
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 86.22
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 86.21
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 86.18
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 86.14
PRK03846198 adenylylsulfate kinase; Provisional 86.13
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 86.09
PRK08099399 bifunctional DNA-binding transcriptional repressor 86.08
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 86.07
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 86.03
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 85.99
PRK14529223 adenylate kinase; Provisional 85.99
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 85.97
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 85.96
PRK04182180 cytidylate kinase; Provisional 85.96
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 85.92
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 85.79
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 85.78
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 85.77
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 85.74
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 85.71
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 85.71
COG4161242 ArtP ABC-type arginine transport system, ATPase co 85.7
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 85.7
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 85.65
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 85.61
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 85.58
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 85.57
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 85.54
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 85.53
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 85.5
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 85.5
TIGR00231161 small_GTP small GTP-binding protein domain. This m 85.49
cd03215182 ABC_Carb_Monos_II This family represents domain II 85.49
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 85.48
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 85.48
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 85.44
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 85.41
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 85.41
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 85.4
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 85.39
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 85.33
PRK13948182 shikimate kinase; Provisional 85.29
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 85.29
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 85.26
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 85.26
PRK14526211 adenylate kinase; Provisional 85.25
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 85.25
cd04171164 SelB SelB subfamily. SelB is an elongation factor 85.25
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 85.25
COG4639168 Predicted kinase [General function prediction only 85.25
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 85.25
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 85.24
COG1100219 GTPase SAR1 and related small G proteins [General 85.17
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 85.13
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 85.13
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 85.12
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 85.11
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 85.1
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 85.09
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 85.09
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 85.03
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 85.03
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 85.02
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 85.0
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 85.0
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 85.0
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 84.98
cd04123162 Rab21 Rab21 subfamily. The localization and functi 84.98
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 84.98
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 84.97
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 84.97
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 84.96
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 84.94
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 84.92
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 84.86
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 84.85
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 84.83
TIGR01526325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 84.79
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 84.74
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 84.73
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 84.72
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 84.7
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 84.65
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 84.59
PRK10253265 iron-enterobactin transporter ATP-binding protein; 84.59
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 84.57
TIGR01288 303 nodI ATP-binding ABC transporter family nodulation 84.57
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 84.56
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 84.55
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 84.53
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 84.52
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 84.52
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 84.51
COG0703172 AroK Shikimate kinase [Amino acid transport and me 84.51
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 84.51
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 84.51
PRK14240250 phosphate transporter ATP-binding protein; Provisi 84.49
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 84.48
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 84.47
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 84.44
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 84.43
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 84.42
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 84.4
PRK12289352 GTPase RsgA; Reviewed 84.4
PRK14239252 phosphate transporter ATP-binding protein; Provisi 84.38
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 84.36
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 84.33
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 84.31
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 84.31
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 84.27
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 84.26
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 84.16
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 84.13
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 84.12
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 84.12
PRK09984262 phosphonate/organophosphate ester transporter subu 84.09
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 84.08
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 84.08
PRK08084235 DNA replication initiation factor; Provisional 84.03
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 84.03
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 84.02
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 84.01
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 84.01
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 83.99
PRK14235267 phosphate transporter ATP-binding protein; Provisi 83.98
cd00154159 Rab Rab family. Rab GTPases form the largest famil 83.97
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 83.96
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 83.96
PRK14241258 phosphate transporter ATP-binding protein; Provisi 83.94
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 83.92
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 83.88
TIGR01188 302 drrA daunorubicin resistance ABC transporter ATP-b 83.88
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 83.88
PRK12288347 GTPase RsgA; Reviewed 83.83
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 83.8
KOG0744|consensus423 83.78
PRK09580248 sufC cysteine desulfurase ATPase component; Review 83.77
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 83.75
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 83.71
PRK10619257 histidine/lysine/arginine/ornithine transporter su 83.7
PF08298 358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 83.7
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 83.68
PRK03695248 vitamin B12-transporter ATPase; Provisional 83.58
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 83.57
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 83.57
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 83.55
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 83.51
PRK14237267 phosphate transporter ATP-binding protein; Provisi 83.46
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 83.43
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 83.42
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 83.41
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 83.4
PRK06893229 DNA replication initiation factor; Validated 83.38
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 83.36
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 83.34
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 83.34
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 83.28
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 83.27
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 83.26
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 83.26
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 83.25
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 83.15
PRK00625173 shikimate kinase; Provisional 83.15
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 83.11
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 83.1
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 83.1
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 83.08
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 83.06
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 83.05
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 83.04
COG3638258 ABC-type phosphate/phosphonate transport system, A 83.04
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 83.02
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 83.0
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 82.99
PHA00729226 NTP-binding motif containing protein 82.99
COG1125 309 OpuBA ABC-type proline/glycine betaine transport s 82.97
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 82.97
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 82.95
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 82.94
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 82.93
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 82.93
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 82.93
PLN02748 468 tRNA dimethylallyltransferase 82.88
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 82.85
PRK11144 352 modC molybdate transporter ATP-binding protein; Pr 82.82
TIGR01186 363 proV glycine betaine/L-proline transport ATP bindi 82.8
TIGR00101199 ureG urease accessory protein UreG. This model rep 82.78
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 82.76
PF1324576 AAA_19: Part of AAA domain 82.71
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 82.71
PLN02459261 probable adenylate kinase 82.71
PRK13851344 type IV secretion system protein VirB11; Provision 82.71
cd01878204 HflX HflX subfamily. A distinct conserved domain w 82.66
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 82.65
COG3172187 NadR Predicted ATPase/kinase involved in NAD metab 82.65
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 82.65
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 82.64
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 82.63
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 82.63
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 82.62
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 82.61
PRK07667193 uridine kinase; Provisional 82.61
PRK13546264 teichoic acids export protein ATP-binding subunit; 82.47
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 82.45
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provi 82.44
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 82.33
TIGR02142 354 modC_ABC molybdenum ABC transporter, ATP-binding p 82.3
PRK06620214 hypothetical protein; Validated 82.29
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 82.28
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 82.26
cd03116159 MobB Molybdenum is an essential trace element in t 82.25
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 82.24
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 82.18
PRK14243264 phosphate transporter ATP-binding protein; Provisi 82.17
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 82.16
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 82.14
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 82.11
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 82.09
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 82.08
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 82.05
PRK11650 356 ugpC glycerol-3-phosphate transporter ATP-binding 82.03
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 82.0
PRK00081194 coaE dephospho-CoA kinase; Reviewed 81.98
PRK08727233 hypothetical protein; Validated 81.97
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 81.96
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 81.91
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 81.9
PRK10851 353 sulfate/thiosulfate transporter subunit; Provision 81.88
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 81.82
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 81.78
PRK13537 306 nodulation ABC transporter NodI; Provisional 81.78
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 81.67
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 81.67
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 81.64
PRK05416 288 glmZ(sRNA)-inactivating NTPase; Provisional 81.64
PRK13536 340 nodulation factor exporter subunit NodI; Provision 81.61
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 81.61
PRK15455 644 PrkA family serine protein kinase; Provisional 81.56
PF02463220 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: 81.55
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 81.54
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 81.54
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 81.54
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 81.54
>KOG0609|consensus Back     alignment and domain information
Probab=100.00  E-value=9.4e-51  Score=410.22  Aligned_cols=214  Identities=54%  Similarity=0.922  Sum_probs=196.2

Q ss_pred             eeeeeeccccCCCCCCCCcCcCcccccccCceEEEeeccCCCceEEEEcCC--CCceeeecCChhHHHHhhhcccccccc
Q psy12793         65 QIFVRAQFNYNPLDDDLIPCAQAGIAFQIGDILQIISKDDHNWWQARKDNV--AGSAGLIPSPELQEWRTACSTIDKTKH  142 (352)
Q Consensus        65 qi~vRAlfDYdp~~d~~iPc~e~~LsF~kGDIL~Vl~~~D~~WWqaR~~~~--~g~~GlIPS~~v~e~r~a~~~~~~~~~  142 (352)
                      .+|+||+|||||.+|+.|||+|++|+|++||||+|++++|.+||||++.++  .+.+|+|||+.+++++.++.....++.
T Consensus       214 ~~~vra~FdYdP~~D~~IPCkEagl~F~~GDILqIv~qdD~nWWQA~~~~~~~~~~AGLiPS~~~qerr~a~~~~~~~~~  293 (542)
T KOG0609|consen  214 VVFVRALFDYDPKEDDLIPCKEAGLPFQRGDILQIVSQDDPNWWQARRVGDPFGGLAGLIPSKELQERRVACLRREVSKE  293 (542)
T ss_pred             eeeehhhcCcCcccCCcccchhcCCcccccceeeeccCCCcchhhhhcccCccccccccccCHHHHHHHHHHHhhhcccC
Confidence            389999999999999999999999999999999999999999999999874  578999999999999999876544322


Q ss_pred             c-cccccccccccccccccccccCCccccccccccceeeEeccCCCCcEEEEEcCCCCChhHHHHHHHhhCCCCcccccc
Q psy12793        143 E-QVNCSIFGRKKKLYKDKYLAKHNAVFDQLDLVTYEEVVKLPSFKRKTLVLLGAHGVGRRHIKNTLINKFPDKYAYPVP  221 (352)
Q Consensus       143 ~-~~~~~~~~rkkk~~k~~~~~k~~~~~~~~~i~sYEeV~~~p~~~~r~iVL~GPsG~gk~tl~~~L~~~~p~~F~~~v~  221 (352)
                      . ...|.++++|||..+.+|+.++++.+++.++++||||++|+++.+|+|||+||+|||+++|+++|+..+|++|+++||
T Consensus       294 ~~~~~c~~l~kkkk~~~~~y~~~~~~~~d~~~~~tYEEV~~~~~~~rrtlVLiGa~GvGr~elk~~Li~~~p~~f~~~VP  373 (542)
T KOG0609|consen  294 PEKTRCQRLSKKKKKKKSKYLGKHSAVFDQPELLTYEEVVRYPPFRRRTLVLIGAQGVGRRELKNKLIELNPDRFGTAVP  373 (542)
T ss_pred             CcCchhcccchhhhhhhhhhhhhcchhhhccccccHHHHhhhcccccceEEEECCcccchHHHHHHHHhhCccccccCCC
Confidence            2 237888888877677779999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccccceeEEEeecCCcchhhhhccCCCCCccccCChhHHHHHHHHhhhccccccccccccccCCccccccccCCCCCC
Q psy12793        222 QFITVCSVMFQIISKDDHNWWQARKDNVAGSAGLIPSPELQEWRTACSTIDKTKHEQGIYSSFSLPFSVYRRDTTRSPRS  301 (352)
Q Consensus       222 ~~~~~~~~~~~vl~k~~~~w~~~~~~~~~~~~g~~p~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~r~~~~  301 (352)
                      |                                                                        |||+||+
T Consensus       374 h------------------------------------------------------------------------TtR~~r~  381 (542)
T KOG0609|consen  374 H------------------------------------------------------------------------TTRPPRS  381 (542)
T ss_pred             C------------------------------------------------------------------------cCCCCCC
Confidence            9                                                                        9999999


Q ss_pred             CCcCCcceEEecHHHHHHHHHcCcEEEEEeecc-----ChhhHHHHHHcCcccc
Q psy12793        302 DEENGRAYYFISHDEMMSDIAANQYLEYGKSIL-----THPSQRHIVSCRKLVV  350 (352)
Q Consensus       302 ~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~  350 (352)
                      +|.||++|||||+++|+.+|++|+|||||+.-.     ...++|.++..||..|
T Consensus       382 ~E~dG~eY~FVSk~~~e~dI~~~~~lE~GEy~~nlYGTs~dsVr~v~~~gKicv  435 (542)
T KOG0609|consen  382 DEVDGVEYHFVSKEEMEADIRAGKFLEYGEYEGNLYGTSLDSVRNVIASGKICV  435 (542)
T ss_pred             CCCCCccceeeehHHHhhhhhcCCceecCcchhccccchHHHHHHHHHhCCEEE
Confidence            999999999999999999999999999998754     4689999999998765



>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>KOG0708|consensus Back     alignment and domain information
>KOG0707|consensus Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A Back     alignment and domain information
>PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>KOG2199|consensus Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>KOG4348|consensus Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies Back     alignment and domain information
>smart00326 SH3 Src homology 3 domains Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>KOG1118|consensus Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>KOG2070|consensus Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>KOG4348|consensus Back     alignment and domain information
>KOG3812|consensus Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>KOG2856|consensus Back     alignment and domain information
>KOG3875|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG3655|consensus Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>KOG2546|consensus Back     alignment and domain information
>PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A Back     alignment and domain information
>KOG1843|consensus Back     alignment and domain information
>PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG2199|consensus Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>KOG4575|consensus Back     alignment and domain information
>KOG3557|consensus Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>smart00326 SH3 Src homology 3 domains Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>KOG3771|consensus Back     alignment and domain information
>cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>KOG1118|consensus Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>KOG2222|consensus Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>KOG2070|consensus Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>KOG1451|consensus Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PF14603 hSH3: Helically-extended SH3 domain; PDB: 1RI9_A Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>KOG2546|consensus Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>KOG2528|consensus Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>KOG0058|consensus Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>KOG3523|consensus Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>KOG3875|consensus Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4639 Predicted kinase [General function prediction only] Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG3172 NadR Predicted ATPase/kinase involved in NAD metabolism [Coenzyme metabolism] Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query352
1kgd_A180 Crystal Structure Of The Guanylate Kinase-Like Doma 6e-13
1kgd_A180 Crystal Structure Of The Guanylate Kinase-Like Doma 1e-10
3tvt_A292 Structural Basis For Discs Large Interaction With P 2e-10
3ney_A197 Crystal Structure Of The Kinase Domain Of Mpp1P55 L 3e-08
3ney_A197 Crystal Structure Of The Kinase Domain Of Mpp1P55 L 1e-06
3uat_A296 Guanylate Kinase Domains Of The Maguk Family Scaffo 5e-08
1jxm_A301 Crystal Structure Of The Gmp Bound Sh3-Hook-Gk Frag 3e-07
1kjw_A295 Sh3-Guanylate Kinase Module From Psd-95 Length = 29 3e-07
2xkx_A721 Single Particle Analysis Of Psd-95 In Negative Stai 5e-07
2eyw_A78 N-Terminal Sh3 Domain Of Ct10-Regulated Kinase Leng 2e-06
2dvj_A230 Phosphorylated Crk-Ii Length = 230 3e-06
2eyy_A204 Ct10-Regulated Kinase Isoform I Length = 204 3e-06
2eyz_A304 Ct10-Regulated Kinase Isoform Ii Length = 304 3e-06
2l3s_A163 Structure Of The Autoinhibited Crk Length = 163 9e-06
1lvg_A 198 Crystal Structure Of Mouse Guanylate Kinase In Comp 7e-05
1m3c_A60 Solution Structure Of A Circular Form Of The N-Term 1e-04
1m3b_A58 Solution Structure Of A Circular Form Of The N-Term 1e-04
1m30_A58 Solution Structure Of N-Terminal Sh3 Domain From On 1e-04
1b07_A65 Crk Sh3 Domain Complexed With Peptoid Inhibitor Len 1e-04
1m3a_A57 Solution Structure Of A Circular Form Of The Trunca 1e-04
1cka_A57 Structural Basis For The Specific Interaction Of Ly 1e-04
3sem_A60 Sem5 Sh3 Domain Complexed With Peptoid Inhibitor Le 3e-04
1sem_A58 Structural Determinants Of Peptide-Binding Orientat 3e-04
1k76_A62 Solution Structure Of The C-Terminal Sem-5 Sh3 Doma 3e-04
1gky_A187 Refined Structure Of The Complex Between Guanylate 8e-04
1ex6_A186 Crystal Structure Of Unliganded Form Of Guanylate K 8e-04
>pdb|1KGD|A Chain A, Crystal Structure Of The Guanylate Kinase-Like Domain Of Human Cask Length = 180 Back     alignment and structure

Iteration: 1

Score = 71.6 bits (174), Expect = 6e-13, Method: Compositional matrix adjust. Identities = 44/111 (39%), Positives = 56/111 (50%), Gaps = 30/111 (27%) Query: 185 SFKRKTLVLLGAHGVGRRHIKNTLINKFPDKYAYPVPQ---------------FITVCSV 229 S RKTLVLLGAHGVGRRHIKNTLI K PD++AYP+P + Sbjct: 2 SHMRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQ 61 Query: 230 MFQIISKDDHNWWQARKDNVAGSAGLIPSPELQEWRTACSTIDKTKHEQGI 280 M Q IS +++ + + +D + G T TI K HEQG+ Sbjct: 62 MMQDISNNEYLEYGSHEDAMYG--------------TKLETIRKI-HEQGL 97
>pdb|1KGD|A Chain A, Crystal Structure Of The Guanylate Kinase-Like Domain Of Human Cask Length = 180 Back     alignment and structure
>pdb|3TVT|A Chain A, Structural Basis For Discs Large Interaction With Pins Length = 292 Back     alignment and structure
>pdb|3NEY|A Chain A, Crystal Structure Of The Kinase Domain Of Mpp1P55 Length = 197 Back     alignment and structure
>pdb|3NEY|A Chain A, Crystal Structure Of The Kinase Domain Of Mpp1P55 Length = 197 Back     alignment and structure
>pdb|3UAT|A Chain A, Guanylate Kinase Domains Of The Maguk Family Scaffold Proteins As Specific Phospho-Protein Binding Modules Length = 296 Back     alignment and structure
>pdb|1JXM|A Chain A, Crystal Structure Of The Gmp Bound Sh3-Hook-Gk Fragment Of Psd-95 Length = 301 Back     alignment and structure
>pdb|1KJW|A Chain A, Sh3-Guanylate Kinase Module From Psd-95 Length = 295 Back     alignment and structure
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure
>pdb|2EYW|A Chain A, N-Terminal Sh3 Domain Of Ct10-Regulated Kinase Length = 78 Back     alignment and structure
>pdb|2DVJ|A Chain A, Phosphorylated Crk-Ii Length = 230 Back     alignment and structure
>pdb|2EYY|A Chain A, Ct10-Regulated Kinase Isoform I Length = 204 Back     alignment and structure
>pdb|2EYZ|A Chain A, Ct10-Regulated Kinase Isoform Ii Length = 304 Back     alignment and structure
>pdb|2L3S|A Chain A, Structure Of The Autoinhibited Crk Length = 163 Back     alignment and structure
>pdb|1LVG|A Chain A, Crystal Structure Of Mouse Guanylate Kinase In Complex With Gmp And Adp Length = 198 Back     alignment and structure
>pdb|1M3C|A Chain A, Solution Structure Of A Circular Form Of The N-Terminal Sh3 Domain (E132c, E133g, R191g Mutant) From Oncogene Protein C-Crk Length = 60 Back     alignment and structure
>pdb|1M3B|A Chain A, Solution Structure Of A Circular Form Of The N-Terminal Sh3 Domain (A134c, E135g, R191g Mutant) From Oncogene Protein C-Crk Length = 58 Back     alignment and structure
>pdb|1M30|A Chain A, Solution Structure Of N-Terminal Sh3 Domain From Oncogene Protein C-Crk Length = 58 Back     alignment and structure
>pdb|1B07|A Chain A, Crk Sh3 Domain Complexed With Peptoid Inhibitor Length = 65 Back     alignment and structure
>pdb|1M3A|A Chain A, Solution Structure Of A Circular Form Of The Truncated N- Terminal Sh3 Domain From Oncogene Protein C-Crk Length = 57 Back     alignment and structure
>pdb|1CKA|A Chain A, Structural Basis For The Specific Interaction Of Lysine- Containing Proline-Rich Peptides With The N-Terminal Sh3 Domain Of C-Crk Length = 57 Back     alignment and structure
>pdb|3SEM|A Chain A, Sem5 Sh3 Domain Complexed With Peptoid Inhibitor Length = 60 Back     alignment and structure
>pdb|1SEM|A Chain A, Structural Determinants Of Peptide-Binding Orientation And Of Sequence Specificity In Sh3 Domains Length = 58 Back     alignment and structure
>pdb|1K76|A Chain A, Solution Structure Of The C-Terminal Sem-5 Sh3 Domain (Minimized Average Structure) Length = 62 Back     alignment and structure
>pdb|1GKY|A Chain A, Refined Structure Of The Complex Between Guanylate Kinase And Its Substrate Gmp At 2.0 Angstroms Resolution Length = 187 Back     alignment and structure
>pdb|1EX6|A Chain A, Crystal Structure Of Unliganded Form Of Guanylate Kinase From Yeast Length = 186 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query352
1kjw_A295 Postsynaptic density protein 95; protein-protein i 2e-46
1kjw_A295 Postsynaptic density protein 95; protein-protein i 5e-21
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 2e-42
3tvt_A 292 Disks large 1 tumor suppressor protein; DLG, SRC-h 3e-21
4dey_A337 Voltage-dependent L-type calcium channel subunit; 2e-33
4dey_A 337 Voltage-dependent L-type calcium channel subunit; 4e-10
2xkx_A721 Disks large homolog 4; structural protein, scaffol 6e-27
2xkx_A721 Disks large homolog 4; structural protein, scaffol 2e-15
3kfv_A308 Tight junction protein ZO-3; structural genomics c 6e-25
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 2e-21
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 3e-05
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 2e-18
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 1e-04
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 2e-14
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 1e-10
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 7e-14
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 9e-10
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 8e-11
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 8e-11
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 2e-04
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 9e-11
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 2e-10
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 2e-04
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 4e-10
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 5e-10
1lvg_A 198 Guanylate kinase, GMP kinase; transferase; HET: AD 5e-10
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 7e-10
1z6g_A 218 Guanylate kinase; structural genomics, SGC, struct 8e-10
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 1e-09
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 8e-04
2j41_A 207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 2e-09
1awj_A77 ITK; transferase, regulatory intramolecular comple 2e-09
1awj_A77 ITK; transferase, regulatory intramolecular comple 7e-04
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 2e-09
3tau_A 208 Guanylate kinase, GMP kinase; structural genomics, 2e-09
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 3e-09
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 5e-09
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 6e-09
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 6e-09
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 8e-09
1s96_A 219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 8e-09
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 9e-09
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 9e-09
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 9e-09
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 8e-04
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 9e-09
3tr0_A 205 Guanylate kinase, GMP kinase; purines, pyrimidines 1e-08
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 1e-08
3lnc_A 231 Guanylate kinase, GMP kinase; ALS collaborative cr 1e-08
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 1e-08
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 2e-08
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 2e-08
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 2e-08
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 2e-08
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 3e-08
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 4e-08
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 4e-08
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 4e-08
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 5e-08
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 5e-08
2cuc_A70 SH3 domain containing ring finger 2; structural ge 5e-08
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 5e-08
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 6e-08
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 6e-08
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 7e-08
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 7e-08
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 8e-08
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 8e-08
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 8e-08
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 9e-08
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 9e-08
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 1e-07
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 1e-07
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 1e-07
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 1e-07
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 1e-07
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 1e-07
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 2e-07
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 2e-07
1uti_A58 GRB2-related adaptor protein 2; signaling protein 2e-07
1i07_A60 Epidermal growth factor receptor kinase substrate 2e-07
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 2e-07
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 2e-07
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 2e-07
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 2e-07
1wxb_A68 Epidermal growth factor receptor pathway substrate 3e-07
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 3e-07
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 3e-07
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 3e-07
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 3e-07
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 3e-07
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 3e-07
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 3e-07
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 3e-07
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 3e-07
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 4e-07
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 4e-07
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 4e-07
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 4e-07
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 5e-04
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 4e-07
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 4e-07
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 5e-07
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 5e-07
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 5e-07
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 5e-07
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 5e-07
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 6e-07
3u23_A65 CD2-associated protein; structural genomics, struc 6e-07
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 6e-07
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 6e-07
2dil_A69 Proline-serine-threonine phosphatase-interacting p 7e-07
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 7e-07
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 7e-07
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 7e-07
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 3e-04
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 7e-07
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 8e-07
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 8e-07
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 9e-07
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 9e-07
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 1e-06
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 1e-06
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 1e-06
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} Length 1e-06
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 1e-06
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 1e-06
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 1e-06
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 1e-06
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 1e-06
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 1e-06
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 1e-06
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 1e-06
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 1e-06
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 2e-06
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 2e-06
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 2e-06
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 2e-06
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 2e-06
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 2e-06
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 2e-06
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 3e-06
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 3e-06
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 3e-06
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 3e-06
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 3e-06
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 4e-06
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 4e-06
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 4e-06
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 4e-06
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 4e-06
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 4e-06
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 5e-06
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 5e-06
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 5e-06
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 5e-06
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 5e-06
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 3e-05
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 5e-06
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 5e-06
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 5e-06
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 6e-06
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 6e-06
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 9e-06
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 9e-06
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 1e-05
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 1e-05
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 1e-05
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 1e-05
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 1e-05
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 1e-05
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 1e-05
2j6f_A62 CD2-associated protein; metal-binding, immune resp 2e-05
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 2e-05
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 2e-05
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 2e-05
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 2e-05
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 2e-05
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 2e-05
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 3e-05
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 3e-05
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 3e-05
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 3e-05
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 3e-05
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 3e-05
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 4e-05
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 4e-05
2pz1_A 466 RHO guanine nucleotide exchange factor 4; helical 4e-05
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 4e-05
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 5e-05
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 5e-05
2da9_A70 SH3-domain kinase binding protein 1; structural ge 7e-05
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 8e-05
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 8e-05
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 9e-05
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 1e-04
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 2e-04
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 2e-04
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 2e-04
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 2e-04
3a98_A184 DOCK2, dedicator of cytokinesis protein 2; protein 2e-04
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 2e-04
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 3e-04
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 4e-04
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 4e-04
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 4e-04
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 5e-04
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Length = 295 Back     alignment and structure
 Score =  159 bits (403), Expect = 2e-46
 Identities = 36/159 (22%), Positives = 67/159 (42%), Gaps = 28/159 (17%)

Query: 67  FVRAQFNYNPLDDDLIPCAQAGIAFQIGDILQIISKDDHNWWQARK---DNVAGSAGLIP 123
           ++RA F+Y+   D         ++F+ GD+L +I   D  WWQAR+   D+     G IP
Sbjct: 3   YIRALFDYDKTKDCGFLSQ--ALSFRFGDVLHVIDAGDEEWWQARRVHSDSETDDIGFIP 60

Query: 124 SPELQEWRTACSTIDKTKHEQVNCSIFGRKKKLYKDKYLAKHNAVFDQLDLVTYEEVVKL 183
           S    E R                       +L    + +   +   +  +++YE V ++
Sbjct: 61  SKRRVERREW--------------------SRLKAKDWGSSSGSQGREDSVLSYETVTQM 100

Query: 184 PSFKRKTLVLLGAHGVGRRHIKNTLINKFPDKYAYPVPQ 222
                + +++LG     +    + L+++FPDK+   VP 
Sbjct: 101 EVHYARPIIILGP---TKDRANDDLLSEFPDKFGSCVPH 136


>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Length = 295 Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Length = 292 Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Length = 292 Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Length = 337 Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Length = 337 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Length = 308 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Length = 180 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Length = 180 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} Length = 197 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} Length = 197 Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Length = 65 Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Length = 67 Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Length = 67 Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Length = 57 Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Length = 67 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Length = 198 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Length = 204 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Length = 218 Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Length = 207 Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Length = 77 Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Length = 77 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Length = 207 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Length = 208 Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} PDB: 3h0i_A 3h0f_A* Length = 73 Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Length = 71 Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 69 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Length = 219 Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A 1qwf_A 1prl_C ... Length = 84 Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Length = 120 Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Length = 120 Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Length = 92 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Length = 205 Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Length = 71 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Length = 231 Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 80 Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Length = 79 Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Length = 65 Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Length = 58 Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Length = 70 Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Length = 70 Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Length = 108 Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Length = 83 Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Length = 69 Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Length = 67 Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Length = 76 Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} Length = 73 Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Length = 64 Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Length = 58 Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Length = 58 Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Length = 60 Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Length = 58 Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Length = 62 Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Length = 62 Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 76 Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Length = 68 Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Length = 73 Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Length = 86 Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Length = 59 Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Length = 80 Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Length = 59 Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Length = 58 Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Length = 60 Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Length = 60 Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 68 Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 69 Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Length = 63 Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Length = 65 Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Length = 62 Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Length = 65 Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Length = 68 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 98 Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Length = 58 Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Length = 68 Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} PDB: 2d1x_A Length = 65 Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Length = 65 Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Length = 58 Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Length = 73 Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 96 Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Length = 89 Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Length = 90 Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 80 Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Length = 60 Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Length = 69 Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Length = 73 Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 62 Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Length = 60 Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Length = 73 Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Length = 73 Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Length = 54 Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 69 Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Length = 68 Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Length = 74 Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Length = 93 Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 58 Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Length = 67 Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Length = 58 Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Length = 64 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Length = 58 Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Length = 71 Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Length = 60 Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 79 Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 72 Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Length = 61 Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Length = 142 Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Length = 62 Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Length = 67 Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Length = 69 Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Length = 65 Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Length = 64 Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Length = 62 Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Length = 58 Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 74 Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 93 Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Length = 466 Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Length = 69 Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 70 Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Length = 60 Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Length = 77 Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Length = 341 Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Length = 184 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} Length = 67 Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Length = 63 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Length = 62 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query352
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 100.0
1kjw_A295 Postsynaptic density protein 95; protein-protein i 100.0
2xkx_A721 Disks large homolog 4; structural protein, scaffol 100.0
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 99.96
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 99.96
4dey_A 337 Voltage-dependent L-type calcium channel subunit; 99.92
3kfv_A308 Tight junction protein ZO-3; structural genomics c 99.91
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 99.84
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 99.66
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 99.41
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 99.4
3tau_A 208 Guanylate kinase, GMP kinase; structural genomics, 99.4
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.37
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 99.34
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 99.32
2lx7_A60 GAS-7, growth arrest-specific protein 7; structura 99.31
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 99.3
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 99.29
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 99.27
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 99.25
2lj0_A65 Sorbin and SH3 domain-containing protein 1; R85FL, 99.25
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 98.89
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 99.23
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 99.21
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 99.19
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 99.19
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 99.17
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 99.17
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 99.16
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 99.14
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 99.13
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 99.13
1uti_A58 GRB2-related adaptor protein 2; signaling protein 99.13
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 99.13
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 99.13
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 99.13
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 99.12
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 99.12
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 99.12
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 99.12
1i07_A60 Epidermal growth factor receptor kinase substrate 99.12
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 99.12
1s96_A 219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 99.11
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 99.11
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 99.11
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} 99.11
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 99.11
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 99.11
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 99.11
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 99.11
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 99.11
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 99.1
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 99.1
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 99.1
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 99.1
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 99.1
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 99.1
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 99.09
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 99.09
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 99.09
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 99.09
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.09
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 99.09
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 99.09
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 99.09
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 99.08
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 99.08
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 99.08
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 99.08
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 99.08
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 99.08
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 99.08
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 99.08
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 99.07
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 99.07
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 99.07
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 99.07
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 99.07
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 99.07
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 99.07
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 99.07
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 99.07
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 99.06
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 99.06
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 99.06
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 99.06
2j6f_A62 CD2-associated protein; metal-binding, immune resp 99.06
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 99.06
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 99.06
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 99.06
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 99.06
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 99.06
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 99.06
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 99.06
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 99.06
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 99.06
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 99.05
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 99.05
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 99.05
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 99.05
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 99.05
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 99.05
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 99.05
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 99.05
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 99.04
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 99.04
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 99.04
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 99.04
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 99.04
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 99.04
1awj_A77 ITK; transferase, regulatory intramolecular comple 99.04
1wxb_A68 Epidermal growth factor receptor pathway substrate 99.03
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 99.03
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 99.03
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 99.03
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.03
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 99.03
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 99.03
3u23_A65 CD2-associated protein; structural genomics, struc 99.03
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 99.03
4glm_A72 Dynamin-binding protein; SH3 domain, DNMBP, struct 99.03
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 99.02
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 99.02
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 99.02
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 99.02
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 99.02
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 99.02
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 99.02
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 99.02
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 99.02
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 99.02
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 99.02
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 99.02
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 99.01
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 99.01
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 99.01
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 99.01
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 99.01
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 99.01
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 99.01
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 99.01
2cuc_A70 SH3 domain containing ring finger 2; structural ge 99.01
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 99.01
2dil_A69 Proline-serine-threonine phosphatase-interacting p 99.01
2m0y_A74 Dedicator of cytokinesis protein 1; apoptosis; NMR 99.01
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 99.01
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 99.0
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 99.0
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 99.0
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 99.0
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 99.0
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 99.0
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 99.0
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 99.0
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 99.0
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 99.0
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 99.0
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 98.99
2da9_A70 SH3-domain kinase binding protein 1; structural ge 98.99
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 98.99
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 98.99
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 98.98
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 98.98
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 98.98
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 98.98
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 98.97
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 98.97
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 98.96
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 98.96
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 98.95
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 98.95
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 98.95
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 98.94
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 98.94
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 98.94
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 98.93
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 98.92
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 98.92
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 98.91
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 98.9
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 98.89
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 98.89
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 98.87
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 98.87
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 98.86
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 98.86
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 98.85
1u3o_A82 Huntingtin-associated protein-interacting protein; 98.85
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 98.84
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 98.84
3i5r_A83 Phosphatidylinositol 3-kinase regulatory subunit a 98.83
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 98.8
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 98.79
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 98.77
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 98.76
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 98.74
3lnc_A 231 Guanylate kinase, GMP kinase; ALS collaborative cr 98.7
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 98.69
3tr0_A 205 Guanylate kinase, GMP kinase; purines, pyrimidines 98.65
3jv3_A283 Intersectin-1; SH3 domain, DH domain, guanine nucl 98.64
3a98_A184 DOCK2, dedicator of cytokinesis protein 2; protein 98.63
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 98.59
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 98.57
2j41_A 207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 98.56
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 98.55
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 98.54
3tvt_A 292 Disks large 1 tumor suppressor protein; DLG, SRC-h 98.52
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 98.5
2pz1_A 466 RHO guanine nucleotide exchange factor 4; helical 98.49
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 98.47
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 98.44
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 98.39
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 98.38
2de0_X526 Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran 98.35
2gtj_A96 FYN-binding protein; SH3, redox, signaling protein 98.35
1ri9_A102 FYN-binding protein; SH3-like, helically extended, 98.34
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 98.3
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 97.63
1v1c_A71 Obscurin; muscle, sarcomere, adapter, myogenesis, 98.28
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 98.26
4dey_A 337 Voltage-dependent L-type calcium channel subunit; 98.19
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 98.17
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 98.12
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 98.07
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 98.01
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 97.95
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 97.85
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 97.82
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 97.82
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 97.78
3pvl_A655 Myosin VIIA isoform 1; protein complex, novel fold 97.76
3kfv_A 308 Tight junction protein ZO-3; structural genomics c 97.66
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 97.58
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 97.56
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 97.54
1kjw_A 295 Postsynaptic density protein 95; protein-protein i 97.53
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 97.43
2lx7_A60 GAS-7, growth arrest-specific protein 7; structura 97.34
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 97.32
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 97.29
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 97.26
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 97.24
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 97.23
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 97.22
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 97.21
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 97.2
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 97.19
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 97.19
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 97.18
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 97.18
1awj_A77 ITK; transferase, regulatory intramolecular comple 97.17
1uti_A58 GRB2-related adaptor protein 2; signaling protein 97.16
2lj0_A65 Sorbin and SH3 domain-containing protein 1; R85FL, 97.15
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 97.15
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 97.15
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 97.14
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 97.14
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 97.12
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} 97.12
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 97.11
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 97.11
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 97.09
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 97.08
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 97.07
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 97.07
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 97.07
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 97.06
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 97.06
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 97.05
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 97.05
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 97.04
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 97.04
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 97.04
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 97.03
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 97.02
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 97.02
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 97.01
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 97.01
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 97.0
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 96.97
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 96.96
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 96.96
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 96.96
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 96.95
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 96.95
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 96.95
2j6f_A62 CD2-associated protein; metal-binding, immune resp 96.94
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 96.94
1ug1_A92 KIAA1010 protein; structural genomics, SH3 domain, 96.94
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 96.93
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 96.92
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 96.91
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 96.91
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 96.91
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 96.9
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 96.87
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 96.87
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 96.87
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 96.87
3r6n_A450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 96.86
1i07_A60 Epidermal growth factor receptor kinase substrate 96.86
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 96.86
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 96.86
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 96.85
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 96.85
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 96.84
2dil_A69 Proline-serine-threonine phosphatase-interacting p 96.82
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 96.82
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 96.82
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 96.81
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 96.8
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 96.8
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 96.79
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 96.78
4glm_A72 Dynamin-binding protein; SH3 domain, DNMBP, struct 96.78
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 96.78
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 96.78
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 96.77
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 96.77
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 96.77
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 96.77
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 96.76
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 96.76
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 96.75
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 96.75
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 96.75
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 96.75
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 96.75
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 96.75
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 96.74
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 96.74
3u23_A65 CD2-associated protein; structural genomics, struc 96.74
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 96.73
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 96.73
2da9_A70 SH3-domain kinase binding protein 1; structural ge 96.72
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 96.72
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 96.71
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 96.71
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 96.71
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 96.71
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 96.7
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 96.7
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 96.7
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 96.69
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 96.69
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 96.69
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 96.68
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 96.68
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 96.68
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 96.66
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 96.66
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 96.66
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 96.65
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 96.64
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 96.64
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 96.64
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 96.63
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 96.62
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 96.62
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 96.61
2m0y_A74 Dedicator of cytokinesis protein 1; apoptosis; NMR 96.61
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 96.6
1wxb_A68 Epidermal growth factor receptor pathway substrate 96.6
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 96.6
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 96.6
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 96.59
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 96.59
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 96.59
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 96.58
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 96.57
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 96.55
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 96.54
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 96.54
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 96.54
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 96.53
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 96.53
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 96.52
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 96.51
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 96.51
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 96.51
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 96.5
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 96.5
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 96.49
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 96.47
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 96.47
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 96.46
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 96.43
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 96.42
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 96.4
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 96.39
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 96.37
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 96.37
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 96.27
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 96.26
2cuc_A70 SH3 domain containing ring finger 2; structural ge 96.24
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 96.23
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 96.23
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 96.19
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 96.15
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 96.14
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 96.1
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 96.07
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 96.0
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 96.0
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 95.94
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 95.93
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 95.91
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 95.91
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 95.89
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 95.83
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 95.8
1u3o_A82 Huntingtin-associated protein-interacting protein; 95.77
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 95.74
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 95.69
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 95.65
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 95.64
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 95.59
3jv3_A 283 Intersectin-1; SH3 domain, DH domain, guanine nucl 95.55
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 95.54
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 95.3
3i5r_A83 Phosphatidylinositol 3-kinase regulatory subunit a 95.29
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 95.11
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 95.05
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 95.04
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 95.03
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 94.67
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 94.63
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 94.56
3a98_A184 DOCK2, dedicator of cytokinesis protein 2; protein 94.48
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 94.37
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 94.36
2pz1_A 466 RHO guanine nucleotide exchange factor 4; helical 94.3
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 94.26
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 94.2
1kag_A173 SKI, shikimate kinase I; transferase, structural g 94.19
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 94.18
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 94.16
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 94.1
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 94.05
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 94.03
3vaa_A199 Shikimate kinase, SK; structural genomics, center 93.96
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 93.81
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 93.75
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 93.72
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 93.54
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 93.51
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 93.51
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 93.37
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 93.2
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 93.19
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 93.12
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 93.12
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 93.08
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 92.94
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 92.88
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 92.85
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 92.75
2vli_A183 Antibiotic resistance protein; transferase, tunica 92.71
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 92.69
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 92.56
3tlx_A243 Adenylate kinase 2; structural genomics, structura 92.5
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 92.48
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 92.44
1via_A175 Shikimate kinase; structural genomics, transferase 92.34
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 92.34
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 92.22
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 92.15
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 92.14
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 92.14
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 92.13
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 92.12
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 91.82
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 91.8
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 91.76
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 91.75
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 91.73
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 91.68
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 91.66
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 91.65
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 91.49
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 91.45
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 91.34
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 91.22
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 91.14
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 91.12
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 91.06
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 91.04
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 91.03
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 90.95
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 90.88
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 90.83
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 90.82
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 90.81
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 90.73
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 90.72
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 90.59
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 90.5
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 90.48
3bos_A242 Putative DNA replication factor; P-loop containing 90.36
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 90.28
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
Probab=100.00  E-value=1.5e-41  Score=326.53  Aligned_cols=181  Identities=32%  Similarity=0.589  Sum_probs=144.5

Q ss_pred             eeeeeeeccccCCCCCCCCcCcCcccccccCceEEEeeccCCCceEEEEcCC---CCceeeecCChhHHHHhhhcccccc
Q psy12793         64 LQIFVRAQFNYNPLDDDLIPCAQAGIAFQIGDILQIISKDDHNWWQARKDNV---AGSAGLIPSPELQEWRTACSTIDKT  140 (352)
Q Consensus        64 lqi~vRAlfDYdp~~d~~iPc~e~~LsF~kGDIL~Vl~~~D~~WWqaR~~~~---~g~~GlIPS~~v~e~r~a~~~~~~~  140 (352)
                      ..+||||+|||+|..|+++||+  ||+|++||||||+++.|.+||||++++.   +.++|+|||+.+++++...+..   
T Consensus         4 ~s~yvRa~fdY~~~~D~~~P~~--gL~F~~gDiL~V~~~~d~~wWqA~~v~~~~~~~~~GlIPS~~~~e~~~~~~~~---   78 (292)
T 3tvt_A            4 RSLYVRALFDYDPNRDDGLPSR--GLPFKHGDILHVTNASDDEWWQARRVLGDNEDEQIGIVPSKRRWERKMRARDR---   78 (292)
T ss_dssp             -CCEEEECSCBCC-----------CCCBCTTCEEEEEECCSSSEEEECCCCC--------EEECHHHHHHHHHC------
T ss_pred             ceEEEEEeccCCCCCCCCCCCC--cCCcCCCCEEEEeecCCCCeEEEEEeCCCCCccceeEEeChHHHHHHHHHhhc---
Confidence            3589999999999999999996  7999999999999999999999999754   4458999999988866543110   


Q ss_pred             ccccccccccccccccccccccccCCccccccccccceeeEeccCCCCcEEEEEcCCCCChhHHHHHHHhhCCCCccccc
Q psy12793        141 KHEQVNCSIFGRKKKLYKDKYLAKHNAVFDQLDLVTYEEVVKLPSFKRKTLVLLGAHGVGRRHIKNTLINKFPDKYAYPV  220 (352)
Q Consensus       141 ~~~~~~~~~~~rkkk~~k~~~~~k~~~~~~~~~i~sYEeV~~~p~~~~r~iVL~GPsG~gk~tl~~~L~~~~p~~F~~~v  220 (352)
                                                ......++++||+|++++++.+|||||+||+   |+||.++|+.++|+.|.+++
T Consensus        79 --------------------------~~~~~~~~~~YE~V~~~~~~~~RpvVl~Gp~---K~tl~~~Ll~~~p~~f~~sV  129 (292)
T 3tvt_A           79 --------------------------SVKSEENVLSYEAVQRLSINYTRPVIILGPL---KDRINDDLISEYPDKFGSCV  129 (292)
T ss_dssp             ---------------------------------CCCEEEEEEEECSSCCCEEEESTT---HHHHHHHHHHHCTTTEECCC
T ss_pred             --------------------------cccccccccchheEEeccCCCCCeEEEeCCC---HHHHHHHHHHhChhhccccc
Confidence                                      0012346789999999999999999999995   99999999999999999999


Q ss_pred             cccccccceeEEEeecCCcchhhhhccCCCCCccccCChhHHHHHHHHhhhccccccccccccccCCccccccccCCCCC
Q psy12793        221 PQFITVCSVMFQIISKDDHNWWQARKDNVAGSAGLIPSPELQEWRTACSTIDKTKHEQGIYSSFSLPFSVYRRDTTRSPR  300 (352)
Q Consensus       221 ~~~~~~~~~~~~vl~k~~~~w~~~~~~~~~~~~g~~p~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~r~~~  300 (352)
                      ++                                                                        |||+||
T Consensus       130 s~------------------------------------------------------------------------TTR~pR  137 (292)
T 3tvt_A          130 PH------------------------------------------------------------------------TTRPKR  137 (292)
T ss_dssp             CE------------------------------------------------------------------------ECSCCC
T ss_pred             cC------------------------------------------------------------------------CccCCc
Confidence            99                                                                        999999


Q ss_pred             CCCcCCcceEEe-cHHHHHHHHHcCcEEEEEeecc-----ChhhHHHHHHcCcccc
Q psy12793        301 SDEENGRAYYFI-SHDEMMSDIAANQYLEYGKSIL-----THPSQRHIVSCRKLVV  350 (352)
Q Consensus       301 ~~e~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~  350 (352)
                      ++|.||++|||| |+++|+.+|+++.||||++...     ...+++.+++.|+.||
T Consensus       138 ~gE~dG~dY~Fv~s~e~fe~~i~~~~flE~a~~~gn~YGT~~~~V~~~~~~gk~vi  193 (292)
T 3tvt_A          138 EYEVDGRDYHFVSSREQMERDIQNHLFIEAGQYNDNLYGTSVASVREVAEKGKHCI  193 (292)
T ss_dssp             TTCCBTTTBEECSCHHHHHHHHHTTCEEEEEEETTEEEEEEHHHHHHHHHHTCEEE
T ss_pred             CCccCCccccccCCHHHHHHHHhcCceEEEEEEccceeEEehHHHHHHHHcCCcEE
Confidence            999999999999 9999999999999999998765     4578999999999876



>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Back     alignment and structure
>4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Back     alignment and structure
>2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Back     alignment and structure
>2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A Back     alignment and structure
>1ri9_A FYN-binding protein; SH3-like, helically extended, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Back     alignment and structure
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Back     alignment and structure
>2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Back     alignment and structure
>1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Back     alignment and structure
>2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 352
d1t0ha_96 b.34.2.1 (A:) SH3-like domain of the L-type calciu 2e-23
d1t0ha_96 b.34.2.1 (A:) SH3-like domain of the L-type calciu 4e-08
d1vyua1136 b.34.2.1 (A:39-174) SH3-like domain of the L-type 1e-22
d1vyua1136 b.34.2.1 (A:39-174) SH3-like domain of the L-type 2e-07
d1vyva1145 b.34.2.1 (A:71-215) SH3-like domain of the L-type 2e-21
d1vyva1145 b.34.2.1 (A:71-215) SH3-like domain of the L-type 2e-07
d1kjwa196 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicu 6e-15
d1kjwa196 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicu 2e-05
d1ckaa_57 b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse 3e-11
d1ckaa_57 b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse 5e-04
d1sema_58 b.34.2.1 (A:) Growth factor receptor-bound protein 3e-09
d1awwa_67 b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Hom 4e-09
d1gcqa_56 b.34.2.1 (A:) Growth factor receptor-bound protein 4e-09
d1ujya_76 b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens 6e-09
d1u06a155 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chic 8e-09
d1uj0a_58 b.34.2.1 (A:) Signal transducing adaptor molecule 2e-08
d1k4us_62 b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId 3e-08
d1gl5a_67 b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musc 3e-08
d2hspa_71 b.34.2.1 (A:) Phospholipase C, SH3 domain {Human ( 4e-08
d1utia_57 b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona 4e-08
d1jo8a_58 b.34.2.1 (A:) Actin binding protein ABP1 {Baker's 1e-07
d1udla_98 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 2e-07
d1arka_60 b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo 3e-07
d2rn8a153 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus 4e-07
d2v1ra167 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pe 8e-07
d1qcfa165 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Hu 1e-06
d1fmka164 b.34.2.1 (A:82-145) c-src protein tyrosine kinase 1e-06
d1efna_57 b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, 1e-06
d1k9aa171 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (cs 2e-06
d1u5sa171 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [Tax 2e-06
d1spka_72 b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RI 2e-06
d1ng2a2118 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic 5e-06
d1ycsb263 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [ 5e-06
d1ugva_72 b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA062 5e-06
d2iima162 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 d 7e-06
d1wiea_96 b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human 7e-06
d1j3ta_74 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 1e-05
d1uhfa_69 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 1e-05
d1gria156 b.34.2.1 (A:1-56) Growth factor receptor-bound pro 2e-05
d1ue9a_80 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 2e-05
d1kgda_178 c.37.1.1 (A:) Guanylate kinase-like domain of Cask 3e-05
d1wfwa_74 b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [Ta 5e-05
d1oota_58 b.34.2.1 (A:) Hypothetical protein YFR024c {Baker' 6e-05
d1ng2a158 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic 1e-04
d1opka157 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domai 1e-04
d1bb9a_83 b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicu 2e-04
d1zuua156 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyc 6e-04
d1i07a_59 b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus 0.001
d1wlpb153 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic 0.003
d1gcqc_69 b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mu 0.003
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 96 Back     information, alignment and structure

class: All beta proteins
fold: SH3-like barrel
superfamily: SH3-domain
family: SH3-domain
domain: SH3-like domain of the L-type calcium channel
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]
 Score = 90.8 bits (225), Expect = 2e-23
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 1/68 (1%)

Query: 67  FVRAQFNYNPLDDDLIPCAQAGIAFQIGDILQIISKDDHNWWQARKDNVAGSAGLIPSP- 125
            VR    Y+   +D +P     I+F+  D L +  K +++WW  R        G IPSP 
Sbjct: 23  AVRTNVRYSAAQEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPV 82

Query: 126 ELQEWRTA 133
           +L+  R  
Sbjct: 83  KLENMRLQ 90


>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 96 Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 96 Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 96 Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Length = 58 Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 55 Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 67 Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 69 Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Length = 74 Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 83 Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 69 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query352
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 99.82
d1s96a_ 205 Guanylate kinase {Escherichia coli [TaxId: 562]} 99.8
d1vyua1136 SH3-like domain of the L-type calcium channel {Rat 99.75
d1vyva1145 SH3-like domain of the L-type calcium channel {Rat 99.75
d1t0ha_96 SH3-like domain of the L-type calcium channel {Rab 99.74
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 99.74
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 99.72
d1kjwa2199 Guanylate kinase-like domain of Psd-95 {Rat (Rattu 99.71
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 99.69
d1kjwa196 Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.67
d1ckaa_57 C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) 99.39
d2rn8a153 Bruton's tyrosine kinase {Mus musculus [TaxId: 100 99.35
d1gcqa_56 Growth factor receptor-bound protein 2 (GRB2), N- 99.28
d1k4us_62 p67phox {Human (Homo sapiens) [TaxId: 9606]} 99.26
d1jo8a_58 Actin binding protein ABP1 {Baker's yeast (Sacchar 99.26
d1utia_57 Grb2-related adaptor protein 2 (Mona/Gads) {Mouse 99.24
d1u06a155 alpha-Spectrin, SH3 domain {Chicken (Gallus gallus 99.24
d1sema_58 Growth factor receptor-bound protein 2 (GRB2), N- 99.23
d1gl5a_67 tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 99.22
d1uj0a_58 Signal transducing adaptor molecule Stam2 {Mouse ( 99.21
d1arka_60 SH3 domain from nebulin {Human (Homo sapiens) [Tax 99.21
d2v1ra167 Peroxisomal membrane protein Pex13p {Baker's yeast 99.19
d1efna_57 Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu 99.19
d1i07a_59 EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 99.18
d1ujya_76 Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 99.17
d1ng2a158 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.17
d1wfwa_74 Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} 99.16
d1zuua156 BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.15
d1ue9a_80 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.12
d1awwa_67 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 99.12
d1wlpb153 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.11
d1ycsb263 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.11
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.11
d1qcfa165 Hemapoetic cell kinase Hck {Human (Homo sapiens) [ 99.09
d2hspa_71 Phospholipase C, SH3 domain {Human (Homo sapiens) 99.08
d1wiea_96 RIM binding protein 2, RIMBP2 {Human (Homo sapiens 99.08
d1fmka164 c-src protein tyrosine kinase {Human (Homo sapiens 99.08
d1u5sa171 Nck-2 {Human (Homo sapiens) [TaxId: 9606]} 99.06
d1k9aa171 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.05
d1spka_72 BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 99.05
d1opka157 Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul 99.04
d2iima162 p56-lck tyrosine kinase, SH3 domain {Human (Homo s 99.02
d1uffa_93 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.01
d1j3ta_74 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.01
d1ng2a2118 p47pox (neutrophil cytosolic factor 1) {Human (Hom 98.99
d1oota_58 Hypothetical protein YFR024c {Baker's yeast (Sacch 98.98
d1uhfa_69 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 98.95
d1uhca_79 Hypothetical protein Baa76854.1 (KIAA1010) {Human 98.95
d1gria156 Growth factor receptor-bound protein 2 (GRB2), N- 98.94
d1ugva_72 Olygophrenin-1 like protein (KIAA0621) {Human (Hom 98.94
d1i1ja_106 Melanoma inhibitory activity protein {Human (Homo 98.91
d1ug1a_92 Hypothetical protein Baa76854.1 (KIAA1010) {Human 98.88
d1phta_83 Phosphatidylinositol 3-kinase (p85-alpha subunit, 98.82
d1gcqc_69 Vav N-terminal SH3 domain {Mouse (Mus musculus) [T 98.81
d1bb9a_83 Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 98.81
d1t0ha_96 SH3-like domain of the L-type calcium channel {Rab 98.73
d1vyua1136 SH3-like domain of the L-type calcium channel {Rat 98.62
d1vyva1145 SH3-like domain of the L-type calcium channel {Rat 98.58
d1kjwa196 Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} 98.28
d2rn8a153 Bruton's tyrosine kinase {Mus musculus [TaxId: 100 97.48
d1wlpb153 p47pox (neutrophil cytosolic factor 1) {Human (Hom 97.38
d1u06a155 alpha-Spectrin, SH3 domain {Chicken (Gallus gallus 97.35
d1ue9a_80 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 97.3
d1zuua156 BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 97.27
d1ckaa_57 C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) 97.25
d1jo8a_58 Actin binding protein ABP1 {Baker's yeast (Sacchar 97.24
d2hspa_71 Phospholipase C, SH3 domain {Human (Homo sapiens) 97.23
d1k4us_62 p67phox {Human (Homo sapiens) [TaxId: 9606]} 97.18
d1gl5a_67 tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 97.17
d1ng2a158 p47pox (neutrophil cytosolic factor 1) {Human (Hom 97.16
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 97.15
d1awwa_67 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 97.13
d1wfwa_74 Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} 97.13
d1uj0a_58 Signal transducing adaptor molecule Stam2 {Mouse ( 97.11
d1fmka164 c-src protein tyrosine kinase {Human (Homo sapiens 97.05
d1utia_57 Grb2-related adaptor protein 2 (Mona/Gads) {Mouse 96.96
d1sema_58 Growth factor receptor-bound protein 2 (GRB2), N- 96.87
d1gcqa_56 Growth factor receptor-bound protein 2 (GRB2), N- 96.87
d1ng2a2118 p47pox (neutrophil cytosolic factor 1) {Human (Hom 96.84
d1efna_57 Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu 96.82
d1i07a_59 EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 96.77
d1arka_60 SH3 domain from nebulin {Human (Homo sapiens) [Tax 96.71
d1ujya_76 Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 96.69
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.69
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.64
d1ycsb263 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 96.62
d1uhfa_69 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 96.59
d1i1ja_106 Melanoma inhibitory activity protein {Human (Homo 96.57
d2v1ra167 Peroxisomal membrane protein Pex13p {Baker's yeast 96.56
d1spka_72 BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 96.53
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.52
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.43
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.37
d1opka157 Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul 96.33
d1j3ta_74 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 96.19
d1bb9a_83 Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 96.0
d1gria156 Growth factor receptor-bound protein 2 (GRB2), N- 96.0
d1uhca_79 Hypothetical protein Baa76854.1 (KIAA1010) {Human 95.98
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 95.93
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.9
d2iima162 p56-lck tyrosine kinase, SH3 domain {Human (Homo s 95.82
d1u5sa171 Nck-2 {Human (Homo sapiens) [TaxId: 9606]} 95.82
d1k9aa171 Carboxyl-terminal src kinase (csk) {Human (Homo sa 95.78
d1ug1a_92 Hypothetical protein Baa76854.1 (KIAA1010) {Human 95.71
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 95.63
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.61
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.59
d1oota_58 Hypothetical protein YFR024c {Baker's yeast (Sacch 95.49
d1uffa_93 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 95.44
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 95.4
d1gcqc_69 Vav N-terminal SH3 domain {Mouse (Mus musculus) [T 95.31
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.29
d1wiea_96 RIM binding protein 2, RIMBP2 {Human (Homo sapiens 95.21
d1qcfa165 Hemapoetic cell kinase Hck {Human (Homo sapiens) [ 95.17
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.15
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 95.07
d1ugva_72 Olygophrenin-1 like protein (KIAA0621) {Human (Hom 95.03
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 94.88
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 94.83
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 94.8
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 94.67
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 94.55
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.55
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 94.51
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 94.35
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 94.31
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 94.19
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 93.94
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.93
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 93.92
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 93.91
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 93.79
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 93.64
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 93.6
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 93.32
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 93.25
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 93.08
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 93.07
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 92.76
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 92.61
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 92.52
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 92.39
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 92.27
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 92.01
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 91.95
d1phta_83 Phosphatidylinositol 3-kinase (p85-alpha subunit, 91.75
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 91.47
d1nrjb_209 Signal recognition particle receptor beta-subunit 91.17
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 90.92
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 90.76
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 90.29
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 90.24
d1j8yf2211 GTPase domain of the signal sequence recognition p 90.23
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 90.1
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 90.06
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 90.04
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 89.92
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 89.86
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 89.64
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 89.6
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 89.58
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 89.57
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 89.54
d2awna2232 Maltose transport protein MalK, N-terminal domain 89.54
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 89.43
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 89.28
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 89.21
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 89.17
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 89.04
d1ri9a_77 Fyn-binding protein (T-cell adapter protein adap) 88.99
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 88.96
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 88.9
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 88.76
d2fh5b1207 Signal recognition particle receptor beta-subunit 88.72
d1vmaa2213 GTPase domain of the signal recognition particle r 88.66
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 88.51
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 88.45
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 88.44
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 88.38
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 88.36
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 88.36
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 88.33
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 88.18
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 87.78
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 87.67
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 87.62
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 87.39
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 87.32
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 87.22
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 87.21
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 87.14
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 87.12
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 87.09
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 86.94
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 86.93
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 86.84
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 86.82
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 86.76
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 86.75
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 86.66
d1g2912240 Maltose transport protein MalK, N-terminal domain 86.63
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 86.59
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 86.58
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 86.52
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 86.5
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 86.48
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 86.47
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 86.43
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 86.42
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 86.42
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 86.33
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 86.27
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 86.27
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 86.26
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 86.16
d1ls1a2207 GTPase domain of the signal sequence recognition p 86.15
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 86.14
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 86.08
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 85.93
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 85.86
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 85.72
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 85.71
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 85.71
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 85.7
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 85.59
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 85.56
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 85.4
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 85.37
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 85.32
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 85.3
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 85.22
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 85.1
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 84.98
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 84.97
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 84.96
d1okkd2207 GTPase domain of the signal recognition particle r 84.78
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 84.73
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 84.65
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 84.44
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 84.44
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 84.36
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 84.27
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 84.22
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 84.19
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 84.07
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 84.0
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 83.91
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 83.82
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 83.8
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 83.69
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 83.69
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 83.63
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 83.48
d2qy9a2211 GTPase domain of the signal recognition particle r 83.44
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 83.4
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 83.2
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 83.11
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 83.06
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 82.91
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 82.83
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 82.79
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 82.73
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 82.73
d2hyda1255 Putative multidrug export ATP-binding/permease pro 82.7
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 82.47
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 82.36
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 82.14
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 81.91
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 81.75
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 81.74
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 81.37
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 81.3
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 81.26
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 81.1
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 80.69
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 80.38
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 80.17
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase-like domain of Cask
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.82  E-value=1.6e-20  Score=164.78  Aligned_cols=92  Identities=61%  Similarity=1.028  Sum_probs=82.0

Q ss_pred             CCcEEEEEcCCCCChhHHHHHHHhhCCCCccccccccccccceeEEEeecCCcchhhhhccCCCCCccccCChhHHHHHH
Q psy12793        187 KRKTLVLLGAHGVGRRHIKNTLINKFPDKYAYPVPQFITVCSVMFQIISKDDHNWWQARKDNVAGSAGLIPSPELQEWRT  266 (352)
Q Consensus       187 ~~r~iVL~GPsG~gk~tl~~~L~~~~p~~F~~~v~~~~~~~~~~~~vl~k~~~~w~~~~~~~~~~~~g~~p~~~~~~~r~  266 (352)
                      +++||||+|||||||+||.++|++++|+.|.+++++                                            
T Consensus         2 m~k~ivl~Gpsg~GK~tl~~~L~~~~~~~~~~~v~~--------------------------------------------   37 (178)
T d1kgda_           2 MRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPH--------------------------------------------   37 (178)
T ss_dssp             CCCEEEEECCTTSSHHHHHHHHHHHCTTTEECCCCE--------------------------------------------
T ss_pred             CCCcEEEECCCCCCHHHHHHHHHHhCCcCeeecccc--------------------------------------------
Confidence            678999999999999999999999999999999999                                            


Q ss_pred             HHhhhccccccccccccccCCccccccccCCCCCCCCcCCcceEEecHHHHHHHHHcCcEEEEEeecc-----ChhhHHH
Q psy12793        267 ACSTIDKTKHEQGIYSSFSLPFSVYRRDTTRSPRSDEENGRAYYFISHDEMMSDIAANQYLEYGKSIL-----THPSQRH  341 (352)
Q Consensus       267 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~r~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~  341 (352)
                                                  |||+||++|.||.+|||||.++|+.++++++||||++...     +..++..
T Consensus        38 ----------------------------TTR~~R~~E~~G~dY~Fvs~~~F~~~~~~g~fie~~~~~g~~YGt~~~~i~~   89 (178)
T d1kgda_          38 ----------------------------TTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRK   89 (178)
T ss_dssp             ----------------------------ECSCC---CCBTTTBEECCHHHHHHHHHTTCEEEEEEETTEEEEEEHHHHHH
T ss_pred             ----------------------------ccCCCCCccccCccceeeehhhhhhheecCceEEEeeecccceeeeeecccc
Confidence                                        9999999999999999999999999999999999987644     3468888


Q ss_pred             HHHcCcccc
Q psy12793        342 IVSCRKLVV  350 (352)
Q Consensus       342 ~~~~~~~~~  350 (352)
                      ++..|+++|
T Consensus        90 ~~~~g~~~i   98 (178)
T d1kgda_          90 IHEQGLIAI   98 (178)
T ss_dssp             HHHTTCEEE
T ss_pred             hhccCceEE
Confidence            999998775



>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ri9a_ b.34.2.1 (A:) Fyn-binding protein (T-cell adapter protein adap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure