Psyllid ID: psy12802

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------1470------1480------1490------1500------1510------1520------1530------1540------1550------1560------1570------1580------1590------1600------1610------1620------1630------164

LYAVKYTDVSSNVLQDDVFNLDIVRLRSEGNVAGIWAWRGQNGRKSYVVKGLAFSPDSTKLAVAQSDNIIFIYKLGDDWGDKKVICNKFIQQCPVTTMVWLADGPIIYGQSDGKIKAAHVKANKTQTLYASNSFVVALCLNVRGAGVLSGHADGSIVRYYVTEDASNFDQQQGRVVQHPVPPYALSWPAGYILAAGSDRIVTIYESDGRVHRIFDYTAPHYKEREFTVACSSPSGQAVVVGSYDNIKLFAWSPSKSVWEEQPNKTIPNLYTISALSWKRDGSRIACGGLCGSVELFESVLKRTIWKGKFEMIYVSPSQVLVKPLSGESKGRGVILKSQYGYEITDVAIMGNDRYLVARTPDTLLLGDLHRNLLSEVLWPDSGRNEKFYFDNVTVCLVFNAGELSIIEYGNNEILTCVSIKLFAWSPSKSVWEEQPNKTIPNLYTISALSWKRDGSRIACGGLCGSVELFESVLKRTIWKGKFEMIYVSPSQVLVKPLSGESKGRGVILKSQYGYEITDVAIMGNDRYLVARTLLTEFMNPHLISVRLNERKQVHSQQENKKLAYLLDLHTICVIDLITNLPTLHINHDSKIDWLELNETAHKLLYRDKKMRLTLLDIRTSEKHNILNYCTFVQWLPGSDVVVAQSRHNACVWYNIDTPDRITQFPVRGDIIDVIRENGQSEILTQDGNHQLGYELDESLIEFGTAVHDSDFGKAILYLESLGINKKEAEGMWQNLAEVAIQLHNLHVAEICYAALGDISTTHFLRETIKIGEVWSKENNIGDPLQCPELWARMAILNKQFKVAEGIYLENNEIHKAIDMYLKLYKWEDALSLAETNNYEYNELKKKYIKWLTDTRQEDKAGELYEKEGDHQTALNYYLKANFTSKACNLVQNEPYLLENHDVVSQIVKGLIKNESYIKAGQIYEFTNENEKALECYRKGKVYDKCIDLTRKINPKNVTALEEEWGDHLIENKQYNAAINHYIEAGKNNKALDTSIKAKQWKKAVQILQVITNKQDIAQHVKTLAQHFKTVKDYKTAEKIYSHCDMHEQIVDMYHQTGQWEKAYAIAEQHLNVGEIKATFIQKCKQLEEENKFKEAERLYLIIGEPDLAISMFKNQRQYENMIKLVRNYHPDLLDTTLLHLAQECEESKNYKQAEKYYLDCNEWKLAIKMYRSLNLWEDAYRIALSNGGQEAVEPVVYLWAKSLGGDSAVRLLNRLSLLESCISNACDTYQFDFAFELAKIGMKSKLEEVHYKYALVLEDNGQFNEAETQFIKANKPKEAISMYIHNQDWENAERIANEHDPTSIGDILLNQSKCEFENENFSKFETLLLRAHKVDLIIEKYKMNHMWNDALRVCGEYVPSKLPLLQQEYEKEINTNISKDIHSLITQARQWEQNGEFYNAVECYLKIKNVDVNLMVKILNEVTQLTLKYLNHDQSYKILPSLVPKLMEFKQYDLAVRVYLNIDMVKEAVDIFIYTQNWNKARKLCAELKPEYLSYVENQYKEWLKKNGDADMLSEIDINTALDMLMKQGQWNQCLDKAKNINTNLLHKYMALYAMHLIKNKEYAQLTQLFNEYGTPNIPQFYNIYKQTAYCILNDSNENVNLIISLRNMLFNVIKNQNNNEEIDKQYLQTNSLLHSK

cccccccccccccEEEEEEcccccEEEEEEcccEEEEEEccccccccEEEEEEEcccccEEEEEEcccEEEEEEccccccccEEEEccccccccEEEEEEcccccEEEEEccccEEEEEcccccEEEEEcccccEEEEEEEccccEEEEEEccccEEEEEEccccccccccccEEEccccccEEEEccccEEEEEEcccEEEEEEccccEEEEEEEcccccccccEEEEEEcccccEEEEEEcccEEEEEEccccccccccccccccccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEcccEEEEEEcccccEEEEcccccccEEEEEEcccccEEEEEEEccccEEEEEEcccEEEEEEEccccEEEEEEcccccEEEEEEcccEEEEEEEcccEEEEEccccEEEEEEEEEEEEEccccccccccccEEccccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEEEEEEEEcccEEEEEEcccccccEEEEEEccccccEEEEEEEcccEEEEEEEEccccccccEEEEEEccccEEEEEccccEEEEEEcccEEEEEEccccccEEEccccccEEEEEEcccccEEEEEccccEEEEEEcccccccEEcccccEEEEcccccEEEEEcccEEEEEEcccccccEEEccccccEEEEEEccccEEEEEcccccccEEcccHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHccccccccHHHHHHHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHcHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHccHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHcccHHHHHHHHHHHHcHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccc

cEEEEEEEcccHHHHHHHHcccEEEEEccccccccEEccccccccEEEEEEEEEcccccEEEEEEcccEEEEEEEcccccccEEEEccccccccEEEEEEcccccEEEEEcccEEEEEEEEcccccEEEccccEEEEEEEcccccEEEEEccccEEEEEEEcccccccccccccEEEcccccEEEEEccccEEEEEcccEEEEEcccccEEEEEccccccccccEEEEEEEcccccEEEEEEccEEEEEEEEccccccccccEEEccccEEEEEEEEcccccEEEEEEccccEEEHEHEHHEEEEcccEEEEEEcccEEEEEEccccccccEEEEEccccEEEEEEEEEccccEEEEEcccEEEEEccccccEEEEEEEccccEEEEEEccccccEEEEccEEEEEEccccEEEEEEEEEEEcccccEEEEccccccccccccEEEEEEEcccccEEEEEEccccHHHHHHHHEEEEEcccEEEEEEcccEEEEEEcccccccccEEEEEEEEEEcccEEEEEEccEEEEEEEEEEcccccEEEEEEEccccEEccccccEEEEEEcccEEEEEEEccccEEEEEEccccEEEEEEcccccEEEEEccccEEEEEEccccccEEEEEEEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEccccEEEEEEccccEEEEEcccccEEEEHHHHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHccHHHHccHHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcHHHHHHHHHHHHccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccHHHHHcccHHHHHHHHHHcccHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcc

lyavkytdvssnvlqddvfnlDIVRLRSEGNVAGIWAWrgqngrksYVVKglafspdstklaVAQSDNIIFIYKLGDDWGDKKVICNKfiqqcpvttmvwladgpiiygqsdgkiKAAHVKANKTQTLYASNSFVVALCLNVRgagvlsghadgSIVRYYvtedasnfdqqqgrvvqhpvppyalswpagyilAAGSDRIVTIYesdgrvhrifdytaphykereftvacsspsgqavvvgsydniklfawspsksvweeqpnktipnlytisalswkrdgsriacgglcgSVELFESVLKRTIWKGKFEMIyvspsqvlvkplsgeskgrgvilksqygyeitdvaimgndrylvartpdtllLGDLHRNLLsevlwpdsgrnekfyfdNVTVCLVFNAGELSIIEYGNNEILTCVSIKlfawspsksvweeqpnktipnlytisalswkrdgsriacgglcgSVELFESVLKRTIWKGKFEMIyvspsqvlvkplsgeskgrgvilksqygyeitdvaimgNDRYLVARTLLTEfmnphlisvRLNERKQVHSQQENKKLAYLLDLHTICVIDLitnlptlhinhdskiDWLELNETAHKLLYRDKKMRLTLLDIRTSEKHNILNYCTfvqwlpgsdVVVAQSRHNACvwynidtpdritqfpvrgDIIDVIREngqseiltqdgnhqlgyeLDESLIEFGTAVHDSDFGKAILYLESLGINKKEAEGMWQNLAEVAIQLHNLHVAEICYAALGDISTTHFLRETIKIgevwskennigdplqcpELWARMAILNKQFKVAEGIYLENNEIHKAIDMYLKLYKWEDALSLAETNNYEYNELKKKYIKWLTDTRQEDKAGELYEKEGDHQTALNYYLKANFTSKacnlvqnepyllenhDVVSQIVKGLIknesyikagqiyeftNENEKALECYRKGKVYDKCIDLtrkinpknvTALEEEWGDHLIENKQYNAAINHYIEAGKNNKALDTSIKAKQWKKAVQILQVITNKQDIAQHVKTLAQHFKTVKDYKTAEKIYSHCDMHEQIVDMYHQTGQWEKAYAIAEQHLNVGEIKATFIQKCKQLEEENKFKEAERLYLIIGEPDLAISMFKNQRQYENMIKLVRNYHPDLLDTTLLHLAQECEESKNYKQAEKYYLDCNEWKLAIKMYRSLNLWEDAYRIALsnggqeavEPVVYLWAKSLGGDSAVRLLNRLSLLESCIsnacdtyqFDFAFELAKIGMKSKLEEVHYKYALVLEDNGQFNEAETQFIKANKPKEAISMYIHNQDwenaerianehdptsigdillnqskcefenenfSKFETLLLRAHKVDLIIEKYKMNHMWNDALRVCgeyvpsklpllQQEYEKEINTNISKDIHSLITQARQWEQNGEFYNAVECYLKIKNVDVNLMVKILNEVTQLTLKYLnhdqsykilPSLVPKLMEFKQYDLAVRVYLNIDMVKEAVDIFIYTQNWNKARKLCAELKPEYLSYVENQYKEWLkkngdadmlseIDINTALDMLMKQGQWNQCLDKAKNINTNLLHKYMALYAMHLIKNKEYAQLTQLFneygtpnipqfyNIYKQTAYCILNDSNENVNLIISLRNMLFNVIKNQNNNEEIDKQYLQtnsllhsk

lyavkytdvssnvlqddvfnLDIVRLRSEGNVagiwawrgqngRKSYVVKGLAFSPDSTKLAVAQSDNIIFIYKLGDDWGDKKVICNKFIQQCPVTTMVWLADGPIIYGQSDGKIKAAHVKANKTQTLYASNSFVVALCLNVRGAGVLSGHADGSIVRYYVTEDASNFDQQQGRVVQHPVPPYALSWPAGYILAAGSDRIVTIYESDGRVHRIFDYTAPHYKEREFTVACSSPSGQAVVVGSYDNIKLFAWSPSKsvweeqpnktipnLYTISALSWKRDGSRIACGGLCGSVELFESVLKRTIWKGKFEMIyvspsqvlvkplsgeskgrgvilkSQYGYEITDVAIMGNDRYLVARTPDTLLLGDLHRNLLSEVLWPDSGRNEKFYFDNVTVCLVFNAGELSIIEYGNNEILTCVSIKLFAWSPSKSvweeqpnktipnLYTISALSWKRDGSRIACGGLCGSVELFESVLKRTIWKGKFEMIyvspsqvlvkplsgeskgrgviLKSQYGYEITDVAIMGNDRYLVARTLLTEFMNPHLISVRLNERKQVHSQQENKKLAYLLDLHTICVIDLITNLPTLHINHDSKIDWLELNETAHKLLYRDKKMRLTLLDIRTSEKHNILNYCTFVQWLPGSDVVVAQSRHNACVWynidtpdritqfpVRGDIIDVIRENGQSEILTQDGNHQLGYELDESLIEFGTAVHDSDFGKAILYLESLGINKKEAEGMWQNLAEVAIQLHNLHVAEICYAALGDISTTHFLRETIKIgevwskennigDPLQCPELWARMAILNKQFKVAEGIYLENNEIHKAIDMYLKLYKWEDALSLAETNNYEYNELKKKYIKWLTDTRQEDKAGELYEKEGDHQTALNYYLKANFTSKACNLVQNEPYLLENHDVVSQIVKGLIKNESYIKAGQIYEFTNENEKALECYRKGKVYDKCIDLTRKINPKNVTALEEEWGDHLIENKQYNAAINHYIEAGKNNKALDTSIKAKQWKKAVQILQVITNKQDIAQHVKTLAQHFKTVKDYKTAEKIYSHCDMHEQIVDMYHQTGQWEKAYAIAEQHLNVGEIKATFIQKCKQLEEENKFKEAERLYLIIGEPDLAISMFKNQRQYENMIKLVRNYHPDLLDTTLLHLAQECEESKNYKQAEKYYLDCNEWKLAIKMYRSLNLWEDAYRIALSNGGQEAVEPVVYLWAKSLGGDSAVRLLNRLSLLESCISNACDTYQFDFAFELAKIGMKSKLEEVHYKYALVLEDNGQFNEAETQFIKANKPKEAISMYIHNQDWENAERIANEHDPTSIGDILLNQSKCEFENENFSKFETLLLRAHKVDLIIEKYKMNHMWNDALRVCGEYVPSKLPLLQQEYEKEINTNISKDIHSLITQARQWEQNGEFYNAVECYLKIKNVDVNLMVKILNEVTQLTLKYLNHDQSYKILPSLVPKLMEFKQYDLAVRVYLNIDMVKEAVDIFIYTQNWNKARKLCAELKPEYLSYVENQYKEWLKKNGDADMLSEIDINTALDMLMKQGQWNQCLDKAKNINTNLLHKYMALYAMHLIKNKEYAQLTQLFNEYGTPNIPQFYNIYKQTAYCILNDSNENVNLIISLRNMLFNVIKNQnnneeidkqylqtnsllhsk

LYAVKYTDVSSNVLQDDVFNLDIVRLRSEGNVAGIWAWRGQNGRKSYVVKGLAFSPDSTKLAVAQSDNIIFIYKLGDDWGDKKVICNKFIQQCPVTTMVWLADGPIIYGQSDGKIKAAHVKANKTQTLYASNSFVVALCLNVRGAGVLSGHADGSIVRYYVTEDASNFDQQQGRVVQHPVPPYALSWPAGYILAAGSDRIVTIYESDGRVHRIFDYTAPHYKEREFTVACSSPSGQAVVVGSYDNIKLFAWSPSKSVWEEQPNKTIPNLYTISALSWKRDGSRIACGGLCGSVELFESVLKRTIWKGKFEMIYVSPSQVLVKPLSGESKGRGVILKSQYGYEITDVAIMGNDRYLVARTPDTLLLGDLHRNLLSEVLWPDSGRNEKFYFDNVTVCLVFNAGELSIIEYGNNEILTCVSIKLFAWSPSKSVWEEQPNKTIPNLYTISALSWKRDGSRIACGGLCGSVELFESVLKRTIWKGKFEMIYVSPSQVLVKPLSGESKGRGVILKSQYGYEITDVAIMGNDRYLVARTLLTEFMNPHLISVRLNERKQVHSQQENKKLAYLLDLHTICVIDLITNLPTLHINHDSKIDWLELNETAHKLLYRDKKMRLTLLDIRTSEKHNILNYCTFVQWLPGSDVVVAQSRHNACVWYNIDTPDRITQFPVRGDIIDVIRENGQSEILTQDGNHQLGYELDESLIEFGTAVHDSDFGKAILYLESLGINKKEAEGMWQNLAEVAIQLHNLHVAEICYAALGDISTTHFLRETIKIGEVWSKENNIGDPLQCPELWARMAILNKQFKVAEGIYLENNEIHKAIDMYLKLYKWEDALSLAETNNYEYNELKKKYIKWLTDTRQEDKAGELYEKEGDHQTALNYYLKANFTSKACNLVQNEPYLLENHDVVSQIVKGLIKNESYIKAGQIYEFTNENEKALECYRKGKVYDKCIDLTRKINPKNVTALEEEWGDHLIENKQYNAAINHYIEAGKNNKALDTSIKAKQWKKAVQILQVITNKQDIAQHVKTLAQHFKTVKDYKTAEKIYSHCDMHEQIVDMYHQTGQWEKAYAIAEQHLNVGEIKATFIQKCKQLEEENKFKEAERLYLIIGEPDLAISMFKNQRQYENMIKLVRNYhpdlldttllhlAQECEESKNYKQAEKYYLDCNEWKLAIKMYRSLNLWEDAYRIALSNGGQEAVEPVVYLWAKSLGGDSAVRLLNRLSLLESCISNACDTYQFDFAFELAKIGMKSKLEEVHYKYALVLEDNGQFNEAETQFIKANKPKEAISMYIHNQDWENAERIANEHDPTSIGDILLNQSKCEFENENFSKFETLLLRAHKVDLIIEKYKMNHMWNDALRVCGEYVPSKLPLLQQEYEKEINTNISKDIHSLITQARQWEQNGEFYNAVECYLKIKNVDVNLMVKILNEVTQLTLKYLNHDQSYKILPSLVPKLMEFKQYDLAVRVYLNIDMVKEAVDIFIYTQNWNKARKLCAELKPEYLSYVENQYKEWLKKNGDADMLSEIDINTALDMLMKQGQWNQCLDKAKNINTNLLHKYMALYAMHLIKNKEYAQLTQLFNEYGTPNIPQFYNIYKQTAYCILNDSNENVNLIISLRNMLFNVIKNQNNNEEIDKQYLQTNSLLHSK

***VKYTDVSSNVLQDDVFNLDIVRLRSEGNVAGIWAWRGQNGRKSYVVKGLAFSPDSTKLAVAQSDNIIFIYKLGDDWGDKKVICNKFIQQCPVTTMVWLADGPIIYGQSDGKIKAAHVKANKTQTLYASNSFVVALCLNVRGAGVLSGHADGSIVRYYVTEDASNFDQQQGRVVQHPVPPYALSWPAGYILAAGSDRIVTIYESDGRVHRIFDYTAPHYKEREFTVACSSPSGQAVVVGSYDNIKLFAWSPSKSVWEEQPNKTIPNLYTISALSWKRDGSRIACGGLCGSVELFESVLKRTIWKGKFEMIYVSPSQVLVKPLSGESKGRGVILKSQYGYEITDVAIMGNDRYLVARTPDTLLLGDLHRNLLSEVLWPDSGRNEKFYFDNVTVCLVFNAGELSIIEYGNNEILTCVSIKLFAWSPSKSVWEEQPNKTIPNLYTISALSWKRDGSRIACGGLCGSVELFESVLKRTIWKGKFEMIYVSPSQVLVKPLSGESKGRGVILKSQYGYEITDVAIMGNDRYLVARTLLTEFMNPHLISVRLNER********NKKLAYLLDLHTICVIDLITNLPTLHINHDSKIDWLELNETAHKLLYRDKKMRLTLLDIRTSEKHNILNYCTFVQWLPGSDVVVAQSRHNACVWYNIDTPDRITQFPVRGDIIDVIRENGQSEILTQDGNHQLGYELDESLIEFGTAVHDSDFGKAILYLESLGINKKEAEGMWQNLAEVAIQLHNLHVAEICYAALGDISTTHFLRETIKIGEVWSKENNIGDPLQCPELWARMAILNKQFKVAEGIYLENNEIHKAIDMYLKLYKWEDALSLAETNNYEYNELKKKYIKWLTDTR******ELYEKEGDHQTALNYYLKANFTSKACNLVQNEPYLLENHDVVSQIVKGLIKNESYIKAGQIYEFTNENEKALECYRKGKVYDKCIDLTRKINPKNVTALEEEWGDHLIENKQYNAAINHYIEAGKNNKALDTSIKAKQWKKAVQILQVITNKQDIAQHVKTLAQHFKTVKDYKTAEKIYSHCDMHEQIVDMYHQTGQWEKAYAIAEQHLNVGEIKATFIQKCKQLEEENKFKEAERLYLIIGEPDLAISMFKNQRQYENMIKLVRNYHPDLLDTTLLHLAQECEESKNYKQAEKYYLDCNEWKLAIKMYRSLNLWEDAYRIALSNGGQEAVEPVVYLWAKSLGGDSAVRLLNRLSLLESCISNACDTYQFDFAFELAKIGMKSKLEEVHYKYALVLEDNGQFNEAETQFIKANKPKEAISMYIHNQDWENAERIANEHDPTSIGDILLNQSKCEFENENFSKFETLLLRAHKVDLIIEKYKMNHMWNDALRVCGEYVPSKLPLLQQEYEKEINTNISKDIHSLITQARQWEQNGEFYNAVECYLKIKNVDVNLMVKILNEVTQLTLKYLNHDQSYKILPSLVPKLMEFKQYDLAVRVYLNIDMVKEAVDIFIYTQNWNKARKLCAELKPEYLSYVENQYKEWLKKNGDADMLSEIDINTALDMLMKQGQWNQCLDKAKNINTNLLHKYMALYAMHLIKNKEYAQLTQLFNEYGTPNIPQFYNIYKQTAYCILNDSNENVNLIISLRNMLFNVIKN*********************

LYAVKYTDVSSNVLQDDVFNLDIVRLRSEGNVAGIWAWRGQNGRKSYVVKGLAFSPDSTKLAVAQSDNIIFIYKLGDDWGDKKVICNKFIQQCPVTTMVWLADGPIIYGQSDGKIKAAHVKANKTQTLYASNSFVVALCLNVRGAGVLSGHADGSIVRYYVTEDASNFDQQQGRVVQHPVPPYALSWPAGYILAAGSDRIVTIYESDGRVHRIFDYTAPHYKEREFTVACSSPSGQAVVVGSYDNIKLFAWSPSKSVWEEQPNKTIPNLYTISALSWKRDGSRIACGGLCGSVELFESVLKRTIWKGKFEMIYVSPSQVLVKPLSGESKGRGVILKSQYGYEITDVAIMGNDRYLVARTPDTLLLGDLHRNLLSEVLWPDSGRNEKFYFDNVTVCLVFNAGELSIIEYGNNEILTCVSIKLFAWSPSKSVWEEQPNKTIPNLYTISALSWKRDGSRIACGGLCGSVELFESVLKRTIWKGKFEMIYVSPSQVLVKPLSGESKGRGVILKSQYGYEITDVAIMGNDRYLVARTLLTEFMNPHLISVRLNERKQVHSQQENKKLAYLLDLHTICVIDLITNLPTLHINHDSKIDWLELNETAHKLLYRDKKMRLTLLDIRTSEKHNILNYCTFVQWLPGSDVVVAQSRHNACVWYNIDTPDRITQFPVRGDIIDVIRENGQSEILTQDGNHQLGYELDESLIEFGTAVHDSDFGKAILYLESLGINKKEAEGMWQNLAEVAIQLHNLHVAEICYAALGDISTTHFLRETI***************LQCPELWARMAILNKQFKVAEGIYLENNEIHKAIDMYLKLYKWEDALSLAETNNYEYNELKKKYIKWLTDTRQEDKAGELYEKEGDHQTALNYYLKANFTSKACNLVQNEPYLLENHDVVSQIVKGLIKNESYIKAGQIYEFTNENEKALECYRKGKVYDKCIDLTRKINPKNVTALEEEWGDHLIENKQYNAAINHYIEAGKNNKALDTSIKAKQWKKAVQILQVITNKQDIAQHVKTLAQHFKTVKDYKTAEKIYSHCDMHEQIVDMYHQTGQWEKAYAIAEQHLNVGEIKATFIQKCKQLEEENKFKEAERLYLIIGEPDLAISMFKNQRQYENMIKLVRNYHPDLLDTTLLHLAQECEESKNYKQAEKYYLDCNEWKLAIKMYRSLNLWEDAYRIALSNGGQEAVEPVVYLWAKSLGGDSAVRLLNRLSLLESCISNACDTYQFDFAFELAKIGMKSKLEEVHYKYALVLEDNGQFNEAETQFIKANKPKEAISMYIHNQDWENAERIANEHDPTSIGDILLNQSKCEFENENFSKFETLLLRAHKVDLIIEKYKMNHMWNDALRVCGEYVPSKLPL**********************QARQWEQNGEFYNAVECYLKIKNVDVNLMVKILNEVTQLTLKYLNHDQSYKILPSLVPKLMEFKQYDLAVRVYLNIDMVKEAVDIFIYTQNWNKARKLCAELKPEYLSYVENQYKE**********LSEIDINTALDMLMKQGQWNQCLDKAKNINTNLLHKYMALYAMHLIKNKEYAQLTQLFNEYGTPNIPQFYNIYKQTAYCILNDSNENVNLIISLRNMLF******************TNSLLHS*

********VSSNVLQDDVFNLDIVRLRSEGNVAGIWAWRGQNGRKSYVVKGLAFSPDSTKLAVAQSDNIIFIYKLGDDWGDKKVICNKFIQQCPVTTMVWLADGPIIYGQSDGKIKAAHVKANKTQTLYASNSFVVALCLNVRGAGVLSGHADGSIVRYYVTEDASNFDQQQGRVVQHPVPPYALSWPAGYILAAGSDRIVTIYESDGRVHRIFDYTAPHYKEREFTVACSSPSGQAVVVGSYDNIKLFAWSPSKSVWEEQPNKTIPNLYTISALSWKRDGSRIACGGLCGSVELFESVLKRTIWKGKFEMIYVSPSQVLVKPLSGESKGRGVILKSQYGYEITDVAIMGNDRYLVARTPDTLLLGDLHRNLLSEVLWPDSGRNEKFYFDNVTVCLVFNAGELSIIEYGNNEILTCVSIKLFAWSPSKSVWEEQPNKTIPNLYTISALSWKRDGSRIACGGLCGSVELFESVLKRTIWKGKFEMIYVSPSQVLVKPLSGESKGRGVILKSQYGYEITDVAIMGNDRYLVARTLLTEFMNPHLISVRLNER********NKKLAYLLDLHTICVIDLITNLPTLHINHDSKIDWLELNETAHKLLYRDKKMRLTLLDIRTSEKHNILNYCTFVQWLPGSDVVVAQSRHNACVWYNIDTPDRITQFPVRGDIIDVIRENGQSEILTQDGNHQLGYELDESLIEFGTAVHDSDFGKAILYLESLGINKKEAEGMWQNLAEVAIQLHNLHVAEICYAALGDISTTHFLRETIKIGEVWSKENNIGDPLQCPELWARMAILNKQFKVAEGIYLENNEIHKAIDMYLKLYKWEDALSLAETNNYEYNELKKKYIKWLTDTRQEDKAGELYEKEGDHQTALNYYLKANFTSKACNLVQNEPYLLENHDVVSQIVKGLIKNESYIKAGQIYEFTNENEKALECYRKGKVYDKCIDLTRKINPKNVTALEEEWGDHLIENKQYNAAINHYIEAGKNNKALDTSIKAKQWKKAVQILQVITNKQDIAQHVKTLAQHFKTVKDYKTAEKIYSHCDMHEQIVDMYHQTGQWEKAYAIAEQHLNVGEIKATFIQKCKQLEEENKFKEAERLYLIIGEPDLAISMFKNQRQYENMIKLVRNYHPDLLDTTLLHLAQECEESKNYKQAEKYYLDCNEWKLAIKMYRSLNLWEDAYRIALSNGGQEAVEPVVYLWAKSLGGDSAVRLLNRLSLLESCISNACDTYQFDFAFELAKIGMKSKLEEVHYKYALVLEDNGQFNEAETQFIKANKPKEAISMYIHNQDWENAERIANEHDPTSIGDILLNQSKCEFENENFSKFETLLLRAHKVDLIIEKYKMNHMWNDALRVCGEYVPSKLPLLQQEYEKEINTNISKDIHSLITQARQWEQNGEFYNAVECYLKIKNVDVNLMVKILNEVTQLTLKYLNHDQSYKILPSLVPKLMEFKQYDLAVRVYLNIDMVKEAVDIFIYTQNWNKARKLCAELKPEYLSYVENQYKEWLKKNGDADMLSEIDINTALDMLMKQGQWNQCLDKAKNINTNLLHKYMALYAMHLIKNKEYAQLTQLFNEYGTPNIPQFYNIYKQTAYCILNDSNENVNLIISLRNMLFNVIKNQNNNEEIDKQYLQTNSLLHSK

LYAVKYTDVSSNVLQDDVFNLDIVRLRSEGNVAGIWAWRGQNGRKSYVVKGLAFSPDSTKLAVAQSDNIIFIYKLGDDWGDKKVICNKFIQQCPVTTMVWLADGPIIYGQSDGKIKAAHVKANKTQTLYASNSFVVALCLNVRGAGVLSGHADGSIVRYYVTEDASNF**QQGRVVQHPVPPYALSWPAGYILAAGSDRIVTIYESDGRVHRIFDYTAPHYKEREFTVACSSPSGQAVVVGSYDNIKLFAWSPSKSVWEEQPNKTIPNLYTISALSWKRDGSRIACGGLCGSVELFESVLKRTIWKGKFEMIYVSPSQVLVKPLSGESKGRGVILKSQYGYEITDVAIMGNDRYLVARTPDTLLLGDLHRNLLSEVLWPDSGRNEKFYFDNVTVCLVFNAGELSIIEYGNNEILTCVSIKLFAWSPSKSVWEEQPNKTIPNLYTISALSWKRDGSRIACGGLCGSVELFESVLKRTIWKGKFEMIYVSPSQVLVKPLSGESKGRGVILKSQYGYEITDVAIMGNDRYLVARTLLTEFMNPHLISVRLNERKQVHSQQENKKLAYLLDLHTICVIDLITNLPTLHINHDSKIDWLELNETAHKLLYRDKKMRLTLLDIRTSEKHNILNYCTFVQWLPGSDVVVAQSRHNACVWYNIDTPDRITQFPVRGDIIDVIRENGQSEILTQDGNHQLGYELDESLIEFGTAVHDSDFGKAILYLESLGINKKEAEGMWQNLAEVAIQLHNLHVAEICYAALGDISTTHFLRETIKIGEVWSKENNIGDPLQCPELWARMAILNKQFKVAEGIYLENNEIHKAIDMYLKLYKWEDALSLAETNNYEYNELKKKYIKWLTDTRQEDKAGELYEKEGDHQTALNYYLKANFTSKACNLVQNEPYLLENHDVVSQIVKGLIKNESYIKAGQIYEFTNENEKALECYRKGKVYDKCIDLTRKINPKNVTALEEEWGDHLIENKQYNAAINHYIEAGKNNKALDTSIKAKQWKKAVQILQVITNKQDIAQHVKTLAQHFKTVKDYKTAEKIYSHCDMHEQIVDMYHQTGQWEKAYAIAEQHLNVGEIKATFIQKCKQLEEENKFKEAERLYLIIGEPDLAISMFKNQRQYENMIKLVRNYHPDLLDTTLLHLAQECEESKNYKQAEKYYLDCNEWKLAIKMYRSLNLWEDAYRIALSNGGQEAVEPVVYLWAKSLGGDSAVRLLNRLSLLESCISNACDTYQFDFAFELAKIGMKSKLEEVHYKYALVLEDNGQFNEAETQFIKANKPKEAISMYIHNQDWENAERIANEHDPTSIGDILLNQSKCEFENENFSKFETLLLRAHKVDLIIEKYKMNHMWNDALRVCGEYVPSKLPLLQQEYEKEINTNISKDIHSLITQARQWEQNGEFYNAVECYLKIKNVDVNLMVKILNEVTQLTLKYLNHDQSYKILPSLVPKLMEFKQYDLAVRVYLNIDMVKEAVDIFIYTQNWNKARKLCAELKPEYLSYVENQYKEWLKKNGDADMLSEIDINTALDMLMKQGQWNQCLDKAKNINTNLLHKYMALYAMHLIKNKEYAQLTQLFNEYGTPNIPQFYNIYKQTAYCILNDSNENVNLIISLRNMLFNVIKNQNNNEEIDKQYLQTNSLLHSK

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

LYAVKYTDVSSNVLQDDVFNLDIVRLRSEGNVAGIWAWRGQNGRKSYVVKGLAFSPDSTKLAVAQSDNIIFIYKLGDDWGDKKVICNKFIQQCPVTTMVWLADGPIIYGQSDGKIKAAHVKANKTQTLYASNSFVVALCLNVRGAGVLSGHADGSIVRYYVTEDASNFDQQQGRVVQHPVPPYALSWPAGYILAAGSDRIVTIYESDGRVHRIFDYTAPHYKEREFTVACSSPSGQAVVVGSYDNIKLFAWSPSKSVWEEQPNKTIPNLYTISALSWKRDGSRIACGGLCGSVELFESVLKRTIWKGKFEMIYVSPSQVLVKPLSGESKGRGVILKSQYGYEITDVAIMGNDRYLVARTPDTLLLGDLHRNLLSEVLWPDSGRNEKFYFDNVTVCLVFNAGELSIIEYGNNEILTCVSIKLFAWSPSKSVWEEQPNKTIPNLYTISALSWKRDGSRIACGGLCGSVELFESVLKRTIWKGKFEMIYVSPSQVLVKPLSGESKGRGVILKSQYGYEITDVAIMGNDRYLVARTLLTEFMNPHLISVRLNERKQVHSQQENKKLAYLLDLHTICVIDLITNLPTLHINHDSKIDWLELNETAHKLLYRDKKMRLTLLDIRTSEKHNILNYCTFVQWLPGSDVVVAQSRHNACVWYNIDTPDRITQFPVRGDIIDVIRENGQSEILTQDGNHQLGYELDESLIEFGTAVHDSDFGKAILYLESLGINKKEAEGMWQNLAEVAIQLHNLHVAEICYAALGDISTTHFLRETIKIGEVWSKENNIGDPLQCPELWARMAILNKQFKVAEGIYLENNEIHKAIDMYLKLYKWEDALSLAETNNYEYNELKKKYIKWLTDTRQEDKAGELYEKEGDHQTALNYYLKANFTSKACNLVQNEPYLLENHDVVSQIVKGLIKNESYIKAGQIYEFTNENEKALECYRKGKVYDKCIDLTRKINPKNVTALEEEWGDHLIENKQYNAAINHYIEAGKNNKALDTSIKAKQWKKAVQILQVITNKQDIAQHVKTLAQHFKTVKDYKTAEKIYSHCDMHEQIVDMYHQTGQWEKAYAIAEQHLNVGEIxxxxxxxxxxxxxxxxxxxxxRLYLIIGEPDLAISMFKNQRQYENMIKLVRNYHPDLLDTTLLHLAQECEESKNYKQAEKYYLDCNEWKLAIKMYRSLNLWEDAYRIALSNGGQEAVEPVVYLWAKSLGGDSAVRLLNRLSLLESCISNACDTYQFDFAFELAKIGMKSKLEEVHYKYALVLEDNGQFNEAETQFIKANKPKEAISMYIHNQDWENAERIANEHDPTSIGDILLNQSKCEFENENFSKFETLLLRAHKVDLIIEKYKMNHMWNDALRVCGEYVPSKLPLLQQEYEKEINTNISKDIHSLITQARQWEQNGEFYNAVECYLKIKNVDVNLMVKILNEVTQLTLKYLNHDQSYKILPSLVPKLMEFKQYDLAVRVYLNIDMVKEAVDIFIYTQNWNKARKLCAELKPEYLSYVENQYKEWLKKNGDADMLSEIDINTALDMLMKQGQWNQCLDKAKNINTNLLHKYMALYAMHLIKNKEYAQLTQLFNEYGTPNIPQFYNIYKQTAYCILNDSNENVNLIISLRNMLFNVIKNQNNNEEIDKQYLQTNSLLHSK

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		1637	2.2.26 [Sep-21-2011]
Q5RHH4		1745	Intraflagellar transport	yes	N/A	0.728	0.683	0.443	0.0
Q6VH22		1749	Intraflagellar transport	yes	N/A	0.727	0.680	0.434	0.0
Q9UG01		1749	Intraflagellar transport	yes	N/A	0.727	0.680	0.429	0.0
Q9JKU3		1749	Intraflagellar transport	yes	N/A	0.727	0.680	0.430	0.0
Q9W040		1772	Intraflagellar transport	yes	N/A	0.864	0.799	0.372	0.0
Q5DM57		1755	Intraflagellar transport	N/A	N/A	0.859	0.801	0.329	0.0
Q22830		1737	Intraflagellar transport	yes	N/A	0.852	0.803	0.323	0.0
A8WGF4		1189	Intraflagellar transport	no	N/A	0.116	0.159	0.237	3e-07
Q6NWV3		1182	Intraflagellar transport	no	N/A	0.114	0.159	0.242	5e-06
Q6NYH1		1187	Intraflagellar transport	no	N/A	0.117	0.162	0.199	7e-06

>sp\|Q5RHH4\|IF172_DANRE Intraflagellar transport protein 172 homolog OS=Danio rerio GN=ift172 PE=2 SV=1	Back alignment and function desciption

 Score = 1140 bits (2950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/1267 (44%), Positives = 843/1267 (66%), Gaps = 74/1267 (5%)

Query: 419  IKLFAWSPSKSVWEEQPNKTIPNLYTISALSWKRDGSRIACGGLCGSVELFESVLKRTIW 478
            +++F WSP K  W+E   K IPNLYTI+ALSWK+DGSR++ G LCG VE+F+  L+R+I+
Sbjct: 263  LRVFNWSPRKGTWDESSPKEIPNLYTITALSWKKDGSRLSVGTLCGGVEMFDCCLRRSIY 322

Query: 479  KGKFEMIYVSPSQVLVKPLSGESKGRGVILKSQYGYEITDVAIM---------------- 522
            K KFEM YV  SQV+V+ LS    G  V+LKSQYGYEI +V +M                
Sbjct: 323  KNKFEMTYVGLSQVIVRNLS---TGTRVVLKSQYGYEIDEVKVMGKDQYLVAHTSDTLLL 379

Query: 523  -----------------GNDRYL------------------------VARTLLTEFMNPH 541
                             GN+++                         +  ++ TEFMNPH
Sbjct: 380  GDLVSNKLSEVAWQGSGGNEKFFFENETVCMIFNAGELALVEYGSNDILGSVRTEFMNPH 439

Query: 542  LISVRLNERKQVHSQQENKKLAYLLDLHTICVIDLITNLPTLHINHDSKIDWLELNETAH 601
            LISVRLNER+Q    ++NKKLAYL+D+ TI ++DL+       I+HDSKIDWLELNET  
Sbjct: 440  LISVRLNERRQ-RGVEDNKKLAYLIDIKTIAIVDLVGGYNLGTISHDSKIDWLELNETGR 498

Query: 602  KLLYRDKKMRLTLLDIRTSEKHNILNYCTFVQWLPGSDVVVAQSRHNACVWYNIDTPDRI 661
            KLL+RDKK+RL L DI +S K  +L++C +VQW+PGSDVVVAQ+R N CVWY ID+P+R+
Sbjct: 499  KLLFRDKKLRLHLYDIESSVKSTMLSFCPYVQWVPGSDVVVAQNRGNLCVWYTIDSPERV 558

Query: 662  TQFPVRGDIIDVIRENGQSEILTQDGNHQLGYELDESLIEFGTAVHDSDFGKAILYLESL 721
            T FP++GDI+D+ R NG++E++  +G + + Y LDE LIEFGTA+ D D+ +A  +LE+L
Sbjct: 559  TMFPLKGDIVDLERSNGKTEVIVNEGVNSISYTLDEGLIEFGTAIDDGDYYRATAFLETL 618

Query: 722  GINKKEAEGMWQNLAEVAIQLHNLHVAEICYAALGDISTTHFLRETIKIGEVWSKENNIG 781
             ++  E E MW+ L++++++   LH+AE C+AALGD+S   FL ET KI +  +KE + G
Sbjct: 619  EMSA-ETEAMWKTLSKLSLEAQQLHIAERCFAALGDVSKARFLNETNKIADAVAKEYD-G 676

Query: 782  DPLQCPELWARMAILNKQFKVAEGIYLENNEIHKAIDMYLKLYKWEDALSLAETNNY-EY 840
            D     ++ AR+A+L+K FK+AE  Y+E N + + ++MY +L+ W++ +++AE   + E 
Sbjct: 677  DGTDHYQVKARLAMLDKNFKLAEMYYMEQNAVDEVMEMYQELHMWDECIAVAEGKGHPEL 736

Query: 841  NELKKKYIKWLTDTRQEDKAGELYEKEGDHQTALNYYLKANFTSKACNLVQNEPYLLENH 900
            + L++ Y  +L +T Q +KA E+ E EGD   A+N YLKA   +KA  L  ++  LL + 
Sbjct: 737  DNLRRSYYSYLMETNQNEKAAEVKENEGDFTGAVNLYLKAGLPAKAAWLAMSKDELLSSQ 796

Query: 901  DVVSQIVKGLIKNESYIKAGQIYEFTNENEKALECYRKGKVYDKCIDLTRKINPKNVTAL 960
            D+VS+I   LIK E Y +AG ++E T  N++ALECYRKG  + K +DL R   P  V  L
Sbjct: 797  DIVSRITAALIKGEFYERAGDLFERTRNNQRALECYRKGNAFKKAVDLARVAFPAEVVKL 856

Query: 961  EEEWGDHLIENKQYNAAINHYIEAGKNNKALDTSIKAKQWKKAVQILQVITNKQDIAQHV 1020
            EE WGD+L++ KQ +AAINHYIEAG++ KA++ +I A+QWKKA+ IL++  ++     ++
Sbjct: 857  EEVWGDYLVQQKQMDAAINHYIEAGRSIKAIEAAIAARQWKKALHILELQEDRTAAKYYL 916

Query: 1021 KTLAQHFKTVKDYKTAEKIYSHCDMHEQIVDMYHQTGQWEKAYAIAEQHLNVGEIKATFI 1080
            K +AQ++ +V++++ AE+++   D  +  +DMY Q G+WE+A+ +A + +   ++   ++
Sbjct: 917  K-IAQYYASVQEFEVAERLFVKGDHIKDAIDMYTQAGRWEQAHKLAVKCMTQEDVSVLYV 975

Query: 1081 QKCKQLEEENKFKEAERLYLIIGEPDLAISMFKNQRQYENMIKLVRNYHPDLLDTTLLHL 1140
             + ++LE+E K+KEAERL+  + EPDLAI+M+K  + Y++MI+LV  +H DLL  T +HL
Sbjct: 976  SRAQELEKEGKYKEAERLFTTVDEPDLAITMYKKNKMYDDMIRLVAVHHKDLLQETHIHL 1035

Query: 1141 AQECEESKNYKQAEKYYLDCNEWKLAIKMYRSLNLWEDAYRIALSNGGQEAVEPVVYLWA 1200
            A+E E    +++AE +YL+  +WK A+ MYR  ++WE+AYRIA ++GG  A + V YLWA
Sbjct: 1036 AKELEAESRFQEAEYHYLEGQDWKAAVNMYRVNDMWEEAYRIAKTHGGANAHKQVAYLWA 1095

Query: 1201 KSLGGDSAVRLLNRLSLLESCISNACDTYQFDFAFELAKIGMKSKLEEVHYKYALVLEDN 1260
            KSLGG++AV+LLN+  LLE+ I  A D Y FDFAFELA++ MK K+ ++H K A+ LED 
Sbjct: 1096 KSLGGEAAVKLLNKFGLLETAIDFAADNYTFDFAFELARLSMKQKIPDIHLKNAMFLEDQ 1155

Query: 1261 GQFNEAETQFIKANKPKEAISMYIHNQDWENAERIANEHDPTSIGDILLNQSKCEFENEN 1320
            G+FNEAE +FIKA KPKEA+ M++HN+DW NA+R+A  HDP S+ DIL++Q+K  F+ + 
Sbjct: 1156 GKFNEAEIEFIKAGKPKEAVLMHVHNKDWSNAQRVAEAHDPESVADILVSQAKFCFDQKE 1215

Query: 1321 FSKFETLLLRAHKVDLIIEKYKMNHMWNDALRVCGEYVPSKLPLLQQEYEKEINTNISKD 1380
            F K E  LLRA + +L I+ YK   MW DA+R+C +Y+PSKL +LQ+EYE E N      
Sbjct: 1216 FQKAEAFLLRAQRPELAIKYYKDAGMWTDAMRICKDYLPSKLSVLQKEYESEGNWG---- 1271

Query: 1381 IHSLITQARQWEQNGEFYNAVECYLKIKN-VDVNLMVKILNEVTQLTLKYLNHDQSYKIL 1439
            +  +I QA++WEQ GE+  AV+CYLK+K+  +++L++K   +  +L +K+L+HD++  + 
Sbjct: 1272 VEGMIEQAQEWEQTGEYSRAVDCYLKVKDSSNLDLLLKCWMKAAELAIKFLSHDKAVDVS 1331

Query: 1440 PSLVPKLMEFKQYDLAVRVYLNIDMVKEAVDIFIYTQNWNKARKLCAELKPEYLSYVENQ 1499
              + P+L++ ++Y+ A  +YLN+D++K A+D FI  + WNKA+++  EL P    YV+ +
Sbjct: 1332 QIVGPRLIQLRKYNEAAELYLNLDLIKNAIDAFIEGEEWNKAKRVAKELDPRLEEYVDKR 1391

Query: 1500 YKEWLKKNGDADMLSEIDINTALDMLMKQGQWNQCLDKAKNINTNLLHKYMALYAMHLIK 1559
            YKE LK  G  D L  +D+  ALDM  ++GQW +C+D A   N  +LHKY+ALYA HLIK
Sbjct: 1392 YKEHLKNQGKVDSLVGVDVVAALDMYAERGQWEKCIDTASKQNFKVLHKYIALYATHLIK 1451

Query: 1560 NKEYAQLTQLFNEYGTPNIPQFYNIYKQTAYCILN----DSNENVNLIISLRNMLFNVIK 1615
              E  ++  L+ ++G P   Q +NIYK+    ++N    D  E   +   LR++L  + +
Sbjct: 1452 EGEVEKVLSLYIQHGVPAYSQNFNIYKRMFQELVNLRDRDCAEAFRMWSDLRDVLLLLCE 1511

Query: 1616 NQNNNEE 1622
            N   + E
Sbjct: 1512 NLTKSSE 1518

Required for the maintenance and formation of cilia.
Danio rerio (taxid: 7955)

>sp\|Q6VH22\|IF172_MOUSE Intraflagellar transport protein 172 homolog OS=Mus musculus GN=Ift172 PE=1 SV=1	Back alignment and function description

>sp\|Q9UG01\|IF172_HUMAN Intraflagellar transport protein 172 homolog OS=Homo sapiens GN=IFT172 PE=1 SV=2	Back alignment and function description

>sp\|Q9JKU3\|IF172_RAT Intraflagellar transport protein 172 homolog OS=Rattus norvegicus GN=Ift172 PE=1 SV=1	Back alignment and function description

>sp\|Q9W040\|OSM1_DROME Intraflagellar transport protein osm-1 OS=Drosophila melanogaster GN=osm-1 PE=3 SV=2	Back alignment and function description

>sp\|Q5DM57\|IF172_CHLRE Intraflagellar transport protein 172 OS=Chlamydomonas reinhardtii GN=IFT172 PE=1 SV=1	Back alignment and function description

>sp\|Q22830\|OSM1_CAEEL Intraflagellar transport protein osm-1 OS=Caenorhabditis elegans GN=osm-1 PE=2 SV=4	Back alignment and function description

>sp\|A8WGF4\|IF122_XENTR Intraflagellar transport protein 122 homolog OS=Xenopus tropicalis GN=ift122 PE=2 SV=1	Back alignment and function description

>sp\|Q6NWV3\|IF122_MOUSE Intraflagellar transport protein 122 homolog OS=Mus musculus GN=Ift122 PE=2 SV=1	Back alignment and function description

>sp\|Q6NYH1\|IF122_DANRE Intraflagellar transport protein 122 homolog OS=Danio rerio GN=ift122 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1637
242012769		1752	wimple/ift172, putative [Pediculus human	0.862	0.805	0.451	0.0
328716745		1766	PREDICTED: intraflagellar transport prot	0.874	0.810	0.447	0.0
443693197		1751	hypothetical protein CAPTEDRAFT_128053 [	0.861	0.805	0.405	0.0
291239676		1751	PREDICTED: intraflagellar transport prot	0.865	0.809	0.400	0.0
91094669		1734	PREDICTED: similar to osm-1 CG13809-PA [	0.735	0.694	0.454	0.0
50539690		1745	intraflagellar transport protein 172 hom	0.728	0.683	0.441	0.0
82232659		1745	RecName: Full=Intraflagellar transport p	0.728	0.683	0.443	0.0
348538537		1749	PREDICTED: intraflagellar transport prot	0.849	0.794	0.398	0.0
118089060		1749	PREDICTED: intraflagellar transport prot	0.732	0.685	0.434	0.0
335285745		1749	PREDICTED: intraflagellar transport prot	0.731	0.684	0.431	0.0

>gi\|242012769\|ref\|XP_002427100.1\| wimple/ift172, putative [Pediculus humanus corporis] gi\|212511358\|gb\|EEB14362.1\| wimple/ift172, putative [Pediculus humanus corporis]	Back alignment and taxonomy information

 Score = 1296 bits (3354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 695/1539 (45%), Positives = 979/1539 (63%), Gaps = 127/1539 (8%)

Query: 180  VPPYALSW-PAGYILA-AGSDRIVTIYESDGRVHRIFDY--TAPHYKEREFTVAC--SSP 233
            V    L W P    LA A +DR +++++  G     F    +   Y ++ F+V C   SP
Sbjct: 17   VKVVGLCWSPNNLKLAVATADRTISLFDDKGDKKDKFSLKPSDSKYGKKSFSVKCIAFSP 76

Query: 234  SGQAVVVGSYDNIKLFAWSPSKSVWEEQPNKTIPNLYTISA----LSWKRDGSRIACGGL 289
                + VG  DNI ++ +   +  W ++  K I N + +S+    L W   GS I  G  
Sbjct: 77   DSTKIAVGQTDNI-VYVYKIGER-WGDK--KVICNKFAVSSAITNLIWLSQGSLI-FGTA 131

Query: 290  CGSVELFESVLKRTIWKGKFEMIYVSPSQVLVKPLSGESKGRGVILKSQYG-----YEIT 344
             G V L            K   +Y + S   V  L+   KG G +     G     Y   
Sbjct: 132  DGKVRL------GNCKTNKASTLYATDS--FVVSLASNFKGTGFLSGHADGTVVRYYVSD 183

Query: 345  DVAIMGNDRYLVARTPDTLLLGDLHRNLLSE-----VLWPDSGR----------NEKFYF 389
            D ++    + LV  +P   L   L+  L +       ++   G+          NEK + 
Sbjct: 184  DSSMEPQGKVLVCSSPPYALAWTLNHILTAGCDKRVTIYEKDGKILRTIDYNKENEKGF- 242

Query: 390  DNVTVCLVFNAGELSIIEYGNNEILTCVSIKLFAWSPSKSVWEEQPNKTIPNLYTISALS 449
               TV     +G+   +  G+ +      I+L +W+  K +WEE  +K I NLYTI+AL 
Sbjct: 243  ---TVACCSPSGQ--AVALGSFD-----RIRLLSWNSIKGIWEESTSKEIKNLYTITALH 292

Query: 450  WKRDGSRIACGGLCGSVELFESVLKRTIWKGKFEMIYVSPSQVLVKPLSGESKGRGVILK 509
            WKRDGSR+ACG LCG V LFESVLKRTI+K KFE+ YV PSQVL+K ++      G++LK
Sbjct: 293  WKRDGSRVACGTLCGGVLLFESVLKRTIYKNKFEITYVGPSQVLIKSINNSD--NGIMLK 350

Query: 510  SQYGYEITDVAIMGNDRYLVART------------LLTEFMNP----------------- 540
            SQYGYE+ DV IMG DRY+VART            L++E M P                 
Sbjct: 351  SQYGYEVNDVRIMGKDRYIVARTPHTIFLGDLEKNLVSEIMWPNSGRNEKFYFDNANVCL 410

Query: 541  ----------------------------HLISVRLNERKQVHSQQENKKLAYLLDLHTIC 572
                                        HLISVRLNER Q+   ++NKKLAYLLDL TIC
Sbjct: 411  IFNVGELSLVEYGENKILGSVRTEFMNPHLISVRLNER-QISGSEDNKKLAYLLDLKTIC 469

Query: 573  VIDLITNLPTLHINHDSKIDWLELNETAHKLLYRDKKMRLTLLDIRTSEKHNILNYCTFV 632
            +IDL   +   HI+HD+K+DWLELNET +KLL+RDKK RL LLD+R+  K  IL  CTF 
Sbjct: 470  IIDLAFGVTVAHISHDAKVDWLELNETGYKLLFRDKKQRLMLLDLRSGRKEAILTNCTF- 528

Query: 633  QWLPGSDVVVAQSRHNACVWYNIDTPDRITQFPVRGDIIDVIRENGQSEILTQDGNHQLG 692
             W+PGSDVVVAQS +N CVWYNIDTP+R+T F ++G+I+DVIR  G++E++ QDG HQLG
Sbjct: 529  -WIPGSDVVVAQSLNNLCVWYNIDTPERVTLFQIKGEIVDVIRAEGRTEVIVQDGIHQLG 587

Query: 693  YELDESLIEFGTAVHDSDFGKAILYLESLGINKKEAEGMWQNLAEVAIQLHNLHVAEICY 752
            YELDE L+EFGTA+HD DFG+A+L+LES+G N+ EA+GMWQNLA++A+ L NL VAE C+
Sbjct: 588  YELDEGLVEFGTAIHDKDFGRAVLFLESMG-NRPEADGMWQNLADIALSLQNLRVAERCF 646

Query: 753  AALGDISTTHFLRETIKIGEVWSKENNIGDPLQCPELWARMAILNKQFKVAEGIYLENNE 812
            AALGD+S THFL+ETIKIG  ++++NN  D L CPE+W R+AIL KQ K AE IYLE NE
Sbjct: 647  AALGDVSKTHFLKETIKIGTSFAEQNNT-DVLSCPEVWVRLAILKKQIKEAEQIYLEQNE 705

Query: 813  IHKAIDMYLKLYKWEDALSLAET-NNYEYNELKKKYIKWLTDTRQEDKAGELYEKEGDHQ 871
            I KAI+MY K +KWE+AL LA +  N E   L+++++KWL +TRQE+KAG+L EKEGDH 
Sbjct: 706  IDKAIEMYQKFHKWEEALKLARSKGNAESEILQERHLKWLMETRQEEKAGDLKEKEGDHL 765

Query: 872  TALNYYLKANFTSKACNLVQNEPYLLENHDVVSQIVKGLIKNESYIKAGQIYEFTNENEK 931
            TALN YL A    +A  L+QN  YLLEN  +V++++  LIK +   +AG +YE  N+  K
Sbjct: 766  TALNLYLNAKQPGRAFRLLQNYTYLLENEQIVNKVISSLIKADMMEQAGMLYEKLNDYHK 825

Query: 932  ALECYRKGKVYDKCIDLTRKINPKNVTALEEEWGDHLIENKQYNAAINHYIEAGKNNKAL 991
            ALECY+KGK++ K ++L +K+ P  +  LEE+WGD L E+KQ +AAINHYIEA K  KAL
Sbjct: 826  ALECYKKGKIFPKAVELAKKVAPNEIKLLEEQWGDWLTESKQLDAAINHYIEARKTVKAL 885

Query: 992  DTSIKAKQWKKAVQILQVITNKQDIAQHVKTLAQHFKTVKDYKTAEKIYSHCDMHEQIVD 1051
            + ++  +QWKKA QI+QVI + + +  + + + ++F +VK+Y+ AE +   C M  +++D
Sbjct: 886  EAAVNGRQWKKAYQIIQVIDDVESVLVYYQKIGEYFLSVKEYQLAEDMLLKCGMFREVID 945

Query: 1052 MYHQTGQWEKAYAIAEQHLNVGEIKATFIQKCKQLEEENKFKEAERLYLIIGEPDLAISM 1111
            MY+  GQW+KA+ IA ++L+  E+   ++ + + LE+  K KEAE+++  I +PD+AISM
Sbjct: 946  MYNNAGQWDKAHKIASKYLDNDEVTTMYLSQAQALEDSGKLKEAEKVFESISKPDMAISM 1005

Query: 1112 FKNQRQYENMIKLVRNYHPDLLDTTLLHLAQECEESKNYKQAEKYYLDCNEWKLAIKMYR 1171
            +K  R+Y+NMIKLV+ YHP+L+  T  HLAQE E  K YK AE++Y+  NEWK A+ MYR
Sbjct: 1006 YKKHRKYDNMIKLVKTYHPELVTITHKHLAQELEAGKQYKLAEQHYIQSNEWKSAVNMYR 1065

Query: 1172 SLNLWEDAYRIALSNGGQEAVEPVVYLWAKSLGGDSAVRLLNRLSLLESCISNACDTYQF 1231
              ++W++A+RIA ++GG EA   V +LWAK+LGGD+AVRLLN+ +LLE CI   CD+YQF
Sbjct: 1066 LADMWDEAHRIAKTHGGTEAGNQVAFLWAKTLGGDAAVRLLNKFNLLEQCIDYCCDSYQF 1125

Query: 1232 DFAFELAKIGMKSKLEEVHYKYALVLEDNGQFNEAETQFIKANKPKEAISMYIHNQDWEN 1291
            DFAFEL K+ M  KL  +HYKYAL LED G+F EAE +F++A KPKEAISMYIH ++WE 
Sbjct: 1126 DFAFELGKLSMSEKLPNIHYKYALALEDGGKFQEAEEEFLEAGKPKEAISMYIHAREWEK 1185

Query: 1292 AERIANEHDPTSIGDILLNQSKCEFENENFSKFETLLLRAHKVDLIIEKYKMNHMWNDAL 1351
            AE +A ++D  S+ D+LL Q+K   + EN S  E+LLLRA K +++I+ Y+ N MW DAL
Sbjct: 1186 AEAVAEKYDKNSLPDVLLAQAKNVMDRENPSAIESLLLRAQKPEMLIKYYQDNDMWVDAL 1245

Query: 1352 RVCGEYVPSKLPLLQQEYEKEINTNISKDIHSLITQARQWEQNGEFYNAVECYLKIKNV- 1410
            R+C EY+PSKL  +Q  Y++++ +  S  + S++ QAR+WEQNG+F  +++CY+KI  + 
Sbjct: 1246 RICKEYLPSKLSAIQSMYDRQVGSKGS--LTSVLAQAREWEQNGQFKQSIQCYIKISTLS 1303

Query: 1411 -DVNLMVKILNEVTQLTLKYLNHDQSYKILPSLVPKLMEFKQYDLAVRVYLNIDMVKEAV 1469
             D   +V  L +   LT K+ + D +  +  S+ PKL+E+KQY  A ++Y+  D++ EAV
Sbjct: 1304 NDKETIVNSLLKAADLTSKFADPDDAIMVSRSVCPKLIEYKQYGSAAQLYMTCDLIPEAV 1363

Query: 1470 DIFIYTQNWNKARKLCAELKPEYLSYVENQYKEWLKKNGDADMLSEIDINTALDMLMKQG 1529
            D +I  + W+KARK+  E +P    YVEN+YKE L   G+ + L+++D   AL++L +QG
Sbjct: 1364 DAYIKGEEWSKARKIAKEYEPRLELYVENKYKEHLTMAGNIEQLADVDATAALNLLARQG 1423

Query: 1530 QWNQCLDKAKNINTNLLHKYMALYAMHLIKNKEYAQLTQLFNEYGTPNIPQFYNIYKQTA 1589
             W QC + AK   + +LHKY+A++A  L+K ++  +   L+ +Y  P   Q YNIYK+  
Sbjct: 1424 SWTQCFETAKQYGSQVLHKYVAIHAAQLLKEEKSLEALNLYTKYEAPAYQQNYNIYKKIT 1483

Query: 1590 YCILN--DSN--ENVNLIISLRNMLFNVIKNQNNNEEID 1624
              I    D N  E+ ++   LRNMLFN+ +N  +++E +
Sbjct: 1484 SDIFGMPDMNEPESYDVWAELRNMLFNLTENIRHSQEAE 1522

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|328716745\|ref\|XP_003246027.1\| PREDICTED: intraflagellar transport protein 172 homolog [Acyrthosiphon pisum]	Back alignment and taxonomy information

>gi\|443693197\|gb\|ELT94627.1\| hypothetical protein CAPTEDRAFT_128053 [Capitella teleta]	Back alignment and taxonomy information

>gi\|291239676\|ref\|XP_002739751.1\| PREDICTED: intraflagellar transport protein 172 homolog isoform 1 [Saccoglossus kowalevskii]	Back alignment and taxonomy information

>gi\|91094669\|ref\|XP_972505.1\| PREDICTED: similar to osm-1 CG13809-PA [Tribolium castaneum] gi\|270016462\|gb\|EFA12908.1\| hypothetical protein TcasGA2_TC006977 [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|50539690\|ref\|NP_001002312.1\| intraflagellar transport protein 172 homolog [Danio rerio] gi\|47834968\|gb\|AAT39119.1\| IFT172 [Danio rerio] gi\|190340273\|gb\|AAI63767.1\| Intraflagellar transport 172 [Danio rerio]	Back alignment and taxonomy information

>gi\|82232659\|sp\|Q5RHH4.1\|IF172_DANRE RecName: Full=Intraflagellar transport protein 172 homolog	Back alignment and taxonomy information

>gi\|348538537\|ref\|XP_003456747.1\| PREDICTED: intraflagellar transport protein 172 homolog [Oreochromis niloticus]	Back alignment and taxonomy information

>gi\|118089060\|ref\|XP_419993.2\| PREDICTED: intraflagellar transport protein 172 homolog [Gallus gallus]	Back alignment and taxonomy information

>gi\|335285745\|ref\|XP_003354937.1\| PREDICTED: intraflagellar transport protein 172 homolog [Sus scrofa]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1637
ZFIN\|ZDB-GENE-040827-1		1745	ift172 "intraflagellar transpo	0.668	0.627	0.448	0.0
UNIPROTKB\|E1BVT1		1753	IFT172 "Uncharacterized protei	0.673	0.629	0.433	0.0
UNIPROTKB\|E1BJT7		1749	LOC100848219 "Uncharacterized	0.672	0.629	0.434	0.0
MGI\|MGI:2682064		1749	Ift172 "intraflagellar transpo	0.672	0.629	0.436	0.0
UNIPROTKB\|E2RF25		1749	IFT172 "Uncharacterized protei	0.673	0.630	0.434	0.0
UNIPROTKB\|I3LPC6		1749	IFT172 "Uncharacterized protei	0.672	0.629	0.434	0.0
UNIPROTKB\|Q9UG01		1749	IFT172 "Intraflagellar transpo	0.672	0.629	0.429	0.0
RGD\|620744		1749	Ift172 "intraflagellar transpo	0.672	0.629	0.432	0.0
FB\|FBgn0035317		1772	osm-1 "osm-1" [Drosophila mela	0.669	0.618	0.413	0.0
UNIPROTKB\|Q5DM57		1755	IFT172 "Intraflagellar transpo	0.667	0.622	0.367	1.6e-292

ZFIN\|ZDB-GENE-040827-1 ift172 "intraflagellar transport 172" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

 Score = 2661 (941.8 bits), Expect = 0., Sum P(2) = 0.
 Identities = 500/1116 (44%), Positives = 760/1116 (68%)

Query:   515 EITDVAIMGNDRYLVARTLLTEFMNPHLISVRLNERKQVHSQQENKKLAYLLDLHTICVI 574
             E+  V    ND   +  ++ TEFMNPHLISVRLNER+Q    ++NKKLAYL+D+ TI ++
Sbjct:   416 ELALVEYGSND---ILGSVRTEFMNPHLISVRLNERRQ-RGVEDNKKLAYLIDIKTIAIV 471

Query:   575 DLIT--NLPTLHINHDSKIDWLELNETAHKLLYRDKKMRLTLLDIRTSEKHNILNYCTFV 632
             DL+   NL T  I+HDSKIDWLELNET  KLL+RDKK+RL L DI +S K  +L++C +V
Sbjct:   472 DLVGGYNLGT--ISHDSKIDWLELNETGRKLLFRDKKLRLHLYDIESSVKSTMLSFCPYV 529

Query:   633 QWLPGSDVVVAQSRHNACVWYNIDTPDRITQFPVRGDIIDVIRENGQSEILTQDGNHQLG 692
             QW+PGSDVVVAQ+R N CVWY ID+P+R+T FP++GDI+D+ R NG++E++  +G + + 
Sbjct:   530 QWVPGSDVVVAQNRGNLCVWYTIDSPERVTMFPLKGDIVDLERSNGKTEVIVNEGVNSIS 589

Query:   693 YELDESLIEFGTAVHDSDFGKAILYLESLGINKKEAEGMWQNLAEVAIQLHNLHVAEICY 752
             Y LDE LIEFGTA+ D D+ +A  +LE+L ++  E E MW+ L++++++   LH+AE C+
Sbjct:   590 YTLDEGLIEFGTAIDDGDYYRATAFLETLEMSA-ETEAMWKTLSKLSLEAQQLHIAERCF 648

Query:   753 AALGDISTTHFLRETIKIGEVWSKENNIGDPLQCPELWARMAILNKQFKVAEGIYLENNE 812
             AALGD+S   FL ET KI +  +KE + GD     ++ AR+A+L+K FK+AE  Y+E N 
Sbjct:   649 AALGDVSKARFLNETNKIADAVAKEYD-GDGTDHYQVKARLAMLDKNFKLAEMYYMEQNA 707

Query:   813 IHKAIDMYLKLYKWEDALSLAETNNY-EYNELKKKYIKWLTDTRQEDKAGELYEKEGDHQ 871
             + + ++MY +L+ W++ +++AE   + E + L++ Y  +L +T Q +KA E+ E EGD  
Sbjct:   708 VDEVMEMYQELHMWDECIAVAEGKGHPELDNLRRSYYSYLMETNQNEKAAEVKENEGDFT 767

Query:   872 TALNYYLKANFTSKACNLVQNEPYLLENHDVVSQIVKGLIKNESYIKAGQIYEFTNENEK 931
              A+N YLKA   +KA  L  ++  LL + D+VS+I   LIK E Y +AG ++E T  N++
Sbjct:   768 GAVNLYLKAGLPAKAAWLAMSKDELLSSQDIVSRITAALIKGEFYERAGDLFERTRNNQR 827

Query:   932 ALECYRKGKVYDKCIDLTRKINPKNVTALEEEWGDHLIENKQYNAAINHYIEAGKNNKAL 991
             ALECYRKG  + K +DL R   P  V  LEE WGD+L++ KQ +AAINHYIEAG++ KA+
Sbjct:   828 ALECYRKGNAFKKAVDLARVAFPAEVVKLEEVWGDYLVQQKQMDAAINHYIEAGRSIKAI 887

Query:   992 DTSIKAKQWKKAVQILQVITNKQDIAQHVKTLAQHFKTVKDYKTAEKIYSHCDMHEQIVD 1051
             + +I A+QWKKA+ IL++  ++     ++K +AQ++ +V++++ AE+++   D  +  +D
Sbjct:   888 EAAIAARQWKKALHILELQEDRTAAKYYLK-IAQYYASVQEFEVAERLFVKGDHIKDAID 946

Query:  1052 MYHQTGQWEKAYAIAEQHLNVGEIKATFIQKCKQLEEENKFKEAERLYLIIGEPDLAISM 1111
             MY Q G+WE+A+ +A + +   ++   ++ + ++LE+E K+KEAERL+  + EPDLAI+M
Sbjct:   947 MYTQAGRWEQAHKLAVKCMTQEDVSVLYVSRAQELEKEGKYKEAERLFTTVDEPDLAITM 1006

Query:  1112 FKNQRQYENMIKLVRNYXXXXXXXXXXXXAQECEESKNYKQAEKYYLDCNEWKLAIKMYR 1171
             +K  + Y++MI+LV  +            A+E E    +++AE +YL+  +WK A+ MYR
Sbjct:  1007 YKKNKMYDDMIRLVAVHHKDLLQETHIHLAKELEAESRFQEAEYHYLEGQDWKAAVNMYR 1066

Query:  1172 SLNLWEDAYRIALSNGGQEAVEPVVYLWAKSLGGDSAVRLLNRLSLLESCISNACDTYQF 1231
               ++WE+AYRIA ++GG  A + V YLWAKSLGG++AV+LLN+  LLE+ I  A D Y F
Sbjct:  1067 VNDMWEEAYRIAKTHGGANAHKQVAYLWAKSLGGEAAVKLLNKFGLLETAIDFAADNYTF 1126

Query:  1232 DFAFELAKIGMKSKLEEVHYKYALVLEDNGQFNEAETQFIKANKPKEAISMYIHNQDWEN 1291
             DFAFELA++ MK K+ ++H K A+ LED G+FNEAE +FIKA KPKEA+ M++HN+DW N
Sbjct:  1127 DFAFELARLSMKQKIPDIHLKNAMFLEDQGKFNEAEIEFIKAGKPKEAVLMHVHNKDWSN 1186

Query:  1292 AERIANEHDPTSIGDILLNQSKCEFENENFSKFETLLLRAHKVDLIIEKYKMNHMWNDAL 1351
             A+R+A  HDP S+ DIL++Q+K  F+ + F K E  LLRA + +L I+ YK   MW DA+
Sbjct:  1187 AQRVAEAHDPESVADILVSQAKFCFDQKEFQKAEAFLLRAQRPELAIKYYKDAGMWTDAM 1246

Query:  1352 RVCGEYVPSKLPLLQQEYEKEINTNISKDIHSLITQARQWEQNGEFYNAVECYLKIKNV- 1410
             R+C +Y+PSKL +LQ+EYE E N  +      +I QA++WEQ GE+  AV+CYLK+K+  
Sbjct:  1247 RICKDYLPSKLSVLQKEYESEGNWGVE----GMIEQAQEWEQTGEYSRAVDCYLKVKDSS 1302

Query:  1411 DVNLMVKILNEVTQLTLKYLNHDQSYKILPSLVPKLMEFKQYDLAVRVYLNIDMVKEAVD 1470
             +++L++K   +  +L +K+L+HD++  +   + P+L++ ++Y+ A  +YLN+D++K A+D
Sbjct:  1303 NLDLLLKCWMKAAELAIKFLSHDKAVDVSQIVGPRLIQLRKYNEAAELYLNLDLIKNAID 1362

Query:  1471 IFIYTQNWNKARKLCAELKPEYLSYVENQYKEWLKKNGDADMLSEIDINTALDMLMKQGQ 1530
              FI  + WNKA+++  EL P    YV+ +YKE LK  G  D L  +D+  ALDM  ++GQ
Sbjct:  1363 AFIEGEEWNKAKRVAKELDPRLEEYVDKRYKEHLKNQGKVDSLVGVDVVAALDMYAERGQ 1422

Query:  1531 WNQCLDKAKNINTNLLHKYMALYAMHLIKNKEYAQLTQLFNEYGTPNIPQFYNIYKQTAY 1590
             W +C+D A   N  +LHKY+ALYA HLIK  E  ++  L+ ++G P   Q +NIYK+   
Sbjct:  1423 WEKCIDTASKQNFKVLHKYIALYATHLIKEGEVEKVLSLYIQHGVPAYSQNFNIYKRMFQ 1482

Query:  1591 CILN----DSNENVNLIISLRNMLFNVIKNQNNNEE 1622
              ++N    D  E   +   LR++L  + +N   + E
Sbjct:  1483 ELVNLRDRDCAEAFRMWSDLRDVLLLLCENLTKSSE 1518

GO:0045494 "photoreceptor cell maintenance" evidence=IMP

GO:0060271 "cilium morphogenesis" evidence=IMP

GO:0048793 "pronephros development" evidence=IGI

GO:0032006 "regulation of TOR signaling cascade" evidence=IMP

GO:0005929 "cilium" evidence=IEA;ISS

GO:0042384 "cilium assembly" evidence=ISS

GO:0007275 "multicellular organismal development" evidence=IEA

GO:0042995 "cell projection" evidence=IEA

UNIPROTKB\|E1BVT1 IFT172 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BJT7 LOC100848219 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

MGI\|MGI:2682064 Ift172 "intraflagellar transport 172" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RF25 IFT172 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|I3LPC6 IFT172 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9UG01 IFT172 "Intraflagellar transport protein 172 homolog" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

RGD\|620744 Ift172 "intraflagellar transport 172 homolog (Chlamydomonas)" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

FB\|FBgn0035317 osm-1 "osm-1" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5DM57 IFT172 "Intraflagellar transport protein 172" [Chlamydomonas reinhardtii (taxid:3055)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q22830	OSM1_CAEEL	No assigned EC number	0.3235	0.8521	0.8031	yes	N/A
Q5RHH4	IF172_DANRE	No assigned EC number	0.4435	0.7287	0.6836	yes	N/A
Q6VH22	IF172_MOUSE	No assigned EC number	0.4345	0.7275	0.6809	yes	N/A
Q9W040	OSM1_DROME	No assigned EC number	0.3727	0.8649	0.7990	yes	N/A
Q9UG01	IF172_HUMAN	No assigned EC number	0.4298	0.7275	0.6809	yes	N/A
Q9JKU3	IF172_RAT	No assigned EC number	0.4306	0.7275	0.6809	yes	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		1637
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	2e-12
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	1e-05
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	1e-04
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	2e-04
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	2e-04
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	0.001

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment

Back alignment and domain information

 Score = 69.3 bits (170), Expect = 2e-12
 Identities = 59/287 (20%), Positives = 114/287 (39%), Gaps = 42/287 (14%)

Query: 28  SEGNVAGIWAWRGQNGRKSYV-----VKGLAFSPDSTKLAVAQSDNIIFIYKLGDDWGDK 82
           S      +W        ++       V+ +A S D T LA   SD  I ++    D    
Sbjct: 28  SGDGTIKVWDLETGELLRTLKGHTGPVRDVAASADGTYLASGSSDKTIRLW----DLETG 83

Query: 83  KVICNKFIQ-QCPVTTMVWLADGPIIYG-QSDGKIKAAHVKANK-TQTLYASNSFVVALC 139
           + +          V+++ +  DG I+     D  IK   V+  K   TL     +V ++ 
Sbjct: 84  ECV-RTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVWDVETGKCLTTLRGHTDWVNSVA 142

Query: 140 LNVRGAGVLSGHADGSIVRYYVTEDASNFDQQQGRVVQ----HPVPPYALSW-PAGY-IL 193
            +  G  V S   DG+I    +      +D + G+ V     H     ++++ P G  +L
Sbjct: 143 FSPDGTFVASSSQDGTI---KL------WDLRTGKCVATLTGHTGEVNSVAFSPDGEKLL 193

Query: 194 AAGSDRIVTIYE-SDGRVHRIFDYTAPHYKEREFTVACSSPSGQAVVVGSYDN-IKLFAW 251
           ++ SD  + +++ S G+             E        SP G  +  GS D  I+++  
Sbjct: 194 SSSSDGTIKLWDLSTGKCLGTL-----RGHENGVNSVAFSPDGYLLASGSEDGTIRVW-- 246

Query: 252 SPSKSVWEEQPNKTIPNL-YTISALSWKRDGSRIACGGLCGSVELFE 297
                +   +  +T+     ++++L+W  DG R+A G   G++ +++
Sbjct: 247 ----DLRTGECVQTLSGHTNSVTSLAWSPDGKRLASGSADGTIRIWD 289

Length = 289

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

Back alignment and domain information

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		1637
KOG3616\|consensus		1636		100.0
KOG3616\|consensus		1636		100.0
KOG3617\|consensus		1416		100.0
KOG1538\|consensus		1081		100.0
KOG2041\|consensus		1189		100.0
KOG0318\|consensus		603		100.0
KOG0292\|consensus		1202		100.0
KOG0276\|consensus		794		100.0
KOG0271\|consensus		480		100.0
KOG0291\|consensus		893		100.0
KOG0271\|consensus		480		100.0
KOG0319\|consensus		775		100.0
KOG1524\|consensus		737		100.0
KOG0319\|consensus		775		100.0
KOG0276\|consensus		794		100.0
KOG0318\|consensus		603		100.0
KOG0291\|consensus		893		100.0
KOG0306\|consensus		888		100.0
KOG0306\|consensus		888		100.0
KOG1538\|consensus		1081		100.0
KOG0272\|consensus		459		100.0
KOG0286\|consensus		343		100.0
TIGR02917		899	PEP_TPR_lipo putative PEP-CTERM system TPR-repeat	100.0
KOG0292\|consensus		1202		100.0
KOG3617\|consensus		1416		100.0
KOG0272\|consensus		459		100.0
KOG0279\|consensus		315		100.0
KOG0273\|consensus		524		100.0
TIGR02917		899	PEP_TPR_lipo putative PEP-CTERM system TPR-repeat	100.0
KOG0284\|consensus		464		100.0
KOG0273\|consensus		524		100.0
KOG0286\|consensus		343		100.0
KOG0279\|consensus		315		100.0
KOG0645\|consensus		312		100.0
KOG2048\|consensus		691		99.98
KOG1408\|consensus		1080		99.98
KOG0296\|consensus		399		99.97
KOG0295\|consensus		406		99.97
KOG0985\|consensus		1666		99.97
KOG0284\|consensus		464		99.97
KOG2106\|consensus		626		99.97
KOG0645\|consensus		312		99.97
KOG1539\|consensus		910		99.97
KOG0315\|consensus		311		99.97
KOG2041\|consensus		1189		99.97
KOG0263\|consensus		707		99.97
KOG0285\|consensus		460		99.97
KOG0285\|consensus		460		99.97
KOG0265\|consensus		338		99.97
KOG0275\|consensus		508		99.97
KOG0315\|consensus		311		99.97
KOG1063\|consensus		764		99.97
KOG0265\|consensus		338		99.97
KOG1063\|consensus		764		99.96
PLN03077		857	Protein ECB2; Provisional	99.96
KOG2048\|consensus		691		99.96
KOG0296\|consensus		399		99.96
KOG1408\|consensus		1080		99.96
PLN03077		857	Protein ECB2; Provisional	99.96
KOG0316\|consensus		307		99.96
KOG1539\|consensus		910		99.96
KOG0293\|consensus		519		99.96
KOG0266\|consensus		456		99.96
PLN00181		793	protein SPA1-RELATED; Provisional	99.96
KOG0295\|consensus		406		99.96
KOG0282\|consensus		503		99.96
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	99.95
KOG0282\|consensus		503		99.95
KOG0293\|consensus		519		99.95
KOG0263\|consensus		707		99.95
KOG0281\|consensus		499		99.95
KOG0281\|consensus		499		99.95
KOG0640\|consensus		430		99.95
KOG0266\|consensus		456		99.95
KOG0643\|consensus		327		99.95
PRK11447		1157	cellulose synthase subunit BcsC; Provisional	99.95
KOG0278\|consensus		334		99.95
PLN00181		793	protein SPA1-RELATED; Provisional	99.94
KOG0305\|consensus		484		99.94
KOG0316\|consensus		307		99.94
KOG0313\|consensus		423		99.94
KOG4626\|consensus		966		99.94
KOG0299\|consensus		479		99.94
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	99.94
KOG2106\|consensus		626		99.94
KOG0277\|consensus		311		99.94
PRK11447		1157	cellulose synthase subunit BcsC; Provisional	99.94
KOG1407\|consensus		313		99.94
KOG0275\|consensus		508		99.94
KOG0643\|consensus		327		99.94
KOG1524\|consensus		737		99.93
KOG0278\|consensus		334		99.93
KOG1407\|consensus		313		99.93
KOG0288\|consensus		459		99.93
KOG0313\|consensus		423		99.93
KOG1920\|consensus		1265		99.93
KOG0973\|consensus		942		99.93
KOG0310\|consensus		487		99.93
KOG0310\|consensus		487		99.92
KOG1036\|consensus		323		99.92
KOG0647\|consensus		347		99.92
KOG0772\|consensus		641		99.92
KOG0288\|consensus		459		99.92
KOG0772\|consensus		641		99.92
KOG0283\|consensus		712		99.92
KOG1446\|consensus		311		99.92
KOG0300\|consensus		481		99.92
KOG4626\|consensus		966		99.92
KOG0640\|consensus		430		99.92
KOG1446\|consensus		311		99.91
KOG0299\|consensus		479		99.91
KOG0641\|consensus		350		99.91
KOG2096\|consensus		420		99.91
PTZ00421		493	coronin; Provisional	99.91
KOG0283\|consensus		712		99.91
KOG0641\|consensus		350		99.91
KOG0639\|consensus		705		99.91
KOG0289\|consensus		506		99.91
KOG1274\|consensus		933		99.91
KOG0277\|consensus		311		99.9
PLN03218		1060	maturation of RBCL 1; Provisional	99.9
KOG1332\|consensus		299		99.9
KOG1332\|consensus		299		99.9
PTZ00420		568	coronin; Provisional	99.9
KOG0308\|consensus		735		99.9
KOG0268\|consensus		433		99.9
KOG0301\|consensus		745		99.9
PLN03081		697	pentatricopeptide (PPR) repeat-containing protein;	99.9
KOG0305\|consensus		484		99.9
KOG0647\|consensus		347		99.9
KOG0268\|consensus		433		99.9
PLN03218		1060	maturation of RBCL 1; Provisional	99.9
PLN03081		697	pentatricopeptide (PPR) repeat-containing protein;	99.9
PTZ00421		493	coronin; Provisional	99.9
KOG0274\|consensus		537		99.89
KOG0301\|consensus		745		99.89
KOG0294\|consensus		362		99.89
KOG0274\|consensus		537		99.89
KOG0308\|consensus		735		99.89
KOG0973\|consensus		942		99.88
PF04762		928	IKI3: IKI3 family; InterPro: IPR006849 Members of	99.88
KOG2096\|consensus		420		99.88
KOG0300\|consensus		481		99.88
PTZ00420		568	coronin; Provisional	99.88
KOG0639\|consensus		705		99.88
KOG1036\|consensus		323		99.88
KOG1274\|consensus		933		99.88
KOG1920\|consensus		1265		99.87
KOG1445\|consensus		1012		99.87
KOG2055\|consensus		514		99.87
KOG0289\|consensus		506		99.86
PRK09782		987	bacteriophage N4 receptor, outer membrane subunit;	99.86
KOG4283\|consensus		397		99.86
KOG0294\|consensus		362		99.86
KOG1445\|consensus		1012		99.86
KOG0264\|consensus		422		99.86
KOG0269\|consensus		839		99.85
KOG2055\|consensus		514		99.85
KOG0646\|consensus		476		99.85
KOG4283\|consensus		397		99.85
KOG0264\|consensus		422		99.84
KOG2445\|consensus		361		99.84
KOG2445\|consensus		361		99.84
PRK09782		987	bacteriophage N4 receptor, outer membrane subunit;	99.84
KOG1273\|consensus		405		99.83
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	99.83
KOG4328\|consensus		498		99.83
KOG1273\|consensus		405		99.83
KOG1963\|consensus		792		99.83
KOG4328\|consensus		498		99.82
KOG2002\|consensus		1018		99.82
KOG4497\|consensus		447		99.81
KOG0307\|consensus		1049		99.81
KOG0650\|consensus		733		99.81
KOG0267\|consensus		825		99.81
KOG0269\|consensus		839		99.8
KOG0270\|consensus		463		99.8
KOG0302\|consensus		440		99.8
KOG0321\|consensus		720		99.8
KOG0646\|consensus		476		99.8
KOG0267\|consensus		825		99.8
KOG2919\|consensus		406		99.8
KOG1034\|consensus		385		99.8
KOG1963\|consensus		792		99.79
KOG0650\|consensus		733		99.79
KOG0302\|consensus		440		99.78
TIGR00990		615	3a0801s09 mitochondrial precursor proteins import	99.78
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	99.78
KOG1009\|consensus		434		99.77
KOG0321\|consensus		720		99.77
KOG4497\|consensus		447		99.76
KOG4378\|consensus		673		99.76
KOG0270\|consensus		463		99.76
KOG1009\|consensus		434		99.75
KOG2002\|consensus		1018		99.75
TIGR00990		615	3a0801s09 mitochondrial precursor proteins import	99.75
KOG2919\|consensus		406		99.74
KOG0307\|consensus		1049		99.73
KOG0290\|consensus		364		99.71
KOG4378\|consensus		673		99.71
KOG1188\|consensus		376		99.71
KOG4227\|consensus		609		99.69
PF04762		928	IKI3: IKI3 family; InterPro: IPR006849 Members of	99.69
COG2319		466	FOG: WD40 repeat [General function prediction only	99.68
KOG2076\|consensus		895		99.68
PRK15174		656	Vi polysaccharide export protein VexE; Provisional	99.68
KOG1517\|consensus		1387		99.68
KOG1587\|consensus		555		99.68
KOG1034\|consensus		385		99.67
KOG1007\|consensus		370		99.67
KOG0642\|consensus		577		99.67
KOG0290\|consensus		364		99.66
KOG0303\|consensus		472		99.66
COG5290		1243	IkappaB kinase complex, IKAP component [Transcript	99.66
KOG1523\|consensus		361		99.65
PRK15174		656	Vi polysaccharide export protein VexE; Provisional	99.65
PRK10049		765	pgaA outer membrane protein PgaA; Provisional	99.65
KOG2003\|consensus		840		99.63
KOG0649\|consensus		325		99.62
KOG0642\|consensus		577		99.62
COG2319		466	FOG: WD40 repeat [General function prediction only	99.61
KOG1007\|consensus		370		99.61
PRK10049		765	pgaA outer membrane protein PgaA; Provisional	99.61
KOG1188\|consensus		376		99.61
PRK11028		330	6-phosphogluconolactonase; Provisional	99.6
KOG0644\|consensus		1113		99.59
KOG1587\|consensus		555		99.59
KOG4227\|consensus		609		99.58
PF04053		443	Coatomer_WDAD: Coatomer WD associated region ; Int	99.58
KOG1912\|consensus		1062		99.58
KOG0649\|consensus		325		99.58
KOG0303\|consensus		472		99.58
KOG0322\|consensus		323		99.58
KOG0985\|consensus		1666		99.57
KOG1523\|consensus		361		99.56
KOG1334\|consensus		559		99.56
PRK11028		330	6-phosphogluconolactonase; Provisional	99.56
KOG1840\|consensus		508		99.56
KOG1517\|consensus		1387		99.55
KOG1912\|consensus		1062		99.55
KOG2076\|consensus		895		99.53
PRK01742		429	tolB translocation protein TolB; Provisional	99.53
KOG0771\|consensus		398		99.52
KOG1240\|consensus		1431		99.51
KOG0644\|consensus		1113		99.51
KOG2139\|consensus		445		99.51
PRK01742		429	tolB translocation protein TolB; Provisional	99.5
KOG2110\|consensus		391		99.5
KOG0322\|consensus		323		99.5
KOG2110\|consensus		391		99.5
KOG0771\|consensus		398		99.49
KOG2139\|consensus		445		99.48
KOG1240\|consensus		1431		99.47
KOG1840\|consensus		508		99.47
KOG0547\|consensus		606		99.47
PRK03629		429	tolB translocation protein TolB; Provisional	99.46
PRK14574		822	hmsH outer membrane protein; Provisional	99.46
KOG2003\|consensus		840		99.46
PRK03629		429	tolB translocation protein TolB; Provisional	99.45
PF04053		443	Coatomer_WDAD: Coatomer WD associated region ; Int	99.45
PRK05137		435	tolB translocation protein TolB; Provisional	99.45
KOG0974\|consensus		967		99.45
PRK11788		389	tetratricopeptide repeat protein; Provisional	99.44
PRK14574		822	hmsH outer membrane protein; Provisional	99.43
KOG1354\|consensus		433		99.43
PRK11788		389	tetratricopeptide repeat protein; Provisional	99.42
KOG1334\|consensus		559		99.42
KOG2315\|consensus		566		99.42
PRK04922		433	tolB translocation protein TolB; Provisional	99.41
KOG1310\|consensus		758		99.41
KOG2321\|consensus		703		99.41
COG4946		668	Uncharacterized protein related to the periplasmic	99.4
KOG2111\|consensus		346		99.4
KOG1272\|consensus		545		99.38
KOG0547\|consensus		606		99.38
KOG0974\|consensus		967		99.38
PRK05137		435	tolB translocation protein TolB; Provisional	99.37
PRK02889		427	tolB translocation protein TolB; Provisional	99.37
PRK02889		427	tolB translocation protein TolB; Provisional	99.37
KOG2321\|consensus		703		99.36
PRK04922		433	tolB translocation protein TolB; Provisional	99.36
KOG0495\|consensus		913		99.36
PF02239		369	Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO	99.35
KOG1155\|consensus		559		99.35
KOG2114\|consensus		933		99.35
KOG1173\|consensus		611		99.34
KOG2314\|consensus		698		99.34
KOG1126\|consensus		638		99.34
KOG2394\|consensus		636		99.34
KOG1155\|consensus		559		99.33
KOG1409\|consensus		404		99.32
KOG0548\|consensus		539		99.32
PF02239		369	Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO	99.32
KOG2111\|consensus		346		99.3
COG4946		668	Uncharacterized protein related to the periplasmic	99.3
KOG1272\|consensus		545		99.28
KOG2394\|consensus		636		99.28
PF08662		194	eIF2A: Eukaryotic translation initiation factor eI	99.28
KOG1310\|consensus		758		99.27
KOG1173\|consensus		611		99.27
COG5354		561	Uncharacterized protein, contains Trp-Asp (WD) rep	99.27
KOG1126\|consensus		638		99.26
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	99.26
PF10282		345	Lactonase: Lactonase, 7-bladed beta-propeller; Int	99.25
KOG2315\|consensus		566		99.24
PRK04792		448	tolB translocation protein TolB; Provisional	99.23
PRK01029		428	tolB translocation protein TolB; Provisional	99.23
PF10282		345	Lactonase: Lactonase, 7-bladed beta-propeller; Int	99.22
KOG1354\|consensus		433		99.21
KOG4162\|consensus		799		99.21
PRK00178		430	tolB translocation protein TolB; Provisional	99.2
KOG2314\|consensus		698		99.19
PF08662		194	eIF2A: Eukaryotic translation initiation factor eI	99.19
PRK04792		448	tolB translocation protein TolB; Provisional	99.19
COG5354		561	Uncharacterized protein, contains Trp-Asp (WD) rep	99.18
KOG2066\|consensus		846		99.18
PF13429		280	TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2	99.18
PRK00178		430	tolB translocation protein TolB; Provisional	99.17
KOG0495\|consensus		913		99.17
KOG3881\|consensus		412		99.17
KOG2280\|consensus		829		99.15
COG2706		346	3-carboxymuconate cyclase [Carbohydrate transport	99.15
PRK01029		428	tolB translocation protein TolB; Provisional	99.15
COG2706		346	3-carboxymuconate cyclase [Carbohydrate transport	99.14
KOG2047\|consensus		835		99.13
KOG0548\|consensus		539		99.13
PF13429		280	TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2	99.11
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	99.1
KOG3881\|consensus		412		99.1
KOG0280\|consensus		339		99.09
KOG1130\|consensus		639		99.07
KOG3785\|consensus		557		99.03
COG2956		389	Predicted N-acetylglucosaminyl transferase [Carboh	99.03
KOG2114\|consensus		933		99.02
KOG2047\|consensus		835		99.01
COG5290		1243	IkappaB kinase complex, IKAP component [Transcript	99.0
KOG4547\|consensus		541		98.99
PRK10747		398	putative protoheme IX biogenesis protein; Provisio	98.99
KOG1127\|consensus		1238		98.97
KOG1174\|consensus		564		98.97
KOG3785\|consensus		557		98.96
PRK10747		398	putative protoheme IX biogenesis protein; Provisio	98.96
KOG1156\|consensus		700		98.96
KOG4532\|consensus		344		98.94
KOG0309\|consensus		1081		98.93
COG2956		389	Predicted N-acetylglucosaminyl transferase [Carboh	98.93
TIGR00540		409	hemY_coli hemY protein. This is an uncharacterized	98.93
KOG4547\|consensus		541		98.93
TIGR02658		352	TTQ_MADH_Hv methylamine dehydrogenase heavy chain.	98.93
TIGR03300		377	assembly_YfgL outer membrane assembly lipoprotein	98.92
KOG4162\|consensus		799		98.92
TIGR02658		352	TTQ_MADH_Hv methylamine dehydrogenase heavy chain.	98.91
KOG2376\|consensus		652		98.89
TIGR00540		409	hemY_coli hemY protein. This is an uncharacterized	98.88
TIGR02521		234	type_IV_pilW type IV pilus biogenesis/stability pr	98.88
KOG2280\|consensus		829		98.88
KOG1409\|consensus		404		98.87
KOG1130\|consensus		639		98.87
KOG4532\|consensus		344		98.86
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	98.86
PRK04841		903	transcriptional regulator MalT; Provisional	98.85
KOG1127\|consensus		1238		98.84
KOG1129\|consensus		478		98.83
KOG1064\|consensus		2439		98.83
COG5170		460	CDC55 Serine/threonine protein phosphatase 2A, reg	98.83
KOG1156\|consensus		700		98.82
KOG0624\|consensus		504		98.81
KOG0280\|consensus		339		98.8
KOG3914\|consensus		390		98.8
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	98.78
COG3063		250	PilF Tfp pilus assembly protein PilF [Cell motilit	98.78
KOG1064\|consensus		2439		98.78
PRK04043		419	tolB translocation protein TolB; Provisional	98.75
PRK04841		903	transcriptional regulator MalT; Provisional	98.75
PRK04043		419	tolB translocation protein TolB; Provisional	98.73
KOG4190\|consensus		1034		98.73
KOG2376\|consensus		652		98.72
KOG4340\|consensus		459		98.72
PF12569		517	NARP1: NMDA receptor-regulated protein 1 ; InterPr	98.71
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	98.7
PRK12370		553	invasion protein regulator; Provisional	98.69
TIGR02521		234	type_IV_pilW type IV pilus biogenesis/stability pr	98.69
KOG1129\|consensus		478		98.69
PF14938		282	SNAP: Soluble NSF attachment protein, SNAP; PDB: 1	98.67
PF15492		282	Nbas_N: Neuroblastoma-amplified sequence, N termin	98.67
KOG4190\|consensus		1034		98.67
KOG4340\|consensus		459		98.67
PRK11189		296	lipoprotein NlpI; Provisional	98.67
PRK12370		553	invasion protein regulator; Provisional	98.65
COG3063		250	PilF Tfp pilus assembly protein PilF [Cell motilit	98.65
KOG1174\|consensus		564		98.64
KOG0882\|consensus		558		98.63
KOG0624\|consensus		504		98.62
PF14938		282	SNAP: Soluble NSF attachment protein, SNAP; PDB: 1	98.61
PF15492		282	Nbas_N: Neuroblastoma-amplified sequence, N termin	98.6
PRK11189		296	lipoprotein NlpI; Provisional	98.59
PF11768		545	DUF3312: Protein of unknown function (DUF3312); In	98.59
TIGR03300		377	assembly_YfgL outer membrane assembly lipoprotein	98.58
cd05804		355	StaR_like StaR_like; a well-conserved protein foun	98.57
KOG1125\|consensus		579		98.55
PF12569		517	NARP1: NMDA receptor-regulated protein 1 ; InterPr	98.53
COG5170		460	CDC55 Serine/threonine protein phosphatase 2A, reg	98.53
KOG0550\|consensus		486		98.52
PRK11138		394	outer membrane biogenesis protein BamB; Provisiona	98.51
KOG0309\|consensus		1081		98.5
KOG3914\|consensus		390		98.48
KOG3621\|consensus		726		98.47
KOG4649\|consensus		354		98.46
KOG4714\|consensus		319		98.45
PF07433		305	DUF1513: Protein of unknown function (DUF1513); In	98.44
KOG2695\|consensus		425		98.41
KOG0550\|consensus		486		98.38
COG3071		400	HemY Uncharacterized enzyme of heme biosynthesis [	98.35
PF00930		353	DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin	98.32
PF07433		305	DUF1513: Protein of unknown function (DUF1513); In	98.32
KOG2066\|consensus		846		98.31
KOG1128\|consensus		777		98.29
TIGR03302		235	OM_YfiO outer membrane assembly lipoprotein YfiO.	98.28
TIGR03302		235	OM_YfiO outer membrane assembly lipoprotein YfiO.	98.28
KOG1915\|consensus		677		98.28
KOG1897\|consensus		1096		98.27
PF13360		238	PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A	98.26
KOG1125\|consensus		579		98.24
KOG1128\|consensus		777		98.24
PRK11138		394	outer membrane biogenesis protein BamB; Provisiona	98.23
KOG4714\|consensus		319		98.2
PRK14720		906	transcript cleavage factor/unknown domain fusion p	98.2
PRK14720		906	transcript cleavage factor/unknown domain fusion p	98.16
COG3071		400	HemY Uncharacterized enzyme of heme biosynthesis [	98.16
PRK15179		694	Vi polysaccharide biosynthesis protein TviE; Provi	98.15
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	98.14
KOG3621\|consensus		726		98.14
KOG1586\|consensus		288		98.14
PF13360		238	PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A	98.14
PRK15179		694	Vi polysaccharide biosynthesis protein TviE; Provi	98.11
KOG1941\|consensus		518		98.11
cd05804		355	StaR_like StaR_like; a well-conserved protein foun	98.11
KOG0882\|consensus		558		98.09
KOG1941\|consensus		518		98.08
KOG1586\|consensus		288		98.08
KOG2695\|consensus		425		98.06
KOG1832\|consensus		1516		98.03
PRK10370		198	formate-dependent nitrite reductase complex subuni	98.01
COG0823		425	TolB Periplasmic component of the Tol biopolymer t	98.01
PF00930		353	DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin	97.98
PF04840		319	Vps16_C: Vps16, C-terminal region; InterPro: IPR00	97.98
KOG1645\|consensus		463		97.97
PF04840		319	Vps16_C: Vps16, C-terminal region; InterPro: IPR00	97.97
PF14583		386	Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C	97.91
KOG1832\|consensus		1516		97.91
PF00400		39	WD40: WD domain, G-beta repeat; InterPro: IPR01978	97.9
PF02897		414	Peptidase_S9_N: Prolyl oligopeptidase, N-terminal	97.9
KOG1275\|consensus		1118		97.9
PF11768		545	DUF3312: Protein of unknown function (DUF3312); In	97.87
KOG1275\|consensus		1118		97.86
KOG1915\|consensus		677		97.86
PF04733		290	Coatomer_E: Coatomer epsilon subunit; InterPro: IP	97.85
PRK15363		157	pathogenicity island 2 chaperone protein SscA; Pro	97.85
PRK15359		144	type III secretion system chaperone protein SscB;	97.84
PF04841		410	Vps16_N: Vps16, N-terminal region; InterPro: IPR00	97.84
PRK10370		198	formate-dependent nitrite reductase complex subuni	97.83
KOG2247\|consensus		615		97.82
KOG1585\|consensus		308		97.81
PRK15359		144	type III secretion system chaperone protein SscB;	97.79
KOG1585\|consensus		308		97.79
KOG1645\|consensus		463		97.78
COG4783		484	Putative Zn-dependent protease, contains TPR repea	97.76
COG5010		257	TadD Flp pilus assembly protein TadD, contains TPR	97.74
KOG0553\|consensus		304		97.74
COG0823		425	TolB Periplasmic component of the Tol biopolymer t	97.73
PF06433		342	Me-amine-dh_H: Methylamine dehydrogenase heavy cha	97.72
KOG2247\|consensus		615		97.72
KOG1008\|consensus		783		97.71
PRK15363		157	pathogenicity island 2 chaperone protein SscA; Pro	97.7
PF09976		145	TPR_21: Tetratricopeptide repeat; InterPro: IPR018	97.69
COG5010		257	TadD Flp pilus assembly protein TadD, contains TPR	97.69
PF04733		290	Coatomer_E: Coatomer epsilon subunit; InterPro: IP	97.68
COG3386		307	Gluconolactonase [Carbohydrate transport and metab	97.66
PF06977		248	SdiA-regulated: SdiA-regulated; InterPro: IPR00972	97.66
PF00400		39	WD40: WD domain, G-beta repeat; InterPro: IPR01978	97.64
PF04841		410	Vps16_N: Vps16, N-terminal region; InterPro: IPR00	97.62
PF06433		342	Me-amine-dh_H: Methylamine dehydrogenase heavy cha	97.62
PRK02888		635	nitrous-oxide reductase; Validated	97.61
KOG1008\|consensus		783		97.6
PRK13616		591	lipoprotein LpqB; Provisional	97.57
KOG4649\|consensus		354		97.53
TIGR02552		135	LcrH_SycD type III secretion low calcium response	97.52
COG4783		484	Putative Zn-dependent protease, contains TPR repea	97.51
PF09976		145	TPR_21: Tetratricopeptide repeat; InterPro: IPR018	97.49
PLN02789		320	farnesyltranstransferase	97.47
KOG0553\|consensus		304		97.45
PF14583		386	Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C	97.45
PF12895		84	Apc3: Anaphase-promoting complex, cyclosome, subun	97.44
PF13424		78	TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15	97.42
PF02897		414	Peptidase_S9_N: Prolyl oligopeptidase, N-terminal	97.4
COG3490		366	Uncharacterized protein conserved in bacteria [Fun	97.4
PLN02789		320	farnesyltranstransferase	97.38
PRK02888		635	nitrous-oxide reductase; Validated	97.36
PF08553		794	VID27: VID27 cytoplasmic protein; InterPro: IPR013	97.35
PF13424		78	TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15	97.34

>KOG3616\|consensus	Back alignment and domain information

Probab=100.00  E-value=6.3e-186  Score=1518.22  Aligned_cols=1331  Identities=40%  Similarity=0.703  Sum_probs=1237.5

Q ss_pred             CCCceeeecccCCcEEEEEEecCCCeEEEEeCCCcEEEEEecCCCCcccccccccccCCCCcEEEEecCCeEEEEecCCe
Q psy12802        121 KANKTQTLYASNSFVVALCLNVRGAGVLSGHADGSIVRYYVTEDASNFDQQQGRVVQHPVPPYALSWPAGYILAAGSDRI  200 (1637)
Q Consensus       121 ~~~~~~~~~~~~~~v~~l~~s~~g~~l~s~~~dg~i~iwd~~~~~~g~~~~~~~~~~~~~~v~~~~~~~~~l~~~~~d~~  200 (1637)
                      +|..+...+..+..++++.-+|.|+.+++++.||+|++|++...      ....+.....|...+.|....+++.++|+.
T Consensus         3 kt~~~s~~~k~~e~~~aiqshp~~~s~v~~~~d~si~lfn~~~r------~qski~~~~~p~~nlv~tnhgl~~~tsdrr   76 (1636)
T KOG3616|consen    3 KTFDCSRDPKEDEFTTAIQSHPGGQSFVLAHQDGSIILFNFIPR------RQSKICEEAKPKENLVFTNHGLVTATSDRR   76 (1636)
T ss_pred             ccccccCCccccceeeeeeecCCCceEEEEecCCcEEEEeeccc------chhhhhhhcCCccceeeeccceEEEeccch
Confidence            34555556666778899999999999999999999999998763      334455566778888898878899999999


Q ss_pred             EEEEeCCCceeEEeeccCCCCCCccEEEEEECCCCCEEEEEecCcEEEEEeCCCCCccccCCCcccCCCcceeEEEEcCC
Q psy12802        201 VTIYESDGRVHRIFDYTAPHYKEREFTVACSSPSGQAVVVGSYDNIKLFAWSPSKSVWEEQPNKTIPNLYTISALSWKRD  280 (1637)
Q Consensus       201 i~iwd~~~~~~~~~~~~~~~~~~~~i~~~~~sp~g~~l~~~~~d~i~i~~~~~~~~~~~~~~~~~~~~~~~i~~l~~spd  280 (1637)
                      +.-|..+|-..++|++...  ....++++                                              ...|.
T Consensus        77 ~la~~~dgvvqqqfdyndq--sekefss~----------------------------------------------~cdpt  108 (1636)
T KOG3616|consen   77 ALAWKEDGVVQQQFDYNDQ--SEKEFSSI----------------------------------------------LCDPT  108 (1636)
T ss_pred             hheeeccCcchhhccccch--hhhhccce----------------------------------------------ecCch
Confidence            9999999988888876422  12222222                                              22233


Q ss_pred             CCEEEEEecCCcEEEEEccccceeeeCcEEEEEecCCeEEEecCCCCCCCceeEEecccCceeeEEEEecCceEEEEeCC
Q psy12802        281 GSRIACGGLCGSVELFESVLKRTIWKGKFEMIYVSPSQVLVKPLSGESKGRGVILKSQYGYEITDVAIMGNDRYLVARTP  360 (1637)
Q Consensus       281 g~~l~~~~~dg~v~iwd~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~i~~v~~s~~~~~lv~~~~  360 (1637)
                      .+ =++|+.+|.|.-+|++.++.+++++|+.+|++|+++++++++++   ++..+.++.|+.|..+.+.+.++|+++.++
T Consensus       109 aq-nvvgtlcggv~q~dcclrr~i~knkfe~tyv~pshvilkdlsn~---trt~l~s~~g~aidelkilgkdryli~~ts  184 (1636)
T KOG3616|consen  109 AQ-NVVGTLCGGVEQFDCCLRRGILKNKFELTYVAPSHVILKDLSND---TRTNLISHKGLAIDELKILGKDRYLIAHTS  184 (1636)
T ss_pred             hh-hhhhhhccceeeehHHHHhHHHhccceeEEeccceeeeecccCC---ceEeeeecCCcchhhhhhccccceEEeecc
Confidence            22 24577788999999999999999999999999999999999999   899999999999999999999999999999


Q ss_pred             CcEEEeeccccceeeeecCCCCCCceeEecCceEEEEEeCCccEEEEecCCceeeeeeeeeeccCCCCcccccCCCccCC
Q psy12802        361 DTLLLGDLHRNLLSEVLWPDSGRNEKFYFDNVTVCLVFNAGELSIIEYGNNEILTCVSIKLFAWSPSKSVWEEQPNKTIP  440 (1637)
Q Consensus       361 ~~i~i~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~i~~~~~~~~~~~w~~~~~~~~~  440 (1637)
                      .+|.+-|+.+++.+++.|+.+||+++|+|+.++.|++|+.|+++++.++.+..+|                         
T Consensus       185 ~siii~d~es~rfsei~wqgsgg~ekfffd~~n~cli~nageltlveyg~d~slg-------------------------  239 (1636)
T KOG3616|consen  185 ESIIIADLESNRFSEIAWQGSGGHEKFFFDFENCCLIFNAGELTLVEYGNDDSLG-------------------------  239 (1636)
T ss_pred             ccEEEeecccchhhhhhcccCCCcceeeeecCcEEEEEecCeeEEEEecCCCcch-------------------------
Confidence            9999999999999999999999999999999999999999999999999988775                         


Q ss_pred             CcceeeeeeeccCCCeEEeeccCCcEEEehhhhhhhhhcCceeEEEecCCceEEeeccCCCCCceeEEeeccceeeeeEE
Q psy12802        441 NLYTISALSWKRDGSRIACGGLCGSVELFESVLKRTIWKGKFEMIYVSPSQVLVKPLSGESKGRGVILKSQYGYEITDVA  520 (1637)
Q Consensus       441 ~~~~I~~l~~s~dg~~la~g~~dg~v~lw~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~l~~~~~~~~~~i~  520 (1637)
                                              +|                                                      
T Consensus       240 ------------------------~v------------------------------------------------------  241 (1636)
T KOG3616|consen  240 ------------------------SV------------------------------------------------------  241 (1636)
T ss_pred             ------------------------hh------------------------------------------------------
Confidence                                    11                                                      


Q ss_pred             EecCcceEeeccccccccCccccccccccccccc----c-cCCCceEEEe------------------------------
Q psy12802        521 IMGNDRYLVARTLLTEFMNPHLISVRLNERKQVH----S-QQENKKLAYL------------------------------  565 (1637)
Q Consensus       521 i~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~----~-s~d~~~la~~------------------------------  565 (1637)
                                   +|++++||++++++.+.+...    | |.|++.++..                              
T Consensus       242 -------------rte~~nphlisvqike~~qksygrnfdse~n~~~a~~~di~tgqicvfsdflqrrtssvffiikaka  308 (1636)
T KOG3616|consen  242 -------------RTEFMNPHLISVQIKEACQKSYGRNFDSEDNKKLAEHIDIKTGQICVFSDFLQRRTSSVFFIIKAKA  308 (1636)
T ss_pred             -------------hhhhcCceeeehHHHHHHHHhhCCCCCcchhhhHHHHhccccCceeeehhhhhhccccceeeehhhh
Confidence                         222222222222222211110    0 1111111111                              


Q ss_pred             -----eccceEEE-EEccCCcceEEecccCCccEEEeCcCcceeEeecccceEEEEeccccceeeecccceEEEEecCCc
Q psy12802        566 -----LDLHTICV-IDLITNLPTLHINHDSKIDWLELNETAHKLLYRDKKMRLTLLDIRTSEKHNILNYCTFVQWLPGSD  639 (1637)
Q Consensus       566 -----~~~~~i~v-~dl~~~~~~~~~~~~~~i~~l~~s~~g~~L~~~~~~~~~~l~d~~t~~~~~l~~~~~~v~w~~~~~  639 (1637)
                           ..-..|.| .|+.+|...+.++|.+.|+|+.++..+.+|++++++..++++|+.+.+..-+.++|++++|.|.++
T Consensus       309 kifndlqlphi~ipvdli~g~~~~~inh~~~vdwielne~~~kllfrdkk~kl~l~di~s~qksmilnfcsymqwvp~sd  388 (1636)
T KOG3616|consen  309 KIFNDLQLPHIAIPVDLIGGQNEGFINHEGAVDWIELNERAHKLLFRDKKLKLHLVDIESCQKSMILNFCSYMQWVPGSD  388 (1636)
T ss_pred             hhcccccCcceeeeeecccCcccccccccccccceeccchhhhhhcccccceeEEEEcccchHHHHHHHhhhheeccCcc
Confidence                 11234555 788899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeEeccccceeEEEecCCCCceeeecccCceEEEEecCCceEEEeccCCccccccchhhhhhhhcccccccHHHHHHHHH
Q psy12802        640 VVVAQSRHNACVWYNIDTPDRITQFPVRGDIIDVIRENGQSEILTQDGNHQLGYELDESLIEFGTAVHDSDFGKAILYLE  719 (1637)
Q Consensus       640 ~l~~~~~~~l~v~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~A~~~~~  719 (1637)
                      ++|+++++++||||+++.|+.+|++.++|+|+.++++.++++++|.++...+.|.+|+.+++|++++++|+|++|..|++
T Consensus       389 vivaqn~dnl~iwyn~d~peqvt~~kikgdv~~l~r~~~kteviv~e~takvayeld~~~iefgaaid~~df~ra~afle  468 (1636)
T KOG3616|consen  389 VIVAQNGDNLCIWYNIDAPEQVTMFKIKGDVEALERDADKTEVIVMEGTAKVAYELDEGLIEFGAAIDDGDFDRATAFLE  468 (1636)
T ss_pred             eEEecCCCceEEEecCCcchhheeeEecccchhhhcCCCceeEEEeecceeEEEEecCcceecccccccCchHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HcCCChhhHHHHHHHHHHHHHHhcCHhHHHHHHHhhcCcchhHHHHHHhhhhhhhhcccCCCCCCchHHHHHHHHHHhcC
Q psy12802        720 SLGINKKEAEGMWQNLAEVAIQLHNLHVAEICYAALGDISTTHFLRETIKIGEVWSKENNIGDPLQCPELWARMAILNKQ  799 (1637)
Q Consensus       720 ~~~~~~~~~~~~w~~l~~~~l~~~~~~~A~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~a~~a~~~~~  799 (1637)
                      .+++.| ++++||..+++++++.+++.+|+|||+++|++.+++||+.+.+|+|+.+.+. +++|++.|.+++.++++.++
T Consensus       469 s~~~~~-da~amw~~laelale~~nl~iaercfaai~dvak~r~lhd~~eiadeas~~~-ggdgt~fykvra~lail~kk  546 (1636)
T KOG3616|consen  469 SLEMGP-DAEAMWIRLAELALEAGNLFIAERCFAAIGDVAKARFLHDILEIADEASIEI-GGDGTDFYKVRAMLAILEKK  546 (1636)
T ss_pred             hhccCc-cHHHHHHHHHHHHHHhccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHhh-CCCCchHHHHHHHHHHHHhh
Confidence            999998 9999999999999999999999999999999999999999999999998887 99999999999999999999


Q ss_pred             HHHHHHHHHhcCcHHHHHHHHHHcCCHHHHHHHHHhcCc-chHHHHHHHHHHHHhcccHHHHHHHHHHcCCHHHHHHHHH
Q psy12802        800 FKVAEGIYLENNEIHKAIDMYLKLYKWEDALSLAETNNY-EYNELKKKYIKWLTDTRQEDKAGELYEKEGDHQTALNYYL  878 (1637)
Q Consensus       800 ~~~A~~~~~~~~~~~~a~~~~~~l~~~~~a~~~~~~~~~-~~~~~~~~~~~~l~~~~~~~~A~~~~~~~g~~~~Ai~~y~  878 (1637)
                      |++|+.+|++++..++|+.||+.+++||+|+.+++..++ ..+.+++.|+++|+++||.++|+++.+..||--.||.+|.
T Consensus       547 fk~ae~ifleqn~te~aigmy~~lhkwde~i~lae~~~~p~~eklk~sy~q~l~dt~qd~ka~elk~sdgd~laaiqlyi  626 (1636)
T KOG3616|consen  547 FKEAEMIFLEQNATEEAIGMYQELHKWDEAIALAEAKGHPALEKLKRSYLQALMDTGQDEKAAELKESDGDGLAAIQLYI  626 (1636)
T ss_pred             hhHHHHHHHhcccHHHHHHHHHHHHhHHHHHHHHHhcCChHHHHHHHHHHHHHHhcCchhhhhhhccccCccHHHHHHHH
Confidence            999999999999999999999999999999999999999 8899999999999999999999999999999999999999


Q ss_pred             HhCCHHHHHHHHHcCCCCCCCHHHHHHHHHHHHhCCcHHHHHHHHHHcCCHHHHHHHHHhCCChHHHHHHHHHhCCCChH
Q psy12802        879 KANFTSKACNLVQNEPYLLENHDVVSQIVKGLIKNESYIKAGQIYEFTNENEKALECYRKGKVYDKCIDLTRKINPKNVT  958 (1637)
Q Consensus       879 ~~~~~~~a~~l~~~~~~~~~~~~~~~~~~~~l~~~g~~~~A~~~~~~~~~~~~a~~~y~~~~~~~~A~~l~~~~~~~~~~  958 (1637)
                      |+|+|.+|++++.....+..+.+++..++..|.+...|++||.+|++..++++|++||.++..|.+|++|++-..|.+++
T Consensus       627 ka~~p~~a~~~a~n~~~l~~de~il~~ia~alik~elydkagdlfeki~d~dkale~fkkgdaf~kaielarfafp~evv  706 (1636)
T KOG3616|consen  627 KAGKPAKAARAALNDEELLADEEILEHIAAALIKGELYDKAGDLFEKIHDFDKALECFKKGDAFGKAIELARFAFPEEVV  706 (1636)
T ss_pred             HcCCchHHHHhhcCHHHhhccHHHHHHHHHHHHhhHHHHhhhhHHHHhhCHHHHHHHHHcccHHHHHHHHHHhhCcHHHh
Confidence            99999999999998888889999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhcccHHHHHHHHHHhCChHHHHHHHHHccCHHHHHHHHHhhccccchHHHHHHHHHHHHHhCCHHHHHH
Q psy12802        959 ALEEEWGDHLIENKQYNAAINHYIEAGKNNKALDTSIKAKQWKKAVQILQVITNKQDIAQHVKTLAQHFKTVKDYKTAEK 1038 (1637)
Q Consensus       959 ~l~~~~~~~l~~~~~~~~A~~~~~~~~~~~~ai~~~~~~~~~~~A~~l~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~ 1038 (1637)
                      .+.+.||+.+.++||++.|+++|.++.+..+|+++.+.+++|.||+.+++.+.+......+|-.+|++|...|+|+.|++
T Consensus       707 ~lee~wg~hl~~~~q~daainhfiea~~~~kaieaai~akew~kai~ildniqdqk~~s~yy~~iadhyan~~dfe~ae~  786 (1636)
T KOG3616|consen  707 KLEEAWGDHLEQIGQLDAAINHFIEANCLIKAIEAAIGAKEWKKAISILDNIQDQKTASGYYGEIADHYANKGDFEIAEE  786 (1636)
T ss_pred             hHHHHHhHHHHHHHhHHHHHHHHHHhhhHHHHHHHHhhhhhhhhhHhHHHHhhhhccccccchHHHHHhccchhHHHHHH
Confidence            99999999999999999999999999999999999999999999999999988877667789999999999999999999


Q ss_pred             HHHhccCHHHHHHHHHHcCCHHHHHHHHHhhcChhhHHHHHHHHHHHHHHcCCHHHHHHHHHHhCCchHHHHHHHhcCCH
Q psy12802       1039 IYSHCDMHEQIVDMYHQTGQWEKAYAIAEQHLNVGEIKATFIQKCKQLEEENKFKEAERLYLIIGEPDLAISMFKNQRQY 1118 (1637)
Q Consensus      1039 ~~~~~~~~~~~~~~y~~~g~~~~A~~~~~~~~~~~~~~~~~~~~a~~~~~~g~~~~A~~~y~~~~~~~~ai~~~~~~~~~ 1118 (1637)
                      +|.+++.++.||+||.++|+|++|++++++...+......|...|.-+.++|+|.+|+++|...|.|++||.||.+.|.+
T Consensus       787 lf~e~~~~~dai~my~k~~kw~da~kla~e~~~~e~t~~~yiakaedldehgkf~eaeqlyiti~~p~~aiqmydk~~~~  866 (1636)
T KOG3616|consen  787 LFTEADLFKDAIDMYGKAGKWEDAFKLAEECHGPEATISLYIAKAEDLDEHGKFAEAEQLYITIGEPDKAIQMYDKHGLD  866 (1636)
T ss_pred             HHHhcchhHHHHHHHhccccHHHHHHHHHHhcCchhHHHHHHHhHHhHHhhcchhhhhheeEEccCchHHHHHHHhhCcc
Confidence            99999999999999999999999999999988888888999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhCCCchHHHHHHHHHHHHHccCHHHHHHHHHHccCHHHHHHHHHhcCCHHHHHHHHHhcCCccchHHHHHH
Q psy12802       1119 ENMIKLVRNYHPDLLDTTLLHLAQECEESKNYKQAEKYYLDCNEWKLAIKMYRSLNLWEDAYRIALSNGGQEAVEPVVYL 1198 (1637)
Q Consensus      1119 ~~a~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~y~~a~~~~~~~~~y~~~g~~~~A~~~~~~~~~~~~~~~l~~~ 1198 (1637)
                      +++++++++++++.+.+++.++|..|+..|++++|+.+|.+|++|..+++||...+.|++|+|+++..++.++.+++++.
T Consensus       867 ddmirlv~k~h~d~l~dt~~~f~~e~e~~g~lkaae~~flea~d~kaavnmyk~s~lw~dayriaktegg~n~~k~v~fl  946 (1636)
T KOG3616|consen  867 DDMIRLVEKHHGDHLHDTHKHFAKELEAEGDLKAAEEHFLEAGDFKAAVNMYKASELWEDAYRIAKTEGGANAEKHVAFL  946 (1636)
T ss_pred             hHHHHHHHHhChhhhhHHHHHHHHHHHhccChhHHHHHHHhhhhHHHHHHHhhhhhhHHHHHHHHhccccccHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhcCcchHHHHHHHhccHHHHHHHHHhcCChHHHHHHHHhcCCCCcHHHHHHHHHHHHhCCChHHHHHHH--------
Q psy12802       1199 WAKSLGGDSAVRLLNRLSLLESCISNACDTYQFDFAFELAKIGMKSKLEEVHYKYALVLEDNGQFNEAETQF-------- 1270 (1637)
Q Consensus      1199 ~~~~~~~~~A~~~~~~~~~~~~~i~~~~~~~~~~~a~~l~~~~~~~~~~~~~~~~a~~~~~~g~~~~A~~~~-------- 1270 (1637)
                      |+++-..+.|++++++.|.++.+|+++++.+.||.|++|++.+.+++++++|+++|+.++++|++++|-++|        
T Consensus       947 waksiggdaavkllnk~gll~~~id~a~d~~afd~afdlari~~k~k~~~vhlk~a~~ledegk~edaskhyveaiklnt 1026 (1636)
T KOG3616|consen  947 WAKSIGGDAAVKLLNKHGLLEAAIDFAADNCAFDFAFDLARIAAKDKMGEVHLKLAMFLEDEGKFEDASKHYVEAIKLNT 1026 (1636)
T ss_pred             HHHhhCcHHHHHHHHhhhhHHHHhhhhhcccchhhHHHHHHHhhhccCccchhHHhhhhhhccchhhhhHhhHHHhhccc
Confidence            999999999999999999999999999999999999999999999999999999999999999999995554        


Q ss_pred             -----------------HHcC-ChHHHHHHHHhcCCHHHHHHHHhhhCCCChHHHHHHhHHHHHhcCChhhHHHHHHHhC
Q psy12802       1271 -----------------IKAN-KPKEAISMYIHNQDWENAERIANEHDPTSIGDILLNQSKCEFENENFSKFETLLLRAH 1332 (1637)
Q Consensus      1271 -----------------~~a~-~~~~ai~~~~~~~~~~~a~~~a~~~~~~~~~~~~~~~a~~~~~~~~~~~A~~~~~~a~ 1332 (1637)
                                       .++| +|++|+.|+.+.++|++|.||++.|.++.+++++..+++...++|++.+|+.++.+++
T Consensus      1027 ynitwcqavpsrfd~e~ir~gnkpe~av~mfi~dndwa~aervae~h~~~~l~dv~tgqar~aiee~d~~kae~fllran 1106 (1636)
T KOG3616|consen 1027 YNITWCQAVPSRFDAEFIRAGNKPEEAVEMFIHDNDWAAAERVAEAHCEDLLADVLTGQARGAIEEGDFLKAEGFLLRAN 1106 (1636)
T ss_pred             ccchhhhcccchhhHHHHHcCCChHHHHHHhhhcccHHHHHHHHHhhChhhhHHHHhhhhhccccccchhhhhhheeecC
Confidence                             4556 8999999999999999999999999999999999999999999999999999999999


Q ss_pred             ChHHHHHHHHHcCChHHHHHHHhhhCCCChhHHHHHHHHHHhcccccchHHHHHHHHHHHHcCCHHHHHHHHHhcCCcch
Q psy12802       1333 KVDLIIEKYKMNHMWNDALRVCGEYVPSKLPLLQQEYEKEINTNISKDIHSLITQARQWEQNGEFYNAVECYLKIKNVDV 1412 (1637)
Q Consensus      1333 ~~~~a~~~y~~~~~~~~Al~~~~~~~p~~~~~l~~~~~~~~~~~~~~~~~~~~~~a~~~~~~g~~~~A~~~~~~~~~~~~ 1412 (1637)
                      +|+.++++|.++++|.+|+|+++.|+|+....++++|++...+++.+....+..+|+.|+++|+|.+|+++|+|+.+..+
T Consensus      1107 kp~i~l~yf~e~~lw~dalri~kdylp~q~a~iqeeyek~~~k~gargvd~fvaqak~weq~gd~rkav~~~lkinrdst 1186 (1636)
T KOG3616|consen 1107 KPDIALNYFIEAELWPDALRIAKDYLPHQAAAIQEEYEKEALKKGARGVDGFVAQAKEWEQAGDWRKAVDALLKINRDST 1186 (1636)
T ss_pred             CCchHHHHHHHhccChHHHHHHHhhChhHHHHHHHHHHHHHHhccccccHHHHHHHHHHHhcccHHHHHHHHhhhccCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999977665


Q ss_pred             ---hHHHHHHHHHHHHHHhccCccchhhhhhhhhhhhhhccCHHHHHHHHhcccchHHHHHHHHhccchHHHHHHHHhhC
Q psy12802       1413 ---NLMVKILNEVTQLTLKYLNHDQSYKILPSLVPKLMEFKQYDLAVRVYLNIDMVKEAVDIFIYTQNWNKARKLCAELK 1489 (1637)
Q Consensus      1413 ---~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~A~~~y~~~~~~~~a~~~~~~~~~~~~a~~~a~~~~ 1489 (1637)
                         ...+.+|++|.++..+|+++++..+++...+..|.+.|.++.|+++|+..+..++||++++++++|.+|+++|+++.
T Consensus      1187 ~nd~l~e~~~~kaadl~ikfl~~d~nme~i~aa~~al~~~~~~e~aael~l~f~~~keaida~~~~eewakakqvake~~ 1266 (1636)
T KOG3616|consen 1187 DNDALAEHCTEKAADLSIKFLMGDENMEVIGAAGGALDEAGCHEAAAELLLLFDLSKEAIDAFCEAEEWAKAKQVAKELD 1266 (1636)
T ss_pred             CcHHHHHHHHHHHHhhhhhhcCCccchhhHHhcchhhhcccccHHHHHHHHHhhhHHHHHHHHHhHHHHHHHHHHHHHhC
Confidence               47889999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cchHHHHHHHHHHHHHhcCCCccccccCHHHHHHHHHHcccHHHHHHHHHhhChh-hHHHHHHHHHHHHHhcCCHHHHHH
Q psy12802       1490 PEYLSYVENQYKEWLKKNGDADMLSEIDINTALDMLMKQGQWNQCLDKAKNINTN-LLHKYMALYAMHLIKNKEYAQLTQ 1568 (1637)
Q Consensus      1490 ~~~~~~~~~~~~~~l~~~~~~~~~~~~d~~~a~~~~~~~~~~~~a~~~a~~~~~~-~~~~~~~~~~~~~~~~~~~~~a~~ 1568 (1637)
                      |++.++++..|++.|+++|+.++++++|+..|||+|++++||+||+++|.+++.+ .|++||++|+.+|+++|+..+|+.
T Consensus      1267 p~~~~~idk~yke~lknegkl~eli~vdviaaidl~ien~qwdk~idtak~qnykpil~kyva~yaa~li~~~d~aq~la 1346 (1636)
T KOG3616|consen 1267 PEMEDEIDKHYKEFLKNEGKLDELIDVDVIAAIDLMIENDQWDKAIDTAKKQNYKPILDKYVALYAAHLIHEGDLAQALA 1346 (1636)
T ss_pred             chhhHHHHHHHHHHHhccCccccccchhHHHHHHHHHhcccHHHHHHHHHhcccHHHHHHHHHHHHHHHHhcCcHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999998 899999999999999999999999


Q ss_pred             HHHHcCCCCCchhHHHHHHHHHHHhcCCCc----chHHHHHHHHHHHHHHHhhcccchhhhhh
Q psy12802       1569 LFNEYGTPNIPQFYNIYKQTAYCILNDSNE----NVNLIISLRNMLFNVIKNQNNNEEIDKQY 1627 (1637)
Q Consensus      1569 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1627 (1637)
                      +|.|||+|++|+||+||+.|+.++++.|..    .|..|++||+++++|+++|++.+|++.+-
T Consensus      1347 l~~q~ga~anpanfniyk~i~ed~lakpgt~~~eay~e~a~lrdv~~dl~~al~keseans~~ 1409 (1636)
T KOG3616|consen 1347 LLEQHGAPANPANFNIYKLIFEDMLAKPGTNCAEAYHEIADLRDVHFDLCEALQKESEANSEA 1409 (1636)
T ss_pred             HHHHhCCCCCcccccHHHHHHHHHhcCCCcchHHHHHHHHHHHHHHHHHHHHHHhhhccCChH
Confidence            999999999999999999999999999866    49999999999999999999999988664

>KOG3616\|consensus	Back alignment and domain information

>KOG3617\|consensus	Back alignment and domain information

>KOG1538\|consensus	Back alignment and domain information

>KOG2041\|consensus	Back alignment and domain information

>KOG0318\|consensus	Back alignment and domain information

>KOG0292\|consensus	Back alignment and domain information

>KOG0276\|consensus	Back alignment and domain information

>KOG0271\|consensus	Back alignment and domain information

>KOG0291\|consensus	Back alignment and domain information

>KOG0271\|consensus	Back alignment and domain information

>KOG0319\|consensus	Back alignment and domain information

>KOG1524\|consensus	Back alignment and domain information

>KOG0319\|consensus	Back alignment and domain information

>KOG0276\|consensus	Back alignment and domain information

>KOG0318\|consensus	Back alignment and domain information

>KOG0291\|consensus	Back alignment and domain information

>KOG0306\|consensus	Back alignment and domain information

>KOG0306\|consensus	Back alignment and domain information

>KOG1538\|consensus	Back alignment and domain information

>KOG0272\|consensus	Back alignment and domain information

>KOG0286\|consensus	Back alignment and domain information

>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>KOG0292\|consensus	Back alignment and domain information

>KOG3617\|consensus	Back alignment and domain information

>KOG0272\|consensus	Back alignment and domain information

>KOG0279\|consensus	Back alignment and domain information

>KOG0273\|consensus	Back alignment and domain information

>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>KOG0284\|consensus	Back alignment and domain information

>KOG0273\|consensus	Back alignment and domain information

>KOG0286\|consensus	Back alignment and domain information

>KOG0279\|consensus	Back alignment and domain information

>KOG0645\|consensus	Back alignment and domain information

>KOG2048\|consensus	Back alignment and domain information

>KOG1408\|consensus	Back alignment and domain information

>KOG0296\|consensus	Back alignment and domain information

>KOG0295\|consensus	Back alignment and domain information

>KOG0985\|consensus	Back alignment and domain information

>KOG0284\|consensus	Back alignment and domain information

>KOG2106\|consensus	Back alignment and domain information

>KOG0645\|consensus	Back alignment and domain information

>KOG1539\|consensus	Back alignment and domain information

>KOG0315\|consensus	Back alignment and domain information

>KOG2041\|consensus	Back alignment and domain information

>KOG0263\|consensus	Back alignment and domain information

>KOG0285\|consensus	Back alignment and domain information

>KOG0285\|consensus	Back alignment and domain information

>KOG0265\|consensus	Back alignment and domain information

>KOG0275\|consensus	Back alignment and domain information

>KOG0315\|consensus	Back alignment and domain information

>KOG1063\|consensus	Back alignment and domain information

>KOG0265\|consensus	Back alignment and domain information

>KOG1063\|consensus	Back alignment and domain information

>PLN03077 Protein ECB2; Provisional	Back alignment and domain information

>KOG2048\|consensus	Back alignment and domain information

>KOG0296\|consensus	Back alignment and domain information

>KOG1408\|consensus	Back alignment and domain information

>PLN03077 Protein ECB2; Provisional	Back alignment and domain information

>KOG0316\|consensus	Back alignment and domain information

>KOG1539\|consensus	Back alignment and domain information

>KOG0293\|consensus	Back alignment and domain information

>KOG0266\|consensus	Back alignment and domain information

>PLN00181 protein SPA1-RELATED; Provisional	Back alignment and domain information

>KOG0295\|consensus	Back alignment and domain information

>KOG0282\|consensus	Back alignment and domain information

>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto

Back alignment and domain information

>KOG0282\|consensus	Back alignment and domain information

>KOG0293\|consensus	Back alignment and domain information

>KOG0263\|consensus	Back alignment and domain information

>KOG0281\|consensus	Back alignment and domain information

>KOG0281\|consensus	Back alignment and domain information

>KOG0640\|consensus	Back alignment and domain information

>KOG0266\|consensus	Back alignment and domain information

>KOG0643\|consensus	Back alignment and domain information

>PRK11447 cellulose synthase subunit BcsC; Provisional	Back alignment and domain information

>KOG0278\|consensus	Back alignment and domain information

>PLN00181 protein SPA1-RELATED; Provisional	Back alignment and domain information

>KOG0305\|consensus	Back alignment and domain information

>KOG0316\|consensus	Back alignment and domain information

>KOG0313\|consensus	Back alignment and domain information

>KOG4626\|consensus	Back alignment and domain information

>KOG0299\|consensus	Back alignment and domain information

Back alignment and domain information

>KOG2106\|consensus	Back alignment and domain information

>KOG0277\|consensus	Back alignment and domain information

>PRK11447 cellulose synthase subunit BcsC; Provisional	Back alignment and domain information

>KOG1407\|consensus	Back alignment and domain information

>KOG0275\|consensus	Back alignment and domain information

>KOG0643\|consensus	Back alignment and domain information

>KOG1524\|consensus	Back alignment and domain information

>KOG0278\|consensus	Back alignment and domain information

>KOG1407\|consensus	Back alignment and domain information

>KOG0288\|consensus	Back alignment and domain information

>KOG0313\|consensus	Back alignment and domain information

>KOG1920\|consensus	Back alignment and domain information

>KOG0973\|consensus	Back alignment and domain information

>KOG0310\|consensus	Back alignment and domain information

>KOG0310\|consensus	Back alignment and domain information

>KOG1036\|consensus	Back alignment and domain information

>KOG0647\|consensus	Back alignment and domain information

>KOG0772\|consensus	Back alignment and domain information

>KOG0288\|consensus	Back alignment and domain information

>KOG0772\|consensus	Back alignment and domain information

>KOG0283\|consensus	Back alignment and domain information

>KOG1446\|consensus	Back alignment and domain information

>KOG0300\|consensus	Back alignment and domain information

>KOG4626\|consensus	Back alignment and domain information

>KOG0640\|consensus	Back alignment and domain information

>KOG1446\|consensus	Back alignment and domain information

>KOG0299\|consensus	Back alignment and domain information

>KOG0641\|consensus	Back alignment and domain information

>KOG2096\|consensus	Back alignment and domain information

>PTZ00421 coronin; Provisional	Back alignment and domain information

>KOG0283\|consensus	Back alignment and domain information

>KOG0641\|consensus	Back alignment and domain information

>KOG0639\|consensus	Back alignment and domain information

>KOG0289\|consensus	Back alignment and domain information

>KOG1274\|consensus	Back alignment and domain information

>KOG0277\|consensus	Back alignment and domain information

>PLN03218 maturation of RBCL 1; Provisional	Back alignment and domain information

>KOG1332\|consensus	Back alignment and domain information

>KOG1332\|consensus	Back alignment and domain information

>PTZ00420 coronin; Provisional	Back alignment and domain information

>KOG0308\|consensus	Back alignment and domain information

>KOG0268\|consensus	Back alignment and domain information

>KOG0301\|consensus	Back alignment and domain information

>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional	Back alignment and domain information

>KOG0305\|consensus	Back alignment and domain information

>KOG0647\|consensus	Back alignment and domain information

>KOG0268\|consensus	Back alignment and domain information

>PLN03218 maturation of RBCL 1; Provisional	Back alignment and domain information

>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional	Back alignment and domain information

>PTZ00421 coronin; Provisional	Back alignment and domain information

>KOG0274\|consensus	Back alignment and domain information

>KOG0301\|consensus	Back alignment and domain information

>KOG0294\|consensus	Back alignment and domain information

>KOG0274\|consensus	Back alignment and domain information

>KOG0308\|consensus	Back alignment and domain information

>KOG0973\|consensus	Back alignment and domain information

>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation []	Back alignment and domain information

>KOG2096\|consensus	Back alignment and domain information

>KOG0300\|consensus	Back alignment and domain information

>PTZ00420 coronin; Provisional	Back alignment and domain information

>KOG0639\|consensus	Back alignment and domain information

>KOG1036\|consensus	Back alignment and domain information

>KOG1274\|consensus	Back alignment and domain information

>KOG1920\|consensus	Back alignment and domain information

>KOG1445\|consensus	Back alignment and domain information

>KOG2055\|consensus	Back alignment and domain information

>KOG0289\|consensus	Back alignment and domain information

>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional	Back alignment and domain information

>KOG4283\|consensus	Back alignment and domain information

>KOG0294\|consensus	Back alignment and domain information

>KOG1445\|consensus	Back alignment and domain information

>KOG0264\|consensus	Back alignment and domain information

>KOG0269\|consensus	Back alignment and domain information

>KOG2055\|consensus	Back alignment and domain information

>KOG0646\|consensus	Back alignment and domain information

>KOG4283\|consensus	Back alignment and domain information

>KOG0264\|consensus	Back alignment and domain information

>KOG2445\|consensus	Back alignment and domain information

>KOG2445\|consensus	Back alignment and domain information

>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional	Back alignment and domain information

>KOG1273\|consensus	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>KOG4328\|consensus	Back alignment and domain information

>KOG1273\|consensus	Back alignment and domain information

>KOG1963\|consensus	Back alignment and domain information

>KOG4328\|consensus	Back alignment and domain information

>KOG2002\|consensus	Back alignment and domain information

>KOG4497\|consensus	Back alignment and domain information

>KOG0307\|consensus	Back alignment and domain information

>KOG0650\|consensus	Back alignment and domain information

>KOG0267\|consensus	Back alignment and domain information

>KOG0269\|consensus	Back alignment and domain information

>KOG0270\|consensus	Back alignment and domain information

>KOG0302\|consensus	Back alignment and domain information

>KOG0321\|consensus	Back alignment and domain information

>KOG0646\|consensus	Back alignment and domain information

>KOG0267\|consensus	Back alignment and domain information

>KOG2919\|consensus	Back alignment and domain information

>KOG1034\|consensus	Back alignment and domain information

>KOG1963\|consensus	Back alignment and domain information

>KOG0650\|consensus	Back alignment and domain information

>KOG0302\|consensus	Back alignment and domain information

>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70)	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>KOG1009\|consensus	Back alignment and domain information

>KOG0321\|consensus	Back alignment and domain information

>KOG4497\|consensus	Back alignment and domain information

>KOG4378\|consensus	Back alignment and domain information

>KOG0270\|consensus	Back alignment and domain information

>KOG1009\|consensus	Back alignment and domain information

>KOG2002\|consensus	Back alignment and domain information

>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70)	Back alignment and domain information

>KOG2919\|consensus	Back alignment and domain information

>KOG0307\|consensus	Back alignment and domain information

>KOG0290\|consensus	Back alignment and domain information

>KOG4378\|consensus	Back alignment and domain information

>KOG1188\|consensus	Back alignment and domain information

>KOG4227\|consensus	Back alignment and domain information

>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation []	Back alignment and domain information

>COG2319 FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>KOG2076\|consensus	Back alignment and domain information

>PRK15174 Vi polysaccharide export protein VexE; Provisional	Back alignment and domain information

>KOG1517\|consensus	Back alignment and domain information

>KOG1587\|consensus	Back alignment and domain information

>KOG1034\|consensus	Back alignment and domain information

>KOG1007\|consensus	Back alignment and domain information

>KOG0642\|consensus	Back alignment and domain information

>KOG0290\|consensus	Back alignment and domain information

>KOG0303\|consensus	Back alignment and domain information

>COG5290 IkappaB kinase complex, IKAP component [Transcription]	Back alignment and domain information

>KOG1523\|consensus	Back alignment and domain information

>PRK15174 Vi polysaccharide export protein VexE; Provisional	Back alignment and domain information

>PRK10049 pgaA outer membrane protein PgaA; Provisional	Back alignment and domain information

>KOG2003\|consensus	Back alignment and domain information

>KOG0649\|consensus	Back alignment and domain information

>KOG0642\|consensus	Back alignment and domain information

>COG2319 FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>KOG1007\|consensus	Back alignment and domain information

>PRK10049 pgaA outer membrane protein PgaA; Provisional	Back alignment and domain information

>KOG1188\|consensus	Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

>KOG0644\|consensus	Back alignment and domain information

>KOG1587\|consensus	Back alignment and domain information

>KOG4227\|consensus	Back alignment and domain information

>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>KOG1912\|consensus	Back alignment and domain information

>KOG0649\|consensus	Back alignment and domain information

>KOG0303\|consensus	Back alignment and domain information

>KOG0322\|consensus	Back alignment and domain information

>KOG0985\|consensus	Back alignment and domain information

>KOG1523\|consensus	Back alignment and domain information

>KOG1334\|consensus	Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

>KOG1840\|consensus	Back alignment and domain information

>KOG1517\|consensus	Back alignment and domain information

>KOG1912\|consensus	Back alignment and domain information

>KOG2076\|consensus	Back alignment and domain information

>PRK01742 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0771\|consensus	Back alignment and domain information

>KOG1240\|consensus	Back alignment and domain information

>KOG0644\|consensus	Back alignment and domain information

>KOG2139\|consensus	Back alignment and domain information

>PRK01742 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG2110\|consensus	Back alignment and domain information

>KOG0322\|consensus	Back alignment and domain information

>KOG2110\|consensus	Back alignment and domain information

>KOG0771\|consensus	Back alignment and domain information

>KOG2139\|consensus	Back alignment and domain information

>KOG1240\|consensus	Back alignment and domain information

>KOG1840\|consensus	Back alignment and domain information

>KOG0547\|consensus	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK14574 hmsH outer membrane protein; Provisional	Back alignment and domain information

>KOG2003\|consensus	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0974\|consensus	Back alignment and domain information

>PRK11788 tetratricopeptide repeat protein; Provisional	Back alignment and domain information

>PRK14574 hmsH outer membrane protein; Provisional	Back alignment and domain information

>KOG1354\|consensus	Back alignment and domain information

>PRK11788 tetratricopeptide repeat protein; Provisional	Back alignment and domain information

>KOG1334\|consensus	Back alignment and domain information

>KOG2315\|consensus	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1310\|consensus	Back alignment and domain information

>KOG2321\|consensus	Back alignment and domain information

>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown]	Back alignment and domain information

>KOG2111\|consensus	Back alignment and domain information

>KOG1272\|consensus	Back alignment and domain information

>KOG0547\|consensus	Back alignment and domain information

>KOG0974\|consensus	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG2321\|consensus	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0495\|consensus	Back alignment and domain information

>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A	Back alignment and domain information

>KOG1155\|consensus	Back alignment and domain information

>KOG2114\|consensus	Back alignment and domain information

>KOG1173\|consensus	Back alignment and domain information

>KOG2314\|consensus	Back alignment and domain information

>KOG1126\|consensus	Back alignment and domain information

>KOG2394\|consensus	Back alignment and domain information

>KOG1155\|consensus	Back alignment and domain information

>KOG1409\|consensus	Back alignment and domain information

>KOG0548\|consensus	Back alignment and domain information

>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A	Back alignment and domain information

>KOG2111\|consensus	Back alignment and domain information

>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown]	Back alignment and domain information

>KOG1272\|consensus	Back alignment and domain information

>KOG2394\|consensus	Back alignment and domain information

>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins	Back alignment and domain information

>KOG1310\|consensus	Back alignment and domain information

>KOG1173\|consensus	Back alignment and domain information

>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only]	Back alignment and domain information

>KOG1126\|consensus	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3	Back alignment and domain information

>KOG2315\|consensus	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK01029 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3	Back alignment and domain information

>KOG1354\|consensus	Back alignment and domain information

>KOG4162\|consensus	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG2314\|consensus	Back alignment and domain information

>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only]	Back alignment and domain information

>KOG2066\|consensus	Back alignment and domain information

>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0495\|consensus	Back alignment and domain information

>KOG3881\|consensus	Back alignment and domain information

>KOG2280\|consensus	Back alignment and domain information

>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK01029 tolB translocation protein TolB; Provisional	Back alignment and domain information

>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG2047\|consensus	Back alignment and domain information

>KOG0548\|consensus	Back alignment and domain information

>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>KOG3881\|consensus	Back alignment and domain information

>KOG0280\|consensus	Back alignment and domain information

>KOG1130\|consensus	Back alignment and domain information

>KOG3785\|consensus	Back alignment and domain information

>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG2114\|consensus	Back alignment and domain information

>KOG2047\|consensus	Back alignment and domain information

>COG5290 IkappaB kinase complex, IKAP component [Transcription]	Back alignment and domain information

>KOG4547\|consensus	Back alignment and domain information

>PRK10747 putative protoheme IX biogenesis protein; Provisional	Back alignment and domain information

>KOG1127\|consensus	Back alignment and domain information

>KOG1174\|consensus	Back alignment and domain information

>KOG3785\|consensus	Back alignment and domain information

>PRK10747 putative protoheme IX biogenesis protein; Provisional	Back alignment and domain information

>KOG1156\|consensus	Back alignment and domain information

>KOG4532\|consensus	Back alignment and domain information

>KOG0309\|consensus	Back alignment and domain information

>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR00540 hemY_coli hemY protein	Back alignment and domain information

>KOG4547\|consensus	Back alignment and domain information

>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain	Back alignment and domain information

>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL	Back alignment and domain information

>KOG4162\|consensus	Back alignment and domain information

>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain	Back alignment and domain information

>KOG2376\|consensus	Back alignment and domain information

>TIGR00540 hemY_coli hemY protein	Back alignment and domain information

>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW	Back alignment and domain information

>KOG2280\|consensus	Back alignment and domain information

>KOG1409\|consensus	Back alignment and domain information

>KOG1130\|consensus	Back alignment and domain information

>KOG4532\|consensus	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>KOG1127\|consensus	Back alignment and domain information

>KOG1129\|consensus	Back alignment and domain information

>KOG1064\|consensus	Back alignment and domain information

>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms]	Back alignment and domain information

>KOG1156\|consensus	Back alignment and domain information

>KOG0624\|consensus	Back alignment and domain information

>KOG0280\|consensus	Back alignment and domain information

>KOG3914\|consensus	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>KOG1064\|consensus	Back alignment and domain information

>PRK04043 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>PRK04043 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG4190\|consensus	Back alignment and domain information

>KOG2376\|consensus	Back alignment and domain information

>KOG4340\|consensus	Back alignment and domain information

>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>PRK12370 invasion protein regulator; Provisional	Back alignment and domain information

>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW	Back alignment and domain information

>KOG1129\|consensus	Back alignment and domain information

>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A	Back alignment and domain information

>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal	Back alignment and domain information

>KOG4190\|consensus	Back alignment and domain information

>KOG4340\|consensus	Back alignment and domain information

>PRK11189 lipoprotein NlpI; Provisional	Back alignment and domain information

>PRK12370 invasion protein regulator; Provisional	Back alignment and domain information

>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>KOG1174\|consensus	Back alignment and domain information

>KOG0882\|consensus	Back alignment and domain information

>KOG0624\|consensus	Back alignment and domain information

>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A	Back alignment and domain information

>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal	Back alignment and domain information

>PRK11189 lipoprotein NlpI; Provisional	Back alignment and domain information

>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats	Back alignment and domain information

>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL	Back alignment and domain information

>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals	Back alignment and domain information

>KOG1125\|consensus	Back alignment and domain information

>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala	Back alignment and domain information

>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms]	Back alignment and domain information

>KOG0550\|consensus	Back alignment and domain information

>PRK11138 outer membrane biogenesis protein BamB; Provisional	Back alignment and domain information

>KOG0309\|consensus	Back alignment and domain information

>KOG3914\|consensus	Back alignment and domain information

>KOG3621\|consensus	Back alignment and domain information

>KOG4649\|consensus	Back alignment and domain information

>KOG4714\|consensus	Back alignment and domain information

>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>KOG2695\|consensus	Back alignment and domain information

>KOG0550\|consensus	Back alignment and domain information

>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>KOG2066\|consensus	Back alignment and domain information

>KOG1128\|consensus	Back alignment and domain information

>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO	Back alignment and domain information

>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO	Back alignment and domain information

>KOG1915\|consensus	Back alignment and domain information

>KOG1897\|consensus	Back alignment and domain information

>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A	Back alignment and domain information

>KOG1125\|consensus	Back alignment and domain information

>KOG1128\|consensus	Back alignment and domain information

>PRK11138 outer membrane biogenesis protein BamB; Provisional	Back alignment and domain information

>KOG4714\|consensus	Back alignment and domain information

>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional	Back alignment and domain information

>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional	Back alignment and domain information

>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>KOG3621\|consensus	Back alignment and domain information

>KOG1586\|consensus	Back alignment and domain information

>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A	Back alignment and domain information

>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional	Back alignment and domain information

>KOG1941\|consensus	Back alignment and domain information

>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals	Back alignment and domain information

>KOG0882\|consensus	Back alignment and domain information

>KOG1941\|consensus	Back alignment and domain information

>KOG1586\|consensus	Back alignment and domain information

>KOG2695\|consensus	Back alignment and domain information

>KOG1832\|consensus	Back alignment and domain information

>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional	Back alignment and domain information

>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion]	Back alignment and domain information

>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex	Back alignment and domain information

>KOG1645\|consensus	Back alignment and domain information

>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex	Back alignment and domain information

>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A	Back alignment and domain information

>KOG1832\|consensus	Back alignment and domain information

>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide	Back alignment and domain information

>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>KOG1275\|consensus	Back alignment and domain information

>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats	Back alignment and domain information

>KOG1275\|consensus	Back alignment and domain information

>KOG1915\|consensus	Back alignment and domain information

>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional	Back alignment and domain information

>PRK15359 type III secretion system chaperone protein SscB; Provisional	Back alignment and domain information

>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex	Back alignment and domain information

>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional	Back alignment and domain information

>KOG2247\|consensus	Back alignment and domain information

>KOG1585\|consensus	Back alignment and domain information

>PRK15359 type III secretion system chaperone protein SscB; Provisional	Back alignment and domain information

>KOG1585\|consensus	Back alignment and domain information

>KOG1645\|consensus	Back alignment and domain information

>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only]	Back alignment and domain information

>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG0553\|consensus	Back alignment and domain information

>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion]	Back alignment and domain information

>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1	Back alignment and domain information

>KOG2247\|consensus	Back alignment and domain information

>KOG1008\|consensus	Back alignment and domain information

>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional	Back alignment and domain information

>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function	Back alignment and domain information

>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion]	Back alignment and domain information

>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>COG3386 Gluconolactonase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators []	Back alignment and domain information

>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide	Back alignment and domain information

>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex	Back alignment and domain information

>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1	Back alignment and domain information

>PRK02888 nitrous-oxide reductase; Validated	Back alignment and domain information

>KOG1008\|consensus	Back alignment and domain information

>PRK13616 lipoprotein LpqB; Provisional	Back alignment and domain information

>KOG4649\|consensus	Back alignment and domain information

>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD	Back alignment and domain information

>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only]	Back alignment and domain information

>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function	Back alignment and domain information

>PLN02789 farnesyltranstransferase	Back alignment and domain information

>KOG0553\|consensus	Back alignment and domain information

>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A	Back alignment and domain information

>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A	Back alignment and domain information

>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H	Back alignment and domain information

>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>COG3490 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PLN02789 farnesyltranstransferase	Back alignment and domain information

>PRK02888 nitrous-oxide reductase; Validated	Back alignment and domain information

>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins	Back alignment and domain information

>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		1637
2oaj_A		902	Protein SNI1; WD40 repeat, beta propeller, endocyt	5e-16
1yfq_A		342	Cell cycle arrest protein BUB3; WD repeat WD40 rep	2e-14
1nr0_A		611	Actin interacting protein 1; beta propeller, WD40	8e-14
1nr0_A		611	Actin interacting protein 1; beta propeller, WD40	1e-11
1nr0_A		611	Actin interacting protein 1; beta propeller, WD40	1e-08
1nr0_A		611	Actin interacting protein 1; beta propeller, WD40	9e-08
1nr0_A		611	Actin interacting protein 1; beta propeller, WD40	9e-06
1nr0_A		611	Actin interacting protein 1; beta propeller, WD40	2e-05
1nr0_A		611	Actin interacting protein 1; beta propeller, WD40	6e-05
1nr0_A		611	Actin interacting protein 1; beta propeller, WD40	1e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-13
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-12
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-11
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-06
2xpi_A		597	Anaphase-promoting complex subunit CUT9; cell cycl	1e-12
3dwl_C		377	Actin-related protein 2/3 complex subunit 1; prope	1e-10
3dwl_C		377	Actin-related protein 2/3 complex subunit 1; prope	8e-09
1xi4_A		1630	Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle	2e-10
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	5e-10
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	2e-08
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	1e-05
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	1e-04
3mmy_A		368	MRNA export factor; mRNA export, nuclear protein;	6e-10
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	7e-10
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	1e-05
3lrv_A		343	PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu	1e-09
3lrv_A		343	PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu	2e-07
3lrv_A		343	PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu	1e-05
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	2e-09
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	1e-07
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	4e-05
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	4e-04
3ulq_A		383	Response regulator aspartate phosphatase F; tetrat	5e-09
3q15_A		378	PSP28, response regulator aspartate phosphatase H;	8e-09
3q15_A		378	PSP28, response regulator aspartate phosphatase H;	1e-05
2ifu_A		307	Gamma-SNAP; membrane fusion, snare complex disasse	8e-09
2ifu_A		307	Gamma-SNAP; membrane fusion, snare complex disasse	5e-08
2ifu_A		307	Gamma-SNAP; membrane fusion, snare complex disasse	2e-05
2ifu_A		307	Gamma-SNAP; membrane fusion, snare complex disasse	2e-04
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	2e-08
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	8e-08
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	1e-07
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	2e-06
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	1e-05
3ei3_B		383	DNA damage-binding protein 2; UV-damage, DDB, nucl	6e-08
1pgu_A		615	Actin interacting protein 1; WD repeat, seven-blad	7e-08
1pgu_A		615	Actin interacting protein 1; WD repeat, seven-blad	1e-04
2oit_A		434	Nucleoporin 214KDA; NH2 terminal domain of NUP214/	1e-07
2oit_A		434	Nucleoporin 214KDA; NH2 terminal domain of NUP214/	3e-05
1k8k_C		372	P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-	2e-07
2j04_B		524	YDR362CP, TAU91; beta propeller, type 2 promoters,	6e-07
3dw8_B		447	Serine/threonine-protein phosphatase 2A 55 kDa RE	1e-06
3gre_A		437	Serine/threonine-protein kinase VPS15; seven-blade	2e-06
2hes_X		330	YDR267CP; beta-propeller, WD40 repeat, biosyntheti	2e-06
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	3e-06
3mkq_B		177	Coatomer subunit alpha; beta-propeller, alpha-sole	4e-06
3fp2_A		537	TPR repeat-containing protein YHR117W; TOM71, mito	9e-06
3fp2_A		537	TPR repeat-containing protein YHR117W; TOM71, mito	5e-05
1qqe_A		292	Vesicular transport protein SEC17; helix-turn-heli	1e-05
1qqe_A		292	Vesicular transport protein SEC17; helix-turn-heli	2e-05
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	2e-05
4e54_B		435	DNA damage-binding protein 2; beta barrel, double	3e-05
4e54_B		435	DNA damage-binding protein 2; beta barrel, double	9e-05
1sq9_A		397	Antiviral protein SKI8; WD repeat, beta-transducin	3e-05
1got_B		340	GT-beta; complex (GTP-binding/transducer), G prote	4e-05
2pm9_A		416	Protein WEB1, protein transport protein SEC31; bet	6e-05
3i2n_A		357	WD repeat-containing protein 92; WD40 repeats, str	6e-05
2pbi_B		354	Guanine nucleotide-binding protein subunit beta 5;	1e-04
3zwl_B		369	Eukaryotic translation initiation factor 3 subuni;	1e-04
3lvg_A		624	Clathrin heavy chain 1; SELF assembly, coated PIT,	1e-04
3ieg_A		359	DNAJ homolog subfamily C member 3; TPR motif, chap	1e-04
2vdu_B		450	TRNA (guanine-N(7)-)-methyltransferase- associated	2e-04
2gw1_A		514	Mitochondrial precursor proteins import receptor;	2e-04
1gxr_A		337	ESG1, transducin-like enhancer protein 1; transcri	2e-04
3ro3_A		164	PINS homolog, G-protein-signaling modulator 2; asy	2e-04
4g1t_A		472	Interferon-induced protein with tetratricopeptide	3e-04
3vu4_A		355	KMHSV2; beta-propeller fold, protein transport; 2.	7e-04

>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Length = 902	Back alignment and structure

 Score = 83.0 bits (204), Expect = 5e-16
 Identities = 47/373 (12%), Positives = 112/373 (30%), Gaps = 50/373 (13%)

Query: 49  VKGLAFSPDSTKLAVAQSDNIIFIYKLGDDWGDKKVICN-KFIQQCPVTTMVWLADGPII 107
               AF      LA+A     + I      +G ++V    K   +  +  M ++    ++
Sbjct: 20  PIAAAFDFTQNLLAIATVTGEVHI------YGQQQVEVVIKLEDRSAIKEMRFVKGIYLV 73

Query: 108 YGQSDGKIKAAHVKANKTQTLYASNSFVVALCLNVRGAGVLSGHADGSIVRYYVTEDAS- 166
              +   +    + + K  T       + ++  +     +L G  +GS++ Y +  D   
Sbjct: 74  VINAKDTVYVLSLYSQKVLTTVFVPGKITSIDTDASLDWMLIGLQNGSMIVYDIDRDQLS 133

Query: 167 -----NFDQQQGRVVQHPVPPYALSW--PAGYILAAGSDRIVTIYE-SDGRVHRIFDYTA 218
                N  +          P  ++ W       +    + +   Y   +  + + F Y  
Sbjct: 134 SFKLDNLQKSSFFPAARLSPIVSIQWNPRDIGTVLISYEYVTLTYSLVENEIKQSFIYEL 193

Query: 219 PHY-----------KEREFTV--ACSSPSGQAVVVGSYDNIKLFAWSPSK---------- 255
           P +           ++R   V  +   P+   ++    DN  L  W  +           
Sbjct: 194 PPFAPGGDFSEKTNEKRTPKVIQSLYHPNSLHIITIHEDN-SLVFWDANSGHMIMARTVF 252

Query: 256 -----SVWEEQPNKTIPNLYTISALSW--KRDGSRIACGGLCGSVELFESVLKRTIWKGK 308
                    +    +  N   IS + W  + +    +      S+   ++     I  G 
Sbjct: 253 ETEINVPQPDYIRDSSTNAAKISKVYWMCENNPEYTSLLISHKSISRGDNQSLTMIDLGY 312

Query: 309 FEMIYVSPSQVLVKPLSGESKGRGVILKSQYGYEITDVAIMGNDRYLVARTPD-TLLLGD 367
                ++  + +    +  +  +  I        I ++  +       A   +  L+L  
Sbjct: 313 TPRYSITSYEGMKNYYA--NPKQMKIFPLPTNVPIVNILPIPRQSPYFAGCHNPGLILLI 370

Query: 368 LHRNLLSEVLWPD 380
           L    +  +L+P 
Sbjct: 371 LGNGEIETMLYPS 383

PyMOL of 2oaj

>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Length = 342	Back alignment and structure

>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611	Back alignment and structure

>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611	Back alignment and structure

>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611	Back alignment and structure

>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611	Back alignment and structure

>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611	Back alignment and structure

>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611	Back alignment and structure

>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611	Back alignment and structure

>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597	Back alignment and structure

>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 377	Back alignment and structure

>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 377	Back alignment and structure

>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Length = 1630	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338	Back alignment and structure

>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Length = 368	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411	Back alignment and structure

>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 343	Back alignment and structure

>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 343	Back alignment and structure

>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 343	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406	Back alignment and structure

>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383	Back alignment and structure

>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378	Back alignment and structure

>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378	Back alignment and structure

>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307	Back alignment and structure

>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307	Back alignment and structure

>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307	Back alignment and structure

>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249	Back alignment and structure

>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Length = 383	Back alignment and structure

>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615	Back alignment and structure

>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615	Back alignment and structure

>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Length = 434	Back alignment and structure

>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Length = 434	Back alignment and structure

>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Length = 372	Back alignment and structure

>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Length = 524	Back alignment and structure

>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Length = 447	Back alignment and structure

>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Length = 437	Back alignment and structure

>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Length = 330	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450	Back alignment and structure

>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Length = 177	Back alignment and structure

>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537	Back alignment and structure

>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537	Back alignment and structure

>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292	Back alignment and structure

>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292	Back alignment and structure

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Length = 814	Back alignment and structure

>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Length = 435	Back alignment and structure

>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Length = 435	Back alignment and structure

>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Length = 397	Back alignment and structure

>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Length = 340	Back alignment and structure

>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Length = 416	Back alignment and structure

>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Length = 357	Back alignment and structure

>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Length = 354	Back alignment and structure

>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Length = 369	Back alignment and structure

>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Length = 624	Back alignment and structure

>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359	Back alignment and structure

>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Length = 450	Back alignment and structure

>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514	Back alignment and structure

>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Length = 337	Back alignment and structure

>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164	Back alignment and structure

>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472	Back alignment and structure

>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Length = 355	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		1637
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	100.0
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	100.0
2ymu_A		577	WD-40 repeat protein; unknown function, two domain	100.0
1nr0_A		611	Actin interacting protein 1; beta propeller, WD40	100.0
2ymu_A		577	WD-40 repeat protein; unknown function, two domain	100.0
1nr0_A		611	Actin interacting protein 1; beta propeller, WD40	100.0
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	100.0
1pgu_A		615	Actin interacting protein 1; WD repeat, seven-blad	100.0
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	100.0
1pgu_A		615	Actin interacting protein 1; WD repeat, seven-blad	100.0
2oaj_A		902	Protein SNI1; WD40 repeat, beta propeller, endocyt	100.0
2oaj_A		902	Protein SNI1; WD40 repeat, beta propeller, endocyt	100.0
1xi4_A		1630	Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle	100.0
1got_B		340	GT-beta; complex (GTP-binding/transducer), G prote	100.0
1vyh_C		410	Platelet-activating factor acetylhydrolase IB alph	100.0
3ow8_A		321	WD repeat-containing protein 61; structural genomi	100.0
4g56_B		357	MGC81050 protein; protein arginine methyltransfera	100.0
4gqb_B		344	Methylosome protein 50; TIM barrel, beta-propeller	100.0
2pbi_B		354	Guanine nucleotide-binding protein subunit beta 5;	100.0
3fm0_A		345	Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r	100.0
3frx_A		319	Guanine nucleotide-binding protein subunit beta- l	100.0
3iz6_a		380	40S ribosomal protein RACK1 (RACK1); eukaryotic ri	100.0
4g56_B		357	MGC81050 protein; protein arginine methyltransfera	100.0
2ynn_A		304	Coatomer subunit beta'; protein transport, peptide	100.0
1xi4_A		1630	Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle	100.0
1vyh_C		410	Platelet-activating factor acetylhydrolase IB alph	100.0
3ow8_A		321	WD repeat-containing protein 61; structural genomi	100.0
2ynn_A		304	Coatomer subunit beta'; protein transport, peptide	100.0
2xzm_R		343	RACK1; ribosome, translation; 3.93A {Tetrahymena t	100.0
1got_B		340	GT-beta; complex (GTP-binding/transducer), G prote	100.0
3frx_A		319	Guanine nucleotide-binding protein subunit beta- l	100.0
2hes_X		330	YDR267CP; beta-propeller, WD40 repeat, biosyntheti	100.0
3fm0_A		345	Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r	100.0
4gqb_B		344	Methylosome protein 50; TIM barrel, beta-propeller	100.0
1r5m_A		425	SIR4-interacting protein SIF2; transcription corep	100.0
1gxr_A		337	ESG1, transducin-like enhancer protein 1; transcri	100.0
1r5m_A		425	SIR4-interacting protein SIF2; transcription corep	100.0
2pbi_B		354	Guanine nucleotide-binding protein subunit beta 5;	100.0
4ery_A		312	WD repeat-containing protein 5; WD40, WIN motif, b	100.0
1erj_A		393	Transcriptional repressor TUP1; beta-propeller, tr	100.0
2xzm_R		343	RACK1; ribosome, translation; 3.93A {Tetrahymena t	100.0
3iz6_a		380	40S ribosomal protein RACK1 (RACK1); eukaryotic ri	100.0
2j04_B		524	YDR362CP, TAU91; beta propeller, type 2 promoters,	100.0
2pm9_A		416	Protein WEB1, protein transport protein SEC31; bet	100.0
2pm9_A		416	Protein WEB1, protein transport protein SEC31; bet	100.0
3vl1_A		420	26S proteasome regulatory subunit RPN14; beta-prop	100.0
2hes_X		330	YDR267CP; beta-propeller, WD40 repeat, biosyntheti	100.0
4aow_A		340	Guanine nucleotide-binding protein subunit beta-2;	99.98
1gxr_A		337	ESG1, transducin-like enhancer protein 1; transcri	99.98
3vl1_A		420	26S proteasome regulatory subunit RPN14; beta-prop	99.98
3dm0_A		694	Maltose-binding periplasmic protein fused with RAC	99.98
4ery_A		312	WD repeat-containing protein 5; WD40, WIN motif, b	99.98
2j04_A		588	TAU60, YPL007P, hypothetical protein YPL007C; beta	99.98
1k8k_C		372	P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-	99.97
3k26_A		366	Polycomb protein EED; WD40, structural genomics, N	99.97
4e54_B		435	DNA damage-binding protein 2; beta barrel, double	99.97
1erj_A		393	Transcriptional repressor TUP1; beta-propeller, tr	99.97
4aow_A		340	Guanine nucleotide-binding protein subunit beta-2;	99.97
3zwl_B		369	Eukaryotic translation initiation factor 3 subuni;	99.97
2pm7_B		297	Protein transport protein SEC13, protein transport	99.97
3dwl_C		377	Actin-related protein 2/3 complex subunit 1; prope	99.97
3ei3_B		383	DNA damage-binding protein 2; UV-damage, DDB, nucl	99.97
3dm0_A		694	Maltose-binding periplasmic protein fused with RAC	99.97
4e54_B		435	DNA damage-binding protein 2; beta barrel, double	99.97
2j04_B		524	YDR362CP, TAU91; beta propeller, type 2 promoters,	99.97
3gre_A		437	Serine/threonine-protein kinase VPS15; seven-blade	99.97
3odt_A		313	Protein DOA1; ubiquitin, nuclear protein; HET: MSE	99.97
2ovr_B		445	FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40	99.97
3v7d_B		464	Cell division control protein 4; WD 40 domain, pho	99.97
3i2n_A		357	WD repeat-containing protein 92; WD40 repeats, str	99.97
1sq9_A		397	Antiviral protein SKI8; WD repeat, beta-transducin	99.97
4h5i_A		365	Guanine nucleotide-exchange factor SEC12; copii ve	99.97
4aez_A		401	CDC20, WD repeat-containing protein SLP1; cell cyc	99.97
3ei3_B		383	DNA damage-binding protein 2; UV-damage, DDB, nucl	99.97
3v7d_B		464	Cell division control protein 4; WD 40 domain, pho	99.97
4gga_A		420	P55CDC, cell division cycle protein 20 homolog; ce	99.97
2pm7_B		297	Protein transport protein SEC13, protein transport	99.97
1k32_A		1045	Tricorn protease; protein degradation, substrate g	99.97
3zwl_B		369	Eukaryotic translation initiation factor 3 subuni;	99.97
2ovr_B		445	FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40	99.96
1sq9_A		397	Antiviral protein SKI8; WD repeat, beta-transducin	99.96
4a11_B		408	DNA excision repair protein ERCC-8; DNA binding pr	99.96
3bg1_A		316	Protein SEC13 homolog; NPC, transport, WD repeat,	99.96
3odt_A		313	Protein DOA1; ubiquitin, nuclear protein; HET: MSE	99.96
1k8k_C		372	P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-	99.96
3i2n_A		357	WD repeat-containing protein 92; WD40 repeats, str	99.96
3dwl_C		377	Actin-related protein 2/3 complex subunit 1; prope	99.96
3bg1_A		316	Protein SEC13 homolog; NPC, transport, WD repeat,	99.96
2j04_A		588	TAU60, YPL007P, hypothetical protein YPL007C; beta	99.96
4ggc_A		318	P55CDC, cell division cycle protein 20 homolog; ce	99.96
3dw8_B		447	Serine/threonine-protein phosphatase 2A 55 kDa RE	99.96
3k26_A		366	Polycomb protein EED; WD40, structural genomics, N	99.96
3dw8_B		447	Serine/threonine-protein phosphatase 2A 55 kDa RE	99.96
1yfq_A		342	Cell cycle arrest protein BUB3; WD repeat WD40 rep	99.96
4aez_A		401	CDC20, WD repeat-containing protein SLP1; cell cyc	99.96
1k32_A		1045	Tricorn protease; protein degradation, substrate g	99.96
4a11_B		408	DNA excision repair protein ERCC-8; DNA binding pr	99.96
3f3f_A		351	Nucleoporin SEH1; structural protein, protein comp	99.96
4h5i_A		365	Guanine nucleotide-exchange factor SEC12; copii ve	99.95
3jrp_A		379	Fusion protein of protein transport protein SEC13	99.95
1yfq_A		342	Cell cycle arrest protein BUB3; WD repeat WD40 rep	99.95
3gre_A		437	Serine/threonine-protein kinase VPS15; seven-blade	99.95
1p22_A		435	F-BOX/WD-repeat protein 1A; ubiquitination, degrad	99.95
4gga_A		420	P55CDC, cell division cycle protein 20 homolog; ce	99.95
3mmy_A		368	MRNA export factor; mRNA export, nuclear protein;	99.95
2aq5_A		402	Coronin-1A; WD40 repeat, 7-bladed beta-propeller,	99.95
3mmy_A		368	MRNA export factor; mRNA export, nuclear protein;	99.95
2aq5_A		402	Coronin-1A; WD40 repeat, 7-bladed beta-propeller,	99.95
3jrp_A		379	Fusion protein of protein transport protein SEC13	99.95
2vdu_B		450	TRNA (guanine-N(7)-)-methyltransferase- associated	99.94
4ggc_A		318	P55CDC, cell division cycle protein 20 homolog; ce	99.94
3jro_A		753	Fusion protein of protein transport protein SEC13	99.94
1p22_A		435	F-BOX/WD-repeat protein 1A; ubiquitination, degrad	99.94
3f3f_A		351	Nucleoporin SEH1; structural protein, protein comp	99.94
3jro_A		753	Fusion protein of protein transport protein SEC13	99.94
3lrv_A		343	PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu	99.94
3vu4_A		355	KMHSV2; beta-propeller fold, protein transport; 2.	99.94
2xyi_A		430	Probable histone-binding protein CAF1; transcripti	99.93
2vdu_B		450	TRNA (guanine-N(7)-)-methyltransferase- associated	99.93
2xyi_A		430	Probable histone-binding protein CAF1; transcripti	99.93
3vu4_A		355	KMHSV2; beta-propeller fold, protein transport; 2.	99.92
1l0q_A		391	Surface layer protein; SLP, S-layer, 7-bladed beta	99.92
1b89_A		449	Protein (clathrin heavy chain); triskelion, coated	99.92
3bws_A		433	Protein LP49; two-domain, immunoglobulin-like, 7-b	99.92
3bws_A		433	Protein LP49; two-domain, immunoglobulin-like, 7-b	99.92
4gq1_A		393	NUP37; propeller, transport protein; 2.40A {Schizo	99.92
4gq1_A		393	NUP37; propeller, transport protein; 2.40A {Schizo	99.91
3lrv_A		343	PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu	99.91
2xpi_A		597	Anaphase-promoting complex subunit CUT9; cell cycl	99.91
2w18_A		356	PALB2, fancn, partner and localizer of BRCA2; fanc	99.9
2xpi_A		597	Anaphase-promoting complex subunit CUT9; cell cycl	99.9
1l0q_A		391	Surface layer protein; SLP, S-layer, 7-bladed beta	99.89
2hqs_A		415	Protein TOLB; TOLB, PAL, TOL, transport protein-li	99.89
1nir_A		543	Nitrite reductase; hemoprotein, denitrification, d	99.89
2ecf_A		741	Dipeptidyl peptidase IV; prolyl oligopeptidase fam	99.89
2w18_A		356	PALB2, fancn, partner and localizer of BRCA2; fanc	99.89
3lvg_A		624	Clathrin heavy chain 1; SELF assembly, coated PIT,	99.88
1w3b_A		388	UDP-N-acetylglucosamine--peptide N-acetylglucosami	99.86
1nir_A		543	Nitrite reductase; hemoprotein, denitrification, d	99.86
1w3b_A		388	UDP-N-acetylglucosamine--peptide N-acetylglucosami	99.85
2ecf_A		741	Dipeptidyl peptidase IV; prolyl oligopeptidase fam	99.85
2hqs_A		415	Protein TOLB; TOLB, PAL, TOL, transport protein-li	99.85
1xfd_A		723	DIP, dipeptidyl aminopeptidase-like protein 6, dip	99.85
2z3z_A		706	Dipeptidyl aminopeptidase IV; peptidase family S9,	99.84
2z3z_A		706	Dipeptidyl aminopeptidase IV; peptidase family S9,	99.83
3u4y_A		331	Uncharacterized protein; structural genomics, PSI-	99.82
1ri6_A		343	Putative isomerase YBHE; 7-bladed propeller, enzym	99.82
2ojh_A		297	Uncharacterized protein ATU1656/AGR_C_3050; TOLB,	99.82
1xfd_A		723	DIP, dipeptidyl aminopeptidase-like protein 6, dip	99.81
3vgz_A		353	Uncharacterized protein YNCE; beta-propeller, prot	99.8
1ri6_A		343	Putative isomerase YBHE; 7-bladed propeller, enzym	99.79
1pby_B		337	Quinohemoprotein amine dehydrogenase 40 kDa subuni	99.78
3u4y_A		331	Uncharacterized protein; structural genomics, PSI-	99.77
1z68_A		719	Fibroblast activation protein, alpha subunit; sepr	99.77
2oit_A		434	Nucleoporin 214KDA; NH2 terminal domain of NUP214/	99.77
3vgz_A		353	Uncharacterized protein YNCE; beta-propeller, prot	99.76
2ojh_A		297	Uncharacterized protein ATU1656/AGR_C_3050; TOLB,	99.76
3o4h_A		582	Acylamino-acid-releasing enzyme; alpha/beta hydrol	99.76
2gw1_A		514	Mitochondrial precursor proteins import receptor;	99.76
3fp2_A		537	TPR repeat-containing protein YHR117W; TOM71, mito	99.75
3fp2_A		537	TPR repeat-containing protein YHR117W; TOM71, mito	99.75
2oit_A		434	Nucleoporin 214KDA; NH2 terminal domain of NUP214/	99.75
3hfq_A		347	Uncharacterized protein LP_2219; Q88V64_lacpl, NES	99.74
3hfq_A		347	Uncharacterized protein LP_2219; Q88V64_lacpl, NES	99.74
4a5s_A		740	Dipeptidyl peptidase 4 soluble form; hydrolase, ty	99.74
2gw1_A		514	Mitochondrial precursor proteins import receptor;	99.73
1z68_A		719	Fibroblast activation protein, alpha subunit; sepr	99.73
3scy_A		361	Hypothetical bacterial 6-phosphogluconolactonase;	99.73
4a5s_A		740	Dipeptidyl peptidase 4 soluble form; hydrolase, ty	99.72
1jmx_B		349	Amine dehydrogenase; oxidoreductase; HET: TRQ HEC;	99.72
3o4h_A		582	Acylamino-acid-releasing enzyme; alpha/beta hydrol	99.71
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	99.7
1b89_A		449	Protein (clathrin heavy chain); triskelion, coated	99.7
1pby_B		337	Quinohemoprotein amine dehydrogenase 40 kDa subuni	99.69
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	99.69
3scy_A		361	Hypothetical bacterial 6-phosphogluconolactonase;	99.69
3pe7_A		388	Oligogalacturonate lyase; seven-bladed beta-propel	99.68
1jmx_B		349	Amine dehydrogenase; oxidoreductase; HET: TRQ HEC;	99.68
3ieg_A		359	DNAJ homolog subfamily C member 3; TPR motif, chap	99.67
2xm6_A		490	Protein corresponding to locus C5321 from CFT073 s	99.63
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	99.63
2xm6_A		490	Protein corresponding to locus C5321 from CFT073 s	99.63
3ieg_A		359	DNAJ homolog subfamily C member 3; TPR motif, chap	99.62
3pe7_A		388	Oligogalacturonate lyase; seven-bladed beta-propel	99.62
4g1t_A		472	Interferon-induced protein with tetratricopeptide	99.62
1jof_A		365	Carboxy-CIS,CIS-muconate cyclase; beta-propeller,	99.61
1fch_A		368	Peroxisomal targeting signal 1 receptor; protein-p	99.61
3c5m_A		396	Oligogalacturonate lyase; blade-shaped beta-propel	99.61
4g1t_A		472	Interferon-induced protein with tetratricopeptide	99.59
1jof_A		365	Carboxy-CIS,CIS-muconate cyclase; beta-propeller,	99.58
3hym_B		330	Cell division cycle protein 16 homolog; APC, anaph	99.57
3azo_A		662	Aminopeptidase; POP family, hydrolase; 2.00A {Stre	99.57
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	99.57
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	99.56
3hym_B		330	Cell division cycle protein 16 homolog; APC, anaph	99.56
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	99.56
1q7f_A		286	NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL	99.56
2xdw_A		710	Prolyl endopeptidase; alpha/beta-hydrolase, amnesi	99.54
2gop_A		347	Trilobed protease; beta propeller, open velcro, hy	99.54
3c5m_A		396	Oligogalacturonate lyase; blade-shaped beta-propel	99.54
3fvz_A		329	Peptidyl-glycine alpha-amidating monooxygenase; be	99.53
4eqf_A		365	PEX5-related protein; accessory protein, tetratric	99.53
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	99.53
3ulq_A		383	Response regulator aspartate phosphatase F; tetrat	99.53
2oiz_A		361	Aromatic amine dehydrogenase, large subunit; oxido	99.51
1fch_A		368	Peroxisomal targeting signal 1 receptor; protein-p	99.51
3azo_A		662	Aminopeptidase; POP family, hydrolase; 2.00A {Stre	99.51
2bkl_A		695	Prolyl endopeptidase; mechanistic study, celiac sp	99.5
3q15_A		378	PSP28, response regulator aspartate phosphatase H;	99.5
3e5z_A		296	Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco	99.5
3fvz_A		329	Peptidyl-glycine alpha-amidating monooxygenase; be	99.5
2bkl_A		695	Prolyl endopeptidase; mechanistic study, celiac sp	99.49
2xdw_A		710	Prolyl endopeptidase; alpha/beta-hydrolase, amnesi	99.49
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	99.49
3ulq_A		383	Response regulator aspartate phosphatase F; tetrat	99.48
3cv0_A		327	Peroxisome targeting signal 1 receptor PEX5; TPR m	99.48
1q7f_A		286	NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL	99.47
1qks_A		567	Cytochrome CD1 nitrite reductase; enzyme, oxidored	99.47
4eqf_A		365	PEX5-related protein; accessory protein, tetratric	99.45
2oiz_A		361	Aromatic amine dehydrogenase, large subunit; oxido	99.45
2dg1_A		333	DRP35, lactonase; beta propeller, hydrolase; 1.72A	99.45
1qks_A		567	Cytochrome CD1 nitrite reductase; enzyme, oxidored	99.44
2gop_A		347	Trilobed protease; beta propeller, open velcro, hy	99.44
2pl2_A		217	Hypothetical conserved protein TTC0263; TPR, prote	99.43
3uq3_A		258	Heat shock protein STI1; HSP90, peptide binding, c	99.42
2dg1_A		333	DRP35, lactonase; beta propeller, hydrolase; 1.72A	99.42
3q15_A		378	PSP28, response regulator aspartate phosphatase H;	99.42
3mkr_A		291	Coatomer subunit epsilon; tetratricopeptide repeat	99.41
1yr2_A		741	Prolyl oligopeptidase; prolyl endopeptidase, mecha	99.41
3cv0_A		327	Peroxisome targeting signal 1 receptor PEX5; TPR m	99.4
2z2n_A		299	Virginiamycin B lyase; seven-bladed beta-propeller	99.4
3mkr_A		291	Coatomer subunit epsilon; tetratricopeptide repeat	99.4
2ooe_A		530	Cleavage stimulation factor 77 kDa subunit; HAT do	99.39
2pl2_A		217	Hypothetical conserved protein TTC0263; TPR, prote	99.39
3mkq_B		177	Coatomer subunit alpha; beta-propeller, alpha-sole	99.38
2z2n_A		299	Virginiamycin B lyase; seven-bladed beta-propeller	99.37
3uq3_A		258	Heat shock protein STI1; HSP90, peptide binding, c	99.36
1yr2_A		741	Prolyl oligopeptidase; prolyl endopeptidase, mecha	99.36
3u4t_A		272	TPR repeat-containing protein; structural genomics	99.35
3u4t_A		272	TPR repeat-containing protein; structural genomics	99.35
1rwi_B		270	Serine/threonine-protein kinase PKND; beta propell	99.34
1rwi_B		270	Serine/threonine-protein kinase PKND; beta propell	99.34
2ooe_A		530	Cleavage stimulation factor 77 kDa subunit; HAT do	99.34
2h6f_A		382	Protein farnesyltransferase/geranylgeranyltransfer	99.34
3dsm_A		328	Uncharacterized protein bacuni_02894; seven_blated	99.3
3dsm_A		328	Uncharacterized protein bacuni_02894; seven_blated	99.3
2qc5_A		300	Streptogramin B lactonase; beta propeller, lyase;	99.27
3iuj_A		693	Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas	99.27
3e5z_A		296	Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco	99.26
3no2_A		276	Uncharacterized protein; six-bladed beta-propeller	99.26
2h6f_A		382	Protein farnesyltransferase/geranylgeranyltransfer	99.25
3e4b_A		452	ALGK; tetratricopeptide repeat, superhelix, algina	99.25
3nf1_A		311	KLC 1, kinesin light chain 1; TPR, structural geno	99.24
1qqe_A		292	Vesicular transport protein SEC17; helix-turn-heli	99.24
4a2l_A		795	BT_4663, two-component system sensor histidine kin	99.23
3no2_A		276	Uncharacterized protein; six-bladed beta-propeller	99.23
1qqe_A		292	Vesicular transport protein SEC17; helix-turn-heli	99.23
3sjl_D		386	Methylamine dehydrogenase heavy chain; MAUG, C-hem	99.22
3e4b_A		452	ALGK; tetratricopeptide repeat, superhelix, algina	99.21
2mad_H		373	Methylamine dehydrogenase (heavy subunit); oxidore	99.21
1pjx_A		314	Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries	99.21
2qc5_A		300	Streptogramin B lactonase; beta propeller, lyase;	99.21
1hz4_A		373	MALT regulatory protein; two-helix bundles, helix	99.21
2mad_H		373	Methylamine dehydrogenase (heavy subunit); oxidore	99.2
3dr2_A		305	Exported gluconolactonase; gluconolactonase SMP-30	99.19
1ouv_A		273	Conserved hypothetical secreted protein; TPR repea	99.18
2ifu_A		307	Gamma-SNAP; membrane fusion, snare complex disasse	99.18
1ouv_A		273	Conserved hypothetical secreted protein; TPR repea	99.17
3sjl_D		386	Methylamine dehydrogenase heavy chain; MAUG, C-hem	99.17
3v9f_A		781	Two-component system sensor histidine kinase/RESP	99.17
3nf1_A		311	KLC 1, kinesin light chain 1; TPR, structural geno	99.17
3g4e_A		297	Regucalcin; six bladed beta-propeller, gluconolcat	99.16
3edt_B		283	KLC 2, kinesin light chain 2; superhelical, struct	99.16
4a2l_A		795	BT_4663, two-component system sensor histidine kin	99.15
3vtx_A		184	MAMA; tetratricopeptide repeats (TPR) containing p	99.15
2ghs_A		326	AGR_C_1268P; regucalcin, structural genomics, join	99.15
3vtx_A		184	MAMA; tetratricopeptide repeats (TPR) containing p	99.15
2q7f_A		243	YRRB protein; TPR, protein binding; 2.49A {Bacillu	99.15
1xnf_A		275	Lipoprotein NLPI; TPR, tetratricopeptide, structur	99.14
4abn_A		474	Tetratricopeptide repeat protein 5; P53 cofactor,	99.14
2ho1_A		252	Type 4 fimbrial biogenesis protein PILF; type IV p	99.14
1hz4_A		373	MALT regulatory protein; two-helix bundles, helix	99.14
4gyw_A		723	UDP-N-acetylglucosamine--peptide N- acetylglucosam	99.14
1pjx_A		314	Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries	99.13
4gyw_A		723	UDP-N-acetylglucosamine--peptide N- acetylglucosam	99.13
4abn_A		474	Tetratricopeptide repeat protein 5; P53 cofactor,	99.12
1xnf_A		275	Lipoprotein NLPI; TPR, tetratricopeptide, structur	99.12
3c75_H		426	MADH, methylamine dehydrogenase heavy chain; coppe	99.1
3hrp_A		409	Uncharacterized protein; NP_812590.1, structural g	99.07
2vq2_A		225	PILW, putative fimbrial biogenesis and twitching m	99.07
2ho1_A		252	Type 4 fimbrial biogenesis protein PILF; type IV p	99.06
3iuj_A		693	Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas	99.06
3edt_B		283	KLC 2, kinesin light chain 2; superhelical, struct	99.04
1xip_A		388	Nucleoporin NUP159; beta-propeller, transport prot	99.04
2ifu_A		307	Gamma-SNAP; membrane fusion, snare complex disasse	99.03
2q7f_A		243	YRRB protein; TPR, protein binding; 2.49A {Bacillu	99.03
3hrp_A		409	Uncharacterized protein; NP_812590.1, structural g	99.01
3v9f_A		781	Two-component system sensor histidine kinase/RESP	99.01
1xip_A		388	Nucleoporin NUP159; beta-propeller, transport prot	99.01
2vq2_A		225	PILW, putative fimbrial biogenesis and twitching m	98.99
3c75_H		426	MADH, methylamine dehydrogenase heavy chain; coppe	98.99
3g4e_A		297	Regucalcin; six bladed beta-propeller, gluconolcat	98.95
2ond_A		308	Cleavage stimulation factor 77 kDa subunit; HAT do	98.95
2ghs_A		326	AGR_C_1268P; regucalcin, structural genomics, join	98.91
3q7m_A		376	Lipoprotein YFGL, BAMB; beta-propeller, BAM comple	98.9
2qe8_A		343	Uncharacterized protein; structural genomics, join	98.88
3qky_A		261	Outer membrane assembly lipoprotein YFIO; membrane	98.86
4i17_A		228	Hypothetical protein; TPR repeats protein, structu	98.85
3dr2_A		305	Exported gluconolactonase; gluconolactonase SMP-30	98.85
3qky_A		261	Outer membrane assembly lipoprotein YFIO; membrane	98.84
2ond_A		308	Cleavage stimulation factor 77 kDa subunit; HAT do	98.83
4i17_A		228	Hypothetical protein; TPR repeats protein, structu	98.81
3gw4_A		203	Uncharacterized protein; structural genomics, PSI-	98.8
2qe8_A		343	Uncharacterized protein; structural genomics, join	98.8
3as5_A		186	MAMA; tetratricopeptide repeats (TPR) containing p	98.79
3as5_A		186	MAMA; tetratricopeptide repeats (TPR) containing p	98.77
4ga2_A		150	E3 SUMO-protein ligase ranbp2; TPR motif, nuclear	98.75
3lvg_A		624	Clathrin heavy chain 1; SELF assembly, coated PIT,	98.74
1yiq_A		689	Quinohemoprotein alcohol dehydrogenase; electron t	98.74
1mda_H		368	Methylamine dehydrogenase (heavy subunit); electro	98.71
4ga2_A		150	E3 SUMO-protein ligase ranbp2; TPR motif, nuclear	98.71
3q7m_A		376	Lipoprotein YFGL, BAMB; beta-propeller, BAM comple	98.7
2hz6_A		369	Endoplasmic reticulum to nucleus signalling 1 isof	98.68
3u3w_A		293	Transcriptional activator PLCR protein; ternary co	98.67
1mda_H		368	Methylamine dehydrogenase (heavy subunit); electro	98.66
2pzi_A		681	Probable serine/threonine-protein kinase PKNG; ATP	98.65
2pzi_A		681	Probable serine/threonine-protein kinase PKNG; ATP	98.65
3hxj_A		330	Pyrrolo-quinoline quinone; all beta protein. incom	98.65
3gw4_A		203	Uncharacterized protein; structural genomics, PSI-	98.65
2fp8_A		322	Strictosidine synthase; six bladed beta propeller	98.64
3urz_A		208	Uncharacterized protein; tetratricopeptide repeats	98.64
2qfc_A		293	PLCR protein; TPR, HTH, transcription regulation;	98.62
2qfc_A		293	PLCR protein; TPR, HTH, transcription regulation;	98.61
3ro3_A		164	PINS homolog, G-protein-signaling modulator 2; asy	98.6
2yhc_A		225	BAMD, UPF0169 lipoprotein YFIO; essential BAM comp	98.6
1kb0_A		677	Quinohemoprotein alcohol dehydrogenase; beta-prope	98.6
2yhc_A		225	BAMD, UPF0169 lipoprotein YFIO; essential BAM comp	98.6
3urz_A		208	Uncharacterized protein; tetratricopeptide repeats	98.59
1fwx_A		595	Nitrous oxide reductase; beta-propeller domain, cu	98.56
2ece_A		462	462AA long hypothetical selenium-binding protein;	98.54
2r5s_A		176	Uncharacterized protein VP0806; APC090868.1, vibri	98.54
3hxj_A		330	Pyrrolo-quinoline quinone; all beta protein. incom	98.52
2ece_A		462	462AA long hypothetical selenium-binding protein;	98.52
3u3w_A		293	Transcriptional activator PLCR protein; ternary co	98.5
3qou_A		287	Protein YBBN; thioredoxin-like fold, tetratricopep	98.5
3gyz_A		151	Chaperone protein IPGC; asymmetric homodimer, tetr	98.5
1kb0_A		677	Quinohemoprotein alcohol dehydrogenase; beta-prope	98.48
4gco_A		126	Protein STI-1; structural genomics, PSI-biology, m	98.48
3rjv_A		212	Putative SEL1 repeat protein; alpha-alpha superhel	98.45
3gyz_A		151	Chaperone protein IPGC; asymmetric homodimer, tetr	98.44
2r5s_A		176	Uncharacterized protein VP0806; APC090868.1, vibri	98.44
3mkq_B		177	Coatomer subunit alpha; beta-propeller, alpha-sole	98.44
3qou_A		287	Protein YBBN; thioredoxin-like fold, tetratricopep	98.43
2hz6_A		369	Endoplasmic reticulum to nucleus signalling 1 isof	98.42
4gco_A		126	Protein STI-1; structural genomics, PSI-biology, m	98.42
1fwx_A		595	Nitrous oxide reductase; beta-propeller domain, cu	98.41
2p4o_A		306	Hypothetical protein; putative lactonase, structur	98.41
4gcn_A		127	Protein STI-1; structural genomics, PSI-biology, m	98.39
3ro3_A		164	PINS homolog, G-protein-signaling modulator 2; asy	98.37
1npe_A		267	Nidogen, entactin; glycoprotein, basement membrane	98.35
4gcn_A		127	Protein STI-1; structural genomics, PSI-biology, m	98.34
1npe_A		267	Nidogen, entactin; glycoprotein, basement membrane	98.33
3n71_A		490	Histone lysine methyltransferase SMYD1; heart deve	98.32
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	98.32
2vsy_A		568	XCC0866; transferase, glycosyl transferase, GT-B,	98.31
3n71_A		490	Histone lysine methyltransferase SMYD1; heart deve	98.31
3mv2_B		310	Coatomer subunit epsilon; vesicular membrane coat	98.29
3mv2_B		310	Coatomer subunit epsilon; vesicular membrane coat	98.29
2xe4_A		751	Oligopeptidase B; hydrolase-inhibitor complex, hyd	98.29
3rjv_A		212	Putative SEL1 repeat protein; alpha-alpha superhel	98.28
2vsy_A		568	XCC0866; transferase, glycosyl transferase, GT-B,	98.28
2iwa_A		266	Glutamine cyclotransferase; pyroglutamate, acyltra	98.28
4g26_A		501	Pentatricopeptide repeat-containing protein AT2G3	98.27
4e6h_A		679	MRNA 3'-END-processing protein RNA14; HAT domain,	98.26
2xe4_A		751	Oligopeptidase B; hydrolase-inhibitor complex, hyd	98.25
4g26_A		501	Pentatricopeptide repeat-containing protein AT2G3	98.25
4b4t_Q		434	26S proteasome regulatory subunit RPN6; hydrolase,	98.23
1yiq_A		689	Quinohemoprotein alcohol dehydrogenase; electron t	98.23
4b4t_Q		434	26S proteasome regulatory subunit RPN6; hydrolase,	98.21
2fo7_A		136	Synthetic consensus TPR protein; tetratricopeptide	98.2
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	98.18
2xbg_A		327	YCF48-like protein; photosynthesis, photosystem II	98.17
2vgx_A		148	Chaperone SYCD; alternative dimer assembly, tetrat	98.16
1a17_A		166	Serine/threonine protein phosphatase 5; hydrolase,	98.14
2hr2_A		159	Hypothetical protein; alpha-alpha superhelix fold,	98.13
4f3v_A		282	ESX-1 secretion system protein ECCA1; tetratricope	98.11
2fo7_A		136	Synthetic consensus TPR protein; tetratricopeptide	98.11
2iwa_A		266	Glutamine cyclotransferase; pyroglutamate, acyltra	98.09
1kv9_A		668	Type II quinohemoprotein alcohol dehydrogenase; el	98.08
2fp8_A		322	Strictosidine synthase; six bladed beta propeller	98.08
1p5q_A		336	FKBP52, FK506-binding protein 4; isomerase; 2.80A	98.08
3nol_A		262	Glutamine cyclotransferase; beta-propeller, glutam	98.08
3s94_A		619	LRP-6, low-density lipoprotein receptor-related pr	98.07
1hh8_A		213	P67PHOX, NCF-2, neutrophil cytosol factor 2; cell	98.07
3upv_A		126	Heat shock protein STI1; TPR-fold, adaptor protein	98.06
1hh8_A		213	P67PHOX, NCF-2, neutrophil cytosol factor 2; cell	98.06
1k3i_A		656	Galactose oxidase precursor; blade beta propeller,	98.05
1a17_A		166	Serine/threonine protein phosphatase 5; hydrolase,	98.04
2vgx_A		148	Chaperone SYCD; alternative dimer assembly, tetrat	98.04
2xbg_A		327	YCF48-like protein; photosynthesis, photosystem II	98.03
2hr2_A		159	Hypothetical protein; alpha-alpha superhelix fold,	98.01
3qqz_A		255	Putative uncharacterized protein YJIK; MCSG, PSI-2	98.01
4e6h_A		679	MRNA 3'-END-processing protein RNA14; HAT domain,	98.01
2xcb_A		142	PCRH, regulatory protein PCRH; protein transport,	97.99
1w6s_A		599	Methanol dehydrogenase subunit 1; anisotropic, ele	97.99
3upv_A		126	Heat shock protein STI1; TPR-fold, adaptor protein	97.99
2ad6_A		571	Methanol dehydrogenase subunit 1; PQQ configuratio	97.99
1p5q_A		336	FKBP52, FK506-binding protein 4; isomerase; 2.80A	97.98
3tc9_A		430	Hypothetical hydrolase; 6-bladed beta-propeller, i	97.98
3nok_A		268	Glutaminyl cyclase; beta-propeller, cyclotransfera	97.98
4f3v_A		282	ESX-1 secretion system protein ECCA1; tetratricope	97.97
3nol_A		262	Glutamine cyclotransferase; beta-propeller, glutam	97.94
2xcb_A		142	PCRH, regulatory protein PCRH; protein transport,	97.93
3sz7_A		164	HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G	97.93
3mbr_X		243	Glutamine cyclotransferase; beta-propeller; 1.44A	97.92
1k3i_A		656	Galactose oxidase precursor; blade beta propeller,	97.92
1kv9_A		668	Type II quinohemoprotein alcohol dehydrogenase; el	97.89
2vyi_A		131	SGTA protein; chaperone, TPR repeat, phosphoprotei	97.87
1hxi_A		121	PEX5, peroxisome targeting signal 1 receptor PEX5;	97.86
3sz7_A		164	HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G	97.86
2lni_A		133	Stress-induced-phosphoprotein 1; structural genomi	97.86
3rkv_A		162	Putative peptidylprolyl isomerase; structural geno	97.85
3q49_B		137	STIP1 homology and U box-containing protein 1; E3	97.85
2p4o_A		306	Hypothetical protein; putative lactonase, structur	97.83
1na0_A		125	Designed protein CTPR3; de novo protein; HET: IPT;	97.83
2vyi_A		131	SGTA protein; chaperone, TPR repeat, phosphoprotei	97.83
4hw6_A		433	Hypothetical protein, IPT/TIG domain protein; puta	97.8
3ei3_A		1158	DNA damage-binding protein 1; UV-damage, DDB, nucl	97.8
3mbr_X		243	Glutamine cyclotransferase; beta-propeller; 1.44A	97.8
2fbn_A		198	70 kDa peptidylprolyl isomerase, putative; sulfur	97.78
2lni_A		133	Stress-induced-phosphoprotein 1; structural genomi	97.78
4hw6_A		433	Hypothetical protein, IPT/TIG domain protein; puta	97.78
3nok_A		268	Glutaminyl cyclase; beta-propeller, cyclotransfera	97.78
3dra_A		306	Protein farnesyltransferase/geranylgeranyltransfer	97.76
3dra_A		306	Protein farnesyltransferase/geranylgeranyltransfer	97.74
3rkv_A		162	Putative peptidylprolyl isomerase; structural geno	97.74
1kt0_A		457	FKBP51, 51 kDa FK506-binding protein; FKBP-like pp	97.74
2e2e_A		177	Formate-dependent nitrite reductase complex NRFG;	97.72
1hxi_A		121	PEX5, peroxisome targeting signal 1 receptor PEX5;	97.72
3tc9_A		430	Hypothetical hydrolase; 6-bladed beta-propeller, i	97.71
4a0p_A		628	LRP6, LRP-6, low-density lipoprotein receptor-rela	97.71
2e2e_A		177	Formate-dependent nitrite reductase complex NRFG;	97.71
3v64_C		349	Agrin; beta propeller, laminin-G, signaling, prote	97.7
2if4_A		338	ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha,	97.69
1flg_A		582	Protein (quinoprotein ethanol dehydrogenase); supe	97.69
3q49_B		137	STIP1 homology and U box-containing protein 1; E3	97.69
1elw_A		118	TPR1-domain of HOP; HOP, TPR-domain, peptide-compl	97.67
1ihg_A		370	Cyclophilin 40; ppiase immunophilin tetratricopept	97.67
1ihg_A		370	Cyclophilin 40; ppiase immunophilin tetratricopept	97.67
4a0p_A		628	LRP6, LRP-6, low-density lipoprotein receptor-rela	97.66
3ei3_A		1158	DNA damage-binding protein 1; UV-damage, DDB, nucl	97.66
1kt0_A		457	FKBP51, 51 kDa FK506-binding protein; FKBP-like pp	97.66
3s94_A		619	LRP-6, low-density lipoprotein receptor-related pr	97.66
2fbn_A		198	70 kDa peptidylprolyl isomerase, putative; sulfur	97.65
1elr_A		131	TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp	97.65
2ad6_A		571	Methanol dehydrogenase subunit 1; PQQ configuratio	97.63
1na0_A		125	Designed protein CTPR3; de novo protein; HET: IPT;	97.62
3qqz_A		255	Putative uncharacterized protein YJIK; MCSG, PSI-2	97.61
3ott_A		758	Two-component system sensor histidine kinase; beta	97.61
1elw_A		118	TPR1-domain of HOP; HOP, TPR-domain, peptide-compl	97.6
3v65_B		386	Low-density lipoprotein receptor-related protein;	97.56
1wao_1		477	Serine/threonine protein phosphatase 5; hydrolase,	97.55
2kck_A		112	TPR repeat; tetratricopeptide repeat, structural g	97.54
2xev_A		129	YBGF; tetratricopeptide, alpha-helical, metal bind	97.54
2dba_A		148	Smooth muscle cell associated protein-1, isoform 2	97.53
1ijq_A		316	LDL receptor, low-density lipoprotein receptor; be	97.53
3v64_C		349	Agrin; beta propeller, laminin-G, signaling, prote	97.51
1ijq_A		316	LDL receptor, low-density lipoprotein receptor; be	97.49
2if4_A		338	ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha,	97.49
1elr_A		131	TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp	97.48
2dba_A		148	Smooth muscle cell associated protein-1, isoform 2	97.46
3qww_A		433	SET and MYND domain-containing protein 2; methyltr	97.46
1w6s_A		599	Methanol dehydrogenase subunit 1; anisotropic, ele	97.42
2xev_A		129	YBGF; tetratricopeptide, alpha-helical, metal bind	97.41
2kck_A		112	TPR repeat; tetratricopeptide repeat, structural g	97.4
1zu2_A		158	Mitochondrial import receptor subunit TOM20-3; TPR	97.39
3qww_A		433	SET and MYND domain-containing protein 2; methyltr	97.39
1flg_A		582	Protein (quinoprotein ethanol dehydrogenase); supe	97.38
3ott_A		758	Two-component system sensor histidine kinase; beta	97.37
1wao_1		477	Serine/threonine protein phosphatase 5; hydrolase,	97.37
2ism_A		352	Putative oxidoreductase; BL41XU spring-8, bladed b	97.36
3k9i_A		117	BH0479 protein; putative protein binding protein,	97.35
3v65_B		386	Low-density lipoprotein receptor-related protein;	97.35
3qwp_A		429	SET and MYND domain-containing protein 3; SMYD3,SE	97.34
3p5b_L		400	Low density lipoprotein receptor variant; B-propel	97.34
3p5b_L		400	Low density lipoprotein receptor variant; B-propel	97.33
3kya_A		496	Putative phosphatase; structural genomics, joint c	97.31
3a9g_A		354	Putative uncharacterized protein; PQQ dependent de	97.31
3k9i_A		117	BH0479 protein; putative protein binding protein,	97.31
3sov_A		318	LRP-6, low-density lipoprotein receptor-related pr	97.28
3qwp_A		429	SET and MYND domain-containing protein 3; SMYD3,SE	97.21
3sov_A		318	LRP-6, low-density lipoprotein receptor-related pr	97.19
3kya_A		496	Putative phosphatase; structural genomics, joint c	97.19
3sre_A		355	PON1, serum paraoxonase; directed evolution, 6-bla	97.17
2g8s_A		353	Glucose/sorbosone dehydrogenases; bladed beta-prop	97.16
2p9w_A		334	MAL S 1 allergenic protein; beta propeller; 1.35A	97.16
2l6j_A		111	TPR repeat-containing protein associated with HSP;	97.16
2xzh_A		365	Clathrin heavy chain 1; endocytosis, endocytosis i	97.13
1na3_A		91	Designed protein CTPR2; de novo protein; HET: IPT;	97.1
2pm7_A		399	Protein WEB1, protein transport protein SEC31; bet	97.06

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

Probab=100.00  E-value=1.6e-51  Score=555.64  Aligned_cols=723  Identities=13%  Similarity=0.125  Sum_probs=518.2

Q ss_pred             eecCCCCCceeEEEEcCCCCEEEEEeCCCeEEEEEcCCCC-------cccceEEEEECCCCCeEEEEECCCeEEEEEcCC
Q psy12802          5 KYTDVSSNVLQDDVFNLDIVRLRSEGNVAGIWAWRGQNGR-------KSYVVKGLAFSPDSTKLAVAQSDNIIFIYKLGD   77 (1637)
Q Consensus         5 k~~~~~~~~i~~~~~spdg~~la~~~~d~~i~vwd~~~~~-------h~~~V~~~~~spd~~~la~~~~d~~i~iw~~~~   77 (1637)
                      +....|+..|++++|||||++|++++.+|.|++||..+++       |...|++++|+|++++|++++.||.|++||+.+
T Consensus         7 ~~~~~h~~~v~~i~~sp~~~~la~~~~~g~v~iwd~~~~~~~~~~~~~~~~v~~~~~s~~~~~l~~~~~dg~i~vw~~~~   86 (814)
T 3mkq_A            7 KTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNT   86 (814)
T ss_dssp             EEEEEECSCEEEEEECSSSSEEEEEETTSEEEEEETTTTEEEEEEECCSSCEEEEEEEGGGTEEEEEETTSEEEEEETTT
T ss_pred             eeeecCCCceEEEEECCCCCEEEEEeCCCEEEEEECCCCceEEEEecCCCcEEEEEEeCCCCEEEEEeCCCeEEEEECCC
Confidence            3445688999999999999999999999999999998765       788999999999999999999999999999987


Q ss_pred             CCCCceeEeeccCCCCCEEEEEEcCCCC-EEEEeCCCcEEEEEcCCC-ce-eeecccCCcEEEEEEec-CCCeEEEEeCC
Q psy12802         78 DWGDKKVICNKFIQQCPVTTMVWLADGP-IIYGQSDGKIKAAHVKAN-KT-QTLYASNSFVVALCLNV-RGAGVLSGHAD  153 (1637)
Q Consensus        78 ~~~~~~~~~~~~~~~~~v~~v~~s~~~~-l~~~~~d~~v~vwd~~~~-~~-~~~~~~~~~v~~l~~s~-~g~~l~s~~~d  153 (1637)
                      +    +.+....+|.+.|++++|+|+++ +++++.||.|++||+.++ .. ..+.+|...|.+++|+| +++.|++++.|
T Consensus        87 ~----~~~~~~~~~~~~v~~~~~s~~~~~l~~~~~dg~i~vw~~~~~~~~~~~~~~~~~~v~~~~~~p~~~~~l~~~~~d  162 (814)
T 3mkq_A           87 G----EKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLD  162 (814)
T ss_dssp             C----CEEEEEECCSSCEEEEEECSSSSEEEEEETTSEEEEEEGGGTSEEEEEEECCSSCEEEEEEETTEEEEEEEEETT
T ss_pred             C----cEEEEEecCCCCEEEEEEeCCCCEEEEEcCCCEEEEEECCCCceEEEEEcCCCCcEEEEEEEcCCCCEEEEEeCC
Confidence            5    45556668999999999999999 999999999999999987 44 77889999999999999 89999999999


Q ss_pred             CcEEEEEecCCCCccccccccccc-CCCCcEEEEecC--C--eEEEEecCCeEEEEe-CCCceeEEeeccCCCCCCccEE
Q psy12802        154 GSIVRYYVTEDASNFDQQQGRVVQ-HPVPPYALSWPA--G--YILAAGSDRIVTIYE-SDGRVHRIFDYTAPHYKEREFT  227 (1637)
Q Consensus       154 g~i~iwd~~~~~~g~~~~~~~~~~-~~~~v~~~~~~~--~--~l~~~~~d~~i~iwd-~~~~~~~~~~~~~~~~~~~~i~  227 (1637)
                      |+|++||+...     .....+.. +...+.+++|+|  +  .+++++.||.|++|| .+++.+..+.     .|...|+
T Consensus       163 g~v~vwd~~~~-----~~~~~~~~~~~~~v~~~~~~~~~~~~~l~~~~~dg~i~~~d~~~~~~~~~~~-----~~~~~v~  232 (814)
T 3mkq_A          163 RTVKVWSLGQS-----TPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLE-----GHMSNVS  232 (814)
T ss_dssp             SEEEEEETTCS-----SCSEEEECCCTTCCCEEEECCSTTCCEEEEECTTSEEEEEETTTTEEEEEEE-----CCSSCEE
T ss_pred             CeEEEEECCCC-----cceeEEecCCCCCEEEEEEEECCCCCEEEEEeCCCEEEEEECCCCcEEEEEc-----CCCCCEE
Confidence            99999999764     34444444 448999999986  3  899999999999999 7888888887     4666899


Q ss_pred             EEEECCCCCEEEEEecCc-EEEEEeCCCCCccccCCCcccCCCcceeEEEEcCCCCE-EEEEecCCcEEEEEccccceee
Q psy12802        228 VACSSPSGQAVVVGSYDN-IKLFAWSPSKSVWEEQPNKTIPNLYTISALSWKRDGSR-IACGGLCGSVELFESVLKRTIW  305 (1637)
Q Consensus       228 ~~~~sp~g~~l~~~~~d~-i~i~~~~~~~~~~~~~~~~~~~~~~~i~~l~~spdg~~-l~~~~~dg~v~iwd~~~~~~~~  305 (1637)
                      +++|+|+|+.+++++.|+ |++|+..+.....     ....+...+.+++|+|+|.. +++++.++.+.+|++...... 
T Consensus       233 ~~~~~~~~~~l~~~~~dg~v~vwd~~~~~~~~-----~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-  306 (814)
T 3mkq_A          233 FAVFHPTLPIIISGSEDGTLKIWNSSTYKVEK-----TLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSLGNDEPT-  306 (814)
T ss_dssp             EEEECSSSSEEEEEETTSCEEEEETTTCSEEE-----EECCSSSSEEEEEECTTCGGGEEEEEETTEEEEEECSCCSCC-
T ss_pred             EEEEcCCCCEEEEEeCCCeEEEEECCCCcEEE-----EeecCCCcEEEEEEccCCCceEEEEEeCCCEEEEEcCCCCce-
Confidence            999999999999999999 9999988765432     22334568999999999974 244555777889987544321 


Q ss_pred             eCcEEEEEecCCeEEEec-------------C------CCCCC-CceeEEecccCceeeEEEEecCceEEEEeCCCcEEE
Q psy12802        306 KGKFEMIYVSPSQVLVKP-------------L------SGESK-GRGVILKSQYGYEITDVAIMGNDRYLVARTPDTLLL  365 (1637)
Q Consensus       306 ~~~~~~~~~~~~~~~v~~-------------~------~~~~~-~~~~~~~~~~~~~i~~v~~s~~~~~lv~~~~~~i~i  365 (1637)
                           ..+...+..+...             +      ..+.. .............+.+++|+|+|+++++++++.+.+
T Consensus       307 -----~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~spdg~~la~~~~~~~~i  381 (814)
T 3mkq_A          307 -----LSLDPVGKLVWSGGKNAAASDIFTAVIRGNEEVEQDEPLSLQTKELGSVDVFPQSLAHSPNGRFVTVVGDGEYVI  381 (814)
T ss_dssp             -----EEECSSSEEEEECCTTSCTTCEEEEECCSCCCCCSSSCBCCCCEEECCCSSCCSEEEECTTSSEEEEEETTEEEE
T ss_pred             -----eEECCCCCEEEECcccccceeeeeeecccccccccCccceeeeecCCCCccCCceeEECCCCCEEEEecCCEEEE
Confidence                 1111111111100             0      00000 000111122333567777777777777766777777


Q ss_pred             eeccccceeeeecCCCCCCceeEecCceEEEEEeCCccEEEEecCCceeeeeeeeeeccCCCCcccccCCCccCCCccee
Q psy12802        366 GDLHRNLLSEVLWPDSGRNEKFYFDNVTVCLVFNAGELSIIEYGNNEILTCVSIKLFAWSPSKSVWEEQPNKTIPNLYTI  445 (1637)
Q Consensus       366 ~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~i~~~~~~~~~~~w~~~~~~~~~~~~~I  445 (1637)
                      |++..       |                                                           ...+.+.|
T Consensus       382 ~~~~~-------~-----------------------------------------------------------~~~~~~~i  395 (814)
T 3mkq_A          382 YTALA-------W-----------------------------------------------------------RNKAFGKC  395 (814)
T ss_dssp             EETTT-------T-----------------------------------------------------------EEEEEEEC
T ss_pred             EECcc-------c-----------------------------------------------------------cccCCCce
Confidence            76422       1                                                           00223567


Q ss_pred             eeeeeccCCCeEEeeccCCcEEEehhhhhhhhhcCceeEEEecCCceEEeeccCCCCCceeEEeeccceeeeeEEEecCc
Q psy12802        446 SALSWKRDGSRIACGGLCGSVELFESVLKRTIWKGKFEMIYVSPSQVLVKPLSGESKGRGVILKSQYGYEITDVAIMGND  525 (1637)
Q Consensus       446 ~~l~~s~dg~~la~g~~dg~v~lw~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~l~~~~~~~~~~i~i~~~~  525 (1637)
                      ++++|||||+++++++.+|.|++|+...                         ++.                        
T Consensus       396 ~~~~~spdg~~la~~~~~g~v~l~~~~~-------------------------~~~------------------------  426 (814)
T 3mkq_A          396 QDFVWGPDSNSYALIDETGQIKYYKNFK-------------------------EVT------------------------  426 (814)
T ss_dssp             SEEEECTTSSCEEEECTTCCEEEEETTE-------------------------ECT------------------------
T ss_pred             EEEEEeCCCCeEEEEeCCCcEEEEECCC-------------------------Ccc------------------------
Confidence            8999999999999999999998885210                         000                        


Q ss_pred             ceEeeccccccccCcccccccccccccccccCCC---ceEEEeeccceEEEEEccCCcceEEecccCCccEEEeCcCcce
Q psy12802        526 RYLVARTLLTEFMNPHLISVRLNERKQVHSQQEN---KKLAYLLDLHTICVIDLITNLPTLHINHDSKIDWLELNETAHK  602 (1637)
Q Consensus       526 ~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~s~d~---~~la~~~~~~~i~v~dl~~~~~~~~~~~~~~i~~l~~s~~g~~  602 (1637)
                                    ..+.       .+. |+|||   +.+++++.+++|++||+.+++.+..+.+...  .+.|||+|++
T Consensus       427 --------------~~v~-------~~~-~s~dg~~~~~l~~~~~d~~v~~~d~~~~~~~~~~~~~~~--~v~~s~dg~~  482 (814)
T 3mkq_A          427 --------------SWSV-------PMH-SAIDRLFSGALLGVKSDGFVYFFDWDNGTLVRRIDVNAK--DVIWSDNGEL  482 (814)
T ss_dssp             --------------TCCC-------CCS-SCCCEEECSSSEEEEETTEEEEECTTTCCEEEEESSCEE--EEEECTTSSE
T ss_pred             --------------ceEE-------cCC-cCccceecceEEEEecCCEEEEEECCcCcEEEEEecCCC--EEEEcCCCCE
Confidence                          1111       222 88888   6888999999999999999999888854443  9999999999


Q ss_pred             eEee------cccceEEEEecc------------------cccee---eecccceEEEEecCCceeEecc-ccceeEEEe
Q psy12802        603 LLYR------DKKMRLTLLDIR------------------TSEKH---NILNYCTFVQWLPGSDVVVAQS-RHNACVWYN  654 (1637)
Q Consensus       603 L~~~------~~~~~~~l~d~~------------------t~~~~---~l~~~~~~v~w~~~~~~l~~~~-~~~l~v~~~  654 (1637)
                      |++.      +.+..+.+|.-.                  .....   .+...+.+..|.  +++++..+ .+.+..+. 
T Consensus       483 la~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~s~~w~--~~~~i~~t~~~~~~~~~-  559 (814)
T 3mkq_A          483 VMIVNTNSNGDEASGYTLLFNKDAYLEAANNGNIDDSEGVDEAFDVLYELSESITSGKWV--GDVFIFTTATNRLNYFV-  559 (814)
T ss_dssp             EEEEECCCSSCSCSEEEEEECHHHHHHHHHHTCCBTTTBCTTTEEEEEEECSCCSEEEEE--TTEEEEECTTSEEEEEE-
T ss_pred             EEEEEcCcccCCceEEEEEechHHhhhhhhccCCccccchhhheeeeeEeccEEEeeEEe--CCEEEEEcCCCeEEEEe-
Confidence            9999      666555454321                  00111   123456677886  45666654 34444322 


Q ss_pred             cCCCCceeeecccCceEEEE-ecCCceEEEeccCCccccccchhhhhhhhcccccccHHHHHH-HHHHcCCChhhHHHHH
Q psy12802        655 IDTPDRITQFPVRGDIIDVI-RENGQSEILTQDGNHQLGYELDESLIEFGTAVHDSDFGKAIL-YLESLGINKKEAEGMW  732 (1637)
Q Consensus       655 ~~~~~~~~~~~~~~~v~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~A~~-~~~~~~~~~~~~~~~w  732 (1637)
                        .++..++......+..+- ..++....++.+......+.++...+.|.+++..++++.|.. ++..++.    .... 
T Consensus       560 --~~~~~~~~~~~~~~~~~~~~~~~~~l~~~d~~~~~~~~~l~~~~~~~~~~~~~~~~~~a~~~~l~~i~~----~~~~-  632 (814)
T 3mkq_A          560 --GGKTYNLAHYTKEMYLLGYLARDNKVYLADREVHVYGYEISLEVLEFQTLTLRGEIEEAIENVLPNVEG----KDSL-  632 (814)
T ss_dssp             --TTEEEEEEECSSCCEEEEEEGGGTEEEEECTTCCEEEEECCHHHHHHHHHHHTTCHHHHHHHTGGGCCC----HHHH-
T ss_pred             --CCeeEEEEECCccEEEEEEEecCCEEEEEcCCCCEEEEEECcHHHHHhHHHHhCCHHHHHHHHHhcCCc----hHHH-
Confidence              233333333333332211 123444444555566778888999999999999999999877 5544320    0111 


Q ss_pred             HHHHHHHHHhcCHhHHHHHHHhhcCcchhHHHHHHhhhhhhhhcccCCCCCCchHHHHHHHHHHhcCHHHHHHHHHhcCc
Q psy12802        733 QNLAEVAIQLHNLHVAEICYAALGDISTTHFLRETIKIGEVWSKENNIGDPLQCPELWARMAILNKQFKVAEGIYLENNE  812 (1637)
Q Consensus       733 ~~l~~~~l~~~~~~~A~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~a~~a~~~~~~~~A~~~~~~~~~  812 (1637)
                      ..++.                                                       .....|.+++|....   .+
T Consensus       633 ~~~~~-------------------------------------------------------~l~~~~~~~~a~~~~---~~  654 (814)
T 3mkq_A          633 TKIAR-------------------------------------------------------FLEGQEYYEEALNIS---PD  654 (814)
T ss_dssp             HHHHH-------------------------------------------------------HHHHTTCHHHHHHHC---CC
T ss_pred             HHHHH-------------------------------------------------------HHHhCCChHHheecC---CC
Confidence            11111                                                       122233333333321   23


Q ss_pred             HHHHHHHHHHcCCHHHHHHHHHhcCcchHHHHHHHHHHHHhcccHHHHHHHHHHcCCHHHHHHHHHHhCCHHHHHHHHHc
Q psy12802        813 IHKAIDMYLKLYKWEDALSLAETNNYEYNELKKKYIKWLTDTRQEDKAGELYEKEGDHQTALNYYLKANFTSKACNLVQN  892 (1637)
Q Consensus       813 ~~~a~~~~~~l~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~A~~~~~~~g~~~~Ai~~y~~~~~~~~a~~l~~~  892 (1637)
                      .....+++..+++|++|+++++....  +..             ++++|+++.+.|+++.|+.+|.++++++.+..|...
T Consensus       655 ~~~~f~~~l~~~~~~~A~~~~~~~~~--~~~-------------W~~la~~al~~~~~~~A~~~y~~~~d~~~l~~l~~~  719 (814)
T 3mkq_A          655 QDQKFELALKVGQLTLARDLLTDESA--EMK-------------WRALGDASLQRFNFKLAIEAFTNAHDLESLFLLHSS  719 (814)
T ss_dssp             HHHHHHHHHHHTCHHHHHHHHTTCCC--HHH-------------HHHHHHHHHHTTCHHHHHHHHHHHTCHHHHHHHHHH
T ss_pred             cchheehhhhcCCHHHHHHHHHhhCc--HhH-------------HHHHHHHHHHcCCHHHHHHHHHHccChhhhHHHHHH
Confidence            34445566677888888777766542  233             334466677777777777777777777777666665


Q ss_pred             CCCCCCCHHHHHHHHHHHHhCCcHHHHHHHHHHcCCHHHHHHHHHhCCChHHHHHHHHHhCCCC--hHHHHHHHHHHHHh
Q psy12802        893 EPYLLENHDVVSQIVKGLIKNESYIKAGQIYEFTNENEKALECYRKGKVYDKCIDLTRKINPKN--VTALEEEWGDHLIE  970 (1637)
Q Consensus       893 ~~~~~~~~~~~~~~~~~l~~~g~~~~A~~~~~~~~~~~~a~~~y~~~~~~~~A~~l~~~~~~~~--~~~l~~~~~~~l~~  970 (1637)
                      .    .+.+.+..++......|+++.|..+|.+.|++++|+++|.+.++|++|+.+++...|.+  +..+...|+..|..
T Consensus       720 ~----~~~~~~~~~~~~a~~~~~~~~A~~~~~~~g~~~~a~~~~~~~~~~~~A~~lA~~~~~~~~~i~~~~~~~~~~L~~  795 (814)
T 3mkq_A          720 F----NNKEGLVTLAKDAETTGKFNLAFNAYWIAGDIQGAKDLLIKSQRFSEAAFLGSTYGLGDNEVNDIVTKWKENLIL  795 (814)
T ss_dssp             T----TCHHHHHHHHHHHHHTTCHHHHHHHHHHHTCHHHHHHHHHHTTCHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHT
T ss_pred             c----CCHHHHHHHHHHHHHcCchHHHHHHHHHcCCHHHHHHHHHHcCChHHHHHHHHHhCCChHHHHHHHHHHHHHHHh
Confidence            2    46677778888889999999999999999999999999999999999999999999999  89999999999999


Q ss_pred             cccHHHHH
Q psy12802        971 NKQYNAAI  978 (1637)
Q Consensus       971 ~~~~~~A~  978 (1637)
                      .|+++.|.
T Consensus       796 ~~~~~~a~  803 (814)
T 3mkq_A          796 NGKNTVSE  803 (814)
T ss_dssp             TTCHHHHT
T ss_pred             ccchhHHH
Confidence            99865443

PyMOL of 3mkq

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme}	Back alignment and structure

>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A	Back alignment and structure

>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme}	Back alignment and structure

>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A	Back alignment and structure

>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A	Back alignment and structure

>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B*	Back alignment and structure

>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1	Back alignment and structure

>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens}	Back alignment and structure

>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis}	Back alignment and structure

>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens}	Back alignment and structure

>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus}	Back alignment and structure

>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens}	Back alignment and structure

>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R*	Back alignment and structure

>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum}	Back alignment and structure

>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis}	Back alignment and structure

>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A	Back alignment and structure

>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A	Back alignment and structure

>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1	Back alignment and structure

>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens}	Back alignment and structure

>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A	Back alignment and structure

>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R	Back alignment and structure

>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B*	Back alignment and structure

>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R*	Back alignment and structure

>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens}	Back alignment and structure

>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens}	Back alignment and structure

>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae}	Back alignment and structure

>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A	Back alignment and structure

>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae}	Back alignment and structure

>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus}	Back alignment and structure

>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ...	Back alignment and structure

>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1	Back alignment and structure

>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R	Back alignment and structure

>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum}	Back alignment and structure

>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae}	Back alignment and structure

>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae}	Back alignment and structure

>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae}	Back alignment and structure

>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A	Back alignment and structure

>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a	Back alignment and structure

>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A	Back alignment and structure

>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A	Back alignment and structure

>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli}	Back alignment and structure

>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ...	Back alignment and structure

>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae}	Back alignment and structure

>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C	Back alignment and structure

>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A	Back alignment and structure

>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B*	Back alignment and structure

>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1	Back alignment and structure

>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a	Back alignment and structure

>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A	Back alignment and structure

>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe}	Back alignment and structure

>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B*	Back alignment and structure

>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli}	Back alignment and structure

>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B*	Back alignment and structure

>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae}	Back alignment and structure

>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae}	Back alignment and structure

>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae}	Back alignment and structure

>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B*	Back alignment and structure

>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B*	Back alignment and structure

>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens}	Back alignment and structure

>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X	Back alignment and structure

>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A	Back alignment and structure

>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe}	Back alignment and structure

>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B*	Back alignment and structure

>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B*	Back alignment and structure

>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A	Back alignment and structure

>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A	Back alignment and structure

>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A*	Back alignment and structure

>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B*	Back alignment and structure

>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X	Back alignment and structure

>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens}	Back alignment and structure

>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A	Back alignment and structure

>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae}	Back alignment and structure

>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C	Back alignment and structure

>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens}	Back alignment and structure

>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe}	Back alignment and structure

>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A	Back alignment and structure

>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae}	Back alignment and structure

>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens}	Back alignment and structure

>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens}	Back alignment and structure

>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A	Back alignment and structure

>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens}	Back alignment and structure

>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A	Back alignment and structure

>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe}	Back alignment and structure

>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A*	Back alignment and structure

>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens}	Back alignment and structure

>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A	Back alignment and structure

>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A	Back alignment and structure

>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A	Back alignment and structure

>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae}	Back alignment and structure

>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1	Back alignment and structure

>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A	Back alignment and structure

>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens}	Back alignment and structure

>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A	Back alignment and structure

>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens}	Back alignment and structure

>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A	Back alignment and structure

>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens}	Back alignment and structure

>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae}	Back alignment and structure

>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1	Back alignment and structure

>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A	Back alignment and structure

>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae}	Back alignment and structure

>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A	Back alignment and structure

>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B	Back alignment and structure

>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B	Back alignment and structure

>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A	Back alignment and structure

>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3	Back alignment and structure

>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3	Back alignment and structure

>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans}	Back alignment and structure

>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans}	Back alignment and structure

>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A	Back alignment and structure

>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A	Back alignment and structure

>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe}	Back alignment and structure

>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A	Back alignment and structure

>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe}	Back alignment and structure

>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3	Back alignment and structure

>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A	Back alignment and structure

>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A*	Back alignment and structure

>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia}	Back alignment and structure

>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A	Back alignment and structure

>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A	Back alignment and structure

>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A*	Back alignment and structure

>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia}	Back alignment and structure

>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A	Back alignment and structure

>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24	Back alignment and structure

>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A*	Back alignment and structure

>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A*	Back alignment and structure

>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans}	Back alignment and structure

>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1	Back alignment and structure

>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str}	Back alignment and structure

>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24	Back alignment and structure

>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A*	Back alignment and structure

>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1	Back alignment and structure

>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B*	Back alignment and structure

>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans}	Back alignment and structure

>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens}	Back alignment and structure

>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A	Back alignment and structure

>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A*	Back alignment and structure

>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str}	Back alignment and structure

>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A	Back alignment and structure

>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae}	Back alignment and structure

>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A	Back alignment and structure

>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A	Back alignment and structure

>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A	Back alignment and structure

>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum}	Back alignment and structure

>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum}	Back alignment and structure

>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ...	Back alignment and structure

>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae}	Back alignment and structure

>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens}	Back alignment and structure

>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A	Back alignment and structure

>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ...	Back alignment and structure

>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B*	Back alignment and structure

>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A	Back alignment and structure

>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3	Back alignment and structure

>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B*	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A	Back alignment and structure

>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A	Back alignment and structure

>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp}	Back alignment and structure

>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B*	Back alignment and structure

>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus}	Back alignment and structure

>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli}	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens}	Back alignment and structure

>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli}	Back alignment and structure

>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus}	Back alignment and structure

>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp}	Back alignment and structure

>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens}	Back alignment and structure

>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1	Back alignment and structure

>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A	Back alignment and structure

>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens}	Back alignment and structure

>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1	Back alignment and structure

>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens}	Back alignment and structure

>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens}	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster}	Back alignment and structure

>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens}	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster}	Back alignment and structure

>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1	Back alignment and structure

>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A*	Back alignment and structure

>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus}	Back alignment and structure

>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A*	Back alignment and structure

>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus}	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus}	Back alignment and structure

>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis}	Back alignment and structure

>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ...	Back alignment and structure

>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A	Back alignment and structure

>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A	Back alignment and structure

>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus}	Back alignment and structure

>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis}	Back alignment and structure

>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans}	Back alignment and structure

>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A*	Back alignment and structure

>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus}	Back alignment and structure

>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A*	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus}	Back alignment and structure

>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis}	Back alignment and structure

>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A	Back alignment and structure

>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1	Back alignment and structure

>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A*	Back alignment and structure

>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus}	Back alignment and structure

>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ...	Back alignment and structure

>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A	Back alignment and structure

>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A*	Back alignment and structure

>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus}	Back alignment and structure

>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus}	Back alignment and structure

>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A	Back alignment and structure

>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis}	Back alignment and structure

>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus}	Back alignment and structure

>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum}	Back alignment and structure

>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A	Back alignment and structure

>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A*	Back alignment and structure

>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus}	Back alignment and structure

>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus}	Back alignment and structure

>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae}	Back alignment and structure

>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A*	Back alignment and structure

>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum}	Back alignment and structure

>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii}	Back alignment and structure

>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii}	Back alignment and structure

>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A	Back alignment and structure

>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A	Back alignment and structure

>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ...

Back alignment and structure

>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis}	Back alignment and structure

>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis}	Back alignment and structure

>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii}	Back alignment and structure

>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A*	Back alignment and structure

>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans}	Back alignment and structure

>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae}	Back alignment and structure

Back alignment and structure

>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens}	Back alignment and structure

>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens}	Back alignment and structure

>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1	Back alignment and structure

>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A*	Back alignment and structure

>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae}	Back alignment and structure

>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1	Back alignment and structure

>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ...	Back alignment and structure

>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens}	Back alignment and structure

>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H*	Back alignment and structure

>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ...	Back alignment and structure

>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii}	Back alignment and structure

>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2	Back alignment and structure

>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H*	Back alignment and structure

>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV}	Back alignment and structure

>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio}	Back alignment and structure

>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ...	Back alignment and structure

>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens}	Back alignment and structure

>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B	Back alignment and structure

>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A	Back alignment and structure

>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A*	Back alignment and structure

>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A	Back alignment and structure

>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1	Back alignment and structure

>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A	Back alignment and structure

>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1	Back alignment and structure

>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1	Back alignment and structure

>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus}	Back alignment and structure

>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A	Back alignment and structure

>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2	Back alignment and structure

>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A*	Back alignment and structure

>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ...	Back alignment and structure

>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A*	Back alignment and structure

>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus}	Back alignment and structure

>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1	Back alignment and structure

>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus}	Back alignment and structure

>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482}	Back alignment and structure

>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis}	Back alignment and structure

>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A	Back alignment and structure

>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A*	Back alignment and structure

>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A	Back alignment and structure

>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C*	Back alignment and structure

>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio}	Back alignment and structure

>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1	Back alignment and structure

>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482}	Back alignment and structure

>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C*	Back alignment and structure

>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis}	Back alignment and structure

>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus}	Back alignment and structure

>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B	Back alignment and structure

>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1	Back alignment and structure

>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A	Back alignment and structure

>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413}	Back alignment and structure

>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus}	Back alignment and structure

>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis}	Back alignment and structure

>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV}	Back alignment and structure

>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus}	Back alignment and structure

>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis}	Back alignment and structure

>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1}	Back alignment and structure

>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413}	Back alignment and structure

>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A	Back alignment and structure

>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A	Back alignment and structure

>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A*	Back alignment and structure

>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A	Back alignment and structure

>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida}	Back alignment and structure

>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1	Back alignment and structure

>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A*	Back alignment and structure

>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A	Back alignment and structure

>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens}	Back alignment and structure

>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A	Back alignment and structure

>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1	Back alignment and structure

>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis}	Back alignment and structure

>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis}	Back alignment and structure

>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis}	Back alignment and structure

>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1}	Back alignment and structure

>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A*	Back alignment and structure

>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus}	Back alignment and structure

>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646}	Back alignment and structure

>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646}	Back alignment and structure

>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus}	Back alignment and structure

>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A	Back alignment and structure

>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1	Back alignment and structure

>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A	Back alignment and structure

>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus}	Back alignment and structure

>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A	Back alignment and structure

>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii}	Back alignment and structure

>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus}	Back alignment and structure

>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis}	Back alignment and structure

>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii}	Back alignment and structure

>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A	Back alignment and structure

>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A*	Back alignment and structure

>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A	Back alignment and structure

>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1	Back alignment and structure

>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans}	Back alignment and structure

>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp}	Back alignment and structure

>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A	Back alignment and structure

>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus}	Back alignment and structure

>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae}	Back alignment and structure

>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A*	Back alignment and structure

>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens}	Back alignment and structure

>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans}	Back alignment and structure

>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A	Back alignment and structure

>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3	Back alignment and structure

>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans}	Back alignment and structure

>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus}	Back alignment and structure

>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1	Back alignment and structure

>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans}	Back alignment and structure

>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1	Back alignment and structure

>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus}	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A*	Back alignment and structure

>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus}	Back alignment and structure

>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B	Back alignment and structure

>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B	Back alignment and structure

>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major}	Back alignment and structure

>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp}	Back alignment and structure

>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A*	Back alignment and structure

>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A*	Back alignment and structure

>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A	Back alignment and structure

>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A	Back alignment and structure

>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major}	Back alignment and structure

>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A	Back alignment and structure

>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida}	Back alignment and structure

>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus}	Back alignment and structure

>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A*	Back alignment and structure

>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A	Back alignment and structure

>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8	Back alignment and structure

>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis}	Back alignment and structure

>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A	Back alignment and structure

>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A*	Back alignment and structure

>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1	Back alignment and structure

>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A*	Back alignment and structure

>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A	Back alignment and structure

>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A	Back alignment and structure

>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A*	Back alignment and structure

>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B*	Back alignment and structure

>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae}	Back alignment and structure

>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B*	Back alignment and structure

>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A	Back alignment and structure

>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A	Back alignment and structure

>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A*	Back alignment and structure

>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus}	Back alignment and structure

>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8	Back alignment and structure

>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli}	Back alignment and structure

>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A	Back alignment and structure

>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A	Back alignment and structure

>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A*	Back alignment and structure

>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae}	Back alignment and structure

>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A*	Back alignment and structure

>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A	Back alignment and structure

>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus}	Back alignment and structure

>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis}	Back alignment and structure

>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A	Back alignment and structure

>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A	Back alignment and structure

>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus}	Back alignment and structure

>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris}	Back alignment and structure

>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A	Back alignment and structure

>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1	Back alignment and structure

>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1	Back alignment and structure

>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1	Back alignment and structure

>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus}	Back alignment and structure

>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens}	Back alignment and structure

>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans}	Back alignment and structure

>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B*	Back alignment and structure

>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3	Back alignment and structure

>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A	Back alignment and structure

>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1	Back alignment and structure

>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus}	Back alignment and structure

>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ...	Back alignment and structure

>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris}	Back alignment and structure

>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1	Back alignment and structure

>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens}	Back alignment and structure

>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus}	Back alignment and structure

>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus}	Back alignment and structure

>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans}	Back alignment and structure

>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans}	Back alignment and structure

>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans}	Back alignment and structure

>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A	Back alignment and structure

>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli}	Back alignment and structure

>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1	Back alignment and structure

>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A*	Back alignment and structure

>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli}	Back alignment and structure

>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus}	Back alignment and structure

>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana}	Back alignment and structure

>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1	Back alignment and structure

>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B*	Back alignment and structure

>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A	Back alignment and structure

>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A	Back alignment and structure

>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A*	Back alignment and structure

>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ...	Back alignment and structure

>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A	Back alignment and structure

>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A*	Back alignment and structure

>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1	Back alignment and structure

>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A	Back alignment and structure

>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A*	Back alignment and structure

>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A	Back alignment and structure

>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli}	Back alignment and structure

>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A	Back alignment and structure

>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus}	Back alignment and structure

>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3	Back alignment and structure

>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis}	Back alignment and structure

>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris}	Back alignment and structure

>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1	Back alignment and structure

>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus}	Back alignment and structure

>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1	Back alignment and structure

>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana}	Back alignment and structure

>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A	Back alignment and structure

>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A*	Back alignment and structure

>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A*	Back alignment and structure

>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris}	Back alignment and structure

>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis}	Back alignment and structure

>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1	Back alignment and structure

>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A*	Back alignment and structure

>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1	Back alignment and structure

>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A	Back alignment and structure

>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3	Back alignment and structure

>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus}	Back alignment and structure

>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans}	Back alignment and structure

>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus}	Back alignment and structure

>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A*	Back alignment and structure

>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L	Back alignment and structure

>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L	Back alignment and structure

>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A*	Back alignment and structure

>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans}	Back alignment and structure

>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B	Back alignment and structure

>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A*	Back alignment and structure

>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B	Back alignment and structure

>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A*	Back alignment and structure

>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12}	Back alignment and structure

>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis}	Back alignment and structure

>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A	Back alignment and structure

>2pm7_A Protein WEB1, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm6_A 3mzl_B	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		1637
d1tbga_		340	b.69.4.1 (A:) beta1-subunit of the signal-transduc	6e-08
d1tbga_		340	b.69.4.1 (A:) beta1-subunit of the signal-transduc	1e-06
d1tbga_		340	b.69.4.1 (A:) beta1-subunit of the signal-transduc	4e-06
d1vyhc1		317	b.69.4.1 (C:92-408) Platelet-activating factor ace	2e-07
d1b89a_		336	a.118.1.3 (A:) Clathrin heavy chain proximal leg s	7e-07
d1b89a_		336	a.118.1.3 (A:) Clathrin heavy chain proximal leg s	3e-04
d1erja_		388	b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea	9e-07
d1erja_		388	b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea	1e-04
d1erja_		388	b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea	3e-04
d2bbkh_		355	b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {	2e-06
d2ovrb2		342	b.69.4.1 (B:2365-2706) F-box/WD repeat-containing	1e-05
d1k8kc_		371	b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1	1e-04
d1yfqa_		342	b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake	2e-04
d1qqea_		290	a.118.8.1 (A:) Vesicular transport protein sec17 {	2e-04
d1w3ba_		388	a.118.8.1 (A:) O-GlcNAc transferase p110 subunit,	3e-04
d1w3ba_		388	a.118.8.1 (A:) O-GlcNAc transferase p110 subunit,	0.004
d1gxra_		337	b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum	3e-04
d1mdah_		368	b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {	4e-04
d1jmxb_		346	b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase	5e-04
d1k32a3		360	b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar	0.002
d1p22a2		293	b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be	0.004

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340	Back information, alignment and structure


class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 54.4 bits (129), Expect = 6e-08
 Identities = 18/110 (16%), Positives = 39/110 (35%), Gaps = 4/110 (3%)

Query: 49  VKGLAFSPDSTKLAVAQSDNIIFIYKLGDDWGDKKVICNKFIQQCPVTTMVWLADGPIIY 108
           +  + F P+    A    D    ++        + +  +     C +T++ +   G ++ 
Sbjct: 229 INAICFFPNGNAFATGSDDATCRLFD--LRADQELMTYSHDNIICGITSVSFSKSGRLLL 286

Query: 109 -GQSDGKIKAAHV-KANKTQTLYASNSFVVALCLNVRGAGVLSGHADGSI 156
            G  D         KA++   L   ++ V  L +   G  V +G  D  +
Sbjct: 287 AGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFL 336

PyMOL of d1tbga_

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340	Back information, alignment and structure

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340	Back information, alignment and structure

>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317	Back information, alignment and structure

>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Length = 336	Back information, alignment and structure

>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Length = 336	Back information, alignment and structure

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388	Back information, alignment and structure

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388	Back information, alignment and structure

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388	Back information, alignment and structure

>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355	Back information, alignment and structure

>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371	Back information, alignment and structure

>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342	Back information, alignment and structure

>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388	Back information, alignment and structure

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337	Back information, alignment and structure

>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368	Back information, alignment and structure

>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360	Back information, alignment and structure

>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		1637
d1gxra_		337	Groucho/tle1, C-terminal domain {Human (Homo sapie	100.0
d1gxra_		337	Groucho/tle1, C-terminal domain {Human (Homo sapie	100.0
d1nr0a1		311	Actin interacting protein 1 {Nematode (Caenorhabdi	100.0
d1k8kc_		371	Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur	99.98
d1vyhc1		317	Platelet-activating factor acetylhydrolase IB subu	99.98
d1nr0a1		311	Actin interacting protein 1 {Nematode (Caenorhabdi	99.97
d1erja_		388	Tup1, C-terminal domain {Baker's yeast (Saccharomy	99.97
d1tbga_		340	beta1-subunit of the signal-transducing G protein	99.97
d1nr0a2		299	Actin interacting protein 1 {Nematode (Caenorhabdi	99.97
d1erja_		388	Tup1, C-terminal domain {Baker's yeast (Saccharomy	99.97
d1vyhc1		317	Platelet-activating factor acetylhydrolase IB subu	99.97
d1k8kc_		371	Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur	99.97
d1nr0a2		299	Actin interacting protein 1 {Nematode (Caenorhabdi	99.96
d1nexb2		355	Cdc4 propeller domain {Baker's yeast (Saccharomyce	99.96
d1tbga_		340	beta1-subunit of the signal-transducing G protein	99.96
d1pgua1		325	Actin interacting protein 1 {Baker's yeast (Saccha	99.95
d1nexb2		355	Cdc4 propeller domain {Baker's yeast (Saccharomyce	99.95
d2ovrb2		342	F-box/WD repeat-containing protein 7, FBXW7 {Human	99.95
d2ovrb2		342	F-box/WD repeat-containing protein 7, FBXW7 {Human	99.94
d1pgua1		325	Actin interacting protein 1 {Baker's yeast (Saccha	99.93
d1p22a2		293	F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom	99.91
d1k32a3		360	Tricorn protease domain 2 {Archaeon Thermoplasma a	99.91
d1yfqa_		342	Cell cycle arrest protein BUB3 {Baker's yeast (Sac	99.91
d1pgua2		287	Actin interacting protein 1 {Baker's yeast (Saccha	99.91
d1yfqa_		342	Cell cycle arrest protein BUB3 {Baker's yeast (Sac	99.91
d1pgua2		287	Actin interacting protein 1 {Baker's yeast (Saccha	99.9
d1p22a2		293	F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom	99.89
d1sq9a_		393	Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac	99.89
d1sq9a_		393	Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac	99.88
d1qksa2		432	C-terminal (heme d1) domain of cytochrome cd1-nitr	99.88
d1k32a3		360	Tricorn protease domain 2 {Archaeon Thermoplasma a	99.88
d1qksa2		432	C-terminal (heme d1) domain of cytochrome cd1-nitr	99.85
d1hzua2		426	C-terminal (heme d1) domain of cytochrome cd1-nitr	99.82
d1l0qa2		301	Surface layer protein {Archaeon Methanosarcina maz	99.81
d1hzua2		426	C-terminal (heme d1) domain of cytochrome cd1-nitr	99.81
d1w3ba_		388	O-GlcNAc transferase p110 subunit, OGT {Human (Hom	99.77
d1w3ba_		388	O-GlcNAc transferase p110 subunit, OGT {Human (Hom	99.75
d1jmxb_		346	Quinohemoprotein amine dehydrogenase B chain {Pseu	99.75
d1l0qa2		301	Surface layer protein {Archaeon Methanosarcina maz	99.75
d1jmxb_		346	Quinohemoprotein amine dehydrogenase B chain {Pseu	99.73
d1pbyb_		337	Quinohemoprotein amine dehydrogenase B chain {Para	99.73
d1ri6a_		333	Putative isomerase YbhE {Escherichia coli [TaxId:	99.68
d1ri6a_		333	Putative isomerase YbhE {Escherichia coli [TaxId:	99.67
d2madh_		373	Methylamine dehydrogenase, H-chain {Gram negative	99.66
d2madh_		373	Methylamine dehydrogenase, H-chain {Gram negative	99.64
d1pbyb_		337	Quinohemoprotein amine dehydrogenase B chain {Para	99.63
d2bbkh_		355	Methylamine dehydrogenase, H-chain {Paracoccus den	99.57
d2bgra1		470	Dipeptidyl peptidase IV/CD26, N-terminal domain {P	99.5
d2bbkh_		355	Methylamine dehydrogenase, H-chain {Paracoccus den	99.48
d1fcha_		323	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	99.43
d1mdah_		368	Methylamine dehydrogenase, H-chain {Paracoccus den	99.34
d2bgra1		470	Dipeptidyl peptidase IV/CD26, N-terminal domain {P	99.31
d1fcha_		323	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	99.29
d1qnia2		441	Nitrous oxide reductase, N-terminal domain {Pseudo	99.24
d1mdah_		368	Methylamine dehydrogenase, H-chain {Paracoccus den	99.2
d1hz4a_		366	Transcription factor MalT domain III {Escherichia	99.19
d1b89a_		336	Clathrin heavy chain proximal leg segment {Cow (Bo	99.17
d1qnia2		441	Nitrous oxide reductase, N-terminal domain {Pseudo	99.14
d1hz4a_		366	Transcription factor MalT domain III {Escherichia	99.13
d1qqea_		290	Vesicular transport protein sec17 {Baker's yeast (	99.06
d1qqea_		290	Vesicular transport protein sec17 {Baker's yeast (	99.02
d2p4oa1		302	Hypothetical protein All0351 homologue {Nostoc pun	98.98
d1jofa_		365	3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu	98.96
d2hqsa1		269	TolB, C-terminal domain {Escherichia coli [TaxId:	98.96
d2hqsa1		269	TolB, C-terminal domain {Escherichia coli [TaxId:	98.95
d1xfda1		465	Dipeptidyl aminopeptidase-like protein 6, DPP6, N-	98.9
d1jofa_		365	3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu	98.85
d1q7fa_		279	Brain tumor cg10719-pa {Fruit fly (Drosophila mela	98.79
d2h6fa1		315	Protein farnesyltransferase alpha-subunit {Human (	98.77
d1xfda1		465	Dipeptidyl aminopeptidase-like protein 6, DPP6, N-	98.77
d2h6fa1		315	Protein farnesyltransferase alpha-subunit {Human (	98.77
d1xnfa_		259	Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	98.77
d1xnfa_		259	Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	98.76
d1rwia_		260	Serine/threonine-protein kinase PknD {Mycobacteriu	98.76
d1b89a_		336	Clathrin heavy chain proximal leg segment {Cow (Bo	98.75
d2dg1a1		319	Lactonase Drp35 {Staphylococcus aureus [TaxId: 128	98.74
d1rwia_		260	Serine/threonine-protein kinase PknD {Mycobacteriu	98.7
d1dcea1		334	Rab geranylgeranyltransferase alpha-subunit, N-ter	98.68
d2p4oa1		302	Hypothetical protein All0351 homologue {Nostoc pun	98.67
d1pjxa_		314	Diisopropylfluorophosphatase (phosphotriesterase,	98.67
d1q7fa_		279	Brain tumor cg10719-pa {Fruit fly (Drosophila mela	98.64
d1pjxa_		314	Diisopropylfluorophosphatase (phosphotriesterase,	98.53
d2ghsa1		295	Regucalcin {Agrobacterium tumefaciens [TaxId: 358]	98.46
d1hh8a_		192	Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H	98.45
d1dcea1		334	Rab geranylgeranyltransferase alpha-subunit, N-ter	98.39
d1k32a2		281	Tricorn protease N-terminal domain {Archaeon Therm	98.39
d2dg1a1		319	Lactonase Drp35 {Staphylococcus aureus [TaxId: 128	98.32
d1hh8a_		192	Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H	98.28
d1elwa_		117	Hop {Human (Homo sapiens) [TaxId: 9606]}	98.23
d1elra_		128	Hop {Human (Homo sapiens) [TaxId: 9606]}	98.23
d2c2la1		201	STIP1 homology and U box-containing protein 1, STU	98.19
d1k32a2		281	Tricorn protease N-terminal domain {Archaeon Therm	98.16
d1elwa_		117	Hop {Human (Homo sapiens) [TaxId: 9606]}	98.15
d1a17a_		159	Protein phosphatase 5 {Human (Homo sapiens) [TaxId	98.11
d1elra_		128	Hop {Human (Homo sapiens) [TaxId: 9606]}	98.06
d1hxia_		112	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	98.04
d1a17a_		159	Protein phosphatase 5 {Human (Homo sapiens) [TaxId	98.02
d2c2la1		201	STIP1 homology and U box-containing protein 1, STU	97.92
d2onda1		308	Cleavage stimulation factor 77 kDa subunit CSTF3 {	97.92
d1ya0a1		497	SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	97.89
d1hxia_		112	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	97.88
d2hr2a1		156	Hypothetical protein CT2138 {Chlorobium tepidum [T	97.86
d1ouva_		265	Cysteine rich protein C (HcpC) {Helicobacter pylor	97.85
d2onda1		308	Cleavage stimulation factor 77 kDa subunit CSTF3 {	97.82
d2hr2a1		156	Hypothetical protein CT2138 {Chlorobium tepidum [T	97.81
d1p5qa1		170	FKBP52 (FKBP4), C-terminal domain {Human (Homo sap	97.8
d1ya0a1		497	SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	97.78
d1ouva_		265	Cysteine rich protein C (HcpC) {Helicobacter pylor	97.78
d1p5qa1		170	FKBP52 (FKBP4), C-terminal domain {Human (Homo sap	97.77
d1ihga1		169	Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	97.76
d1ihga1		169	Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	97.7
d1kt1a1		168	FKBP51, C-terminal domain {Monkey (Saimiri bolivie	97.68
d2ghsa1		295	Regucalcin {Agrobacterium tumefaciens [TaxId: 358]	97.67
d1nzna_		122	Mitochondria fission protein Fis1 {Human (Homo sap	97.65
d1kt1a1		168	FKBP51, C-terminal domain {Monkey (Saimiri bolivie	97.59
d2fbna1		153	Putative 70 kda peptidylprolyl isomerase PFL2275c	97.59
d2fbna1		153	Putative 70 kda peptidylprolyl isomerase PFL2275c	97.46
d1nzna_		122	Mitochondria fission protein Fis1 {Human (Homo sap	97.44
d1k3ia3		387	Galactose oxidase, central domain {Fungi (Fusarium	97.35
d1tjca_		95	Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human	97.3
d1utca2		327	Clathrin heavy-chain terminal domain {Rat (Rattus	97.22
d1qfma1		430	Prolyl oligopeptidase, N-terminal domain {Pig (Sus	97.2
d1zu2a1		145	Mitochondrial import receptor subunit tom20-3 {Tha	97.01
d1zu2a1		145	Mitochondrial import receptor subunit tom20-3 {Tha	96.89
d1k3ia3		387	Galactose oxidase, central domain {Fungi (Fusarium	96.86
d1tjca_		95	Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human	96.79
d1utca2		327	Clathrin heavy-chain terminal domain {Rat (Rattus	96.79
d1npea_		263	Nidogen {Mouse (Mus musculus) [TaxId: 10090]}	96.74
d1ijqa1		266	Low density lipoprotein (LDL) receptor {Human (Hom	96.72
d1qfma1		430	Prolyl oligopeptidase, N-terminal domain {Pig (Sus	96.53
d1zbpa1		264	Hypothetical protein VPA1032 {Vibrio parahaemolyti	96.52
d1v04a_		340	Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory	96.46
d1fwxa2		459	Nitrous oxide reductase, N-terminal domain {Paraco	96.45
d1ijqa1		266	Low density lipoprotein (LDL) receptor {Human (Hom	96.25
d2ff4a2		179	Probable regulatory protein EmbR, middle domain {M	96.21
d2ff4a2		179	Probable regulatory protein EmbR, middle domain {M	96.19
d2ad6a1		571	Methanol dehydrogenase, heavy chain {Methylophilus	96.12
d1fwxa2		459	Nitrous oxide reductase, N-terminal domain {Paraco	96.06
d2ad6a1		571	Methanol dehydrogenase, heavy chain {Methylophilus	95.89
d1zbpa1		264	Hypothetical protein VPA1032 {Vibrio parahaemolyti	95.65
d1w6sa_		596	Methanol dehydrogenase, heavy chain {Methylobacter	95.43
d1npea_		263	Nidogen {Mouse (Mus musculus) [TaxId: 10090]}	95.22
d1qsaa1		450	70 KDa soluble lytic transglycosylase (SLT70), sup	94.74
d1kv9a2		560	Quinoprotein alcohol dehydrogenase, N-terminal dom	94.6
d1qsaa1		450	70 KDa soluble lytic transglycosylase (SLT70), sup	94.36
d1klxa_		133	Cysteine rich protein B (HcpB) {Helicobacter pylor	94.15
d1v04a_		340	Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory	93.99
d1kv9a2		560	Quinoprotein alcohol dehydrogenase, N-terminal dom	93.18
d1kb0a2		573	Quinoprotein alcohol dehydrogenase, N-terminal dom	92.29
d1h6la_		353	Thermostable phytase (3-phytase) {Bacillus amyloli	92.19
d1w6sa_		596	Methanol dehydrogenase, heavy chain {Methylobacter	92.1
d1flga_		582	Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax	92.04
d1klxa_		133	Cysteine rich protein B (HcpB) {Helicobacter pylor	91.41
d1xipa_		381	Nucleoporin NUP159 {Baker's yeast (Saccharomyces c	91.31
d1crua_		450	Soluble quinoprotein glucose dehydrogenase {Acinet	91.06
d1xipa_		381	Nucleoporin NUP159 {Baker's yeast (Saccharomyces c	90.44
d1crua_		450	Soluble quinoprotein glucose dehydrogenase {Acinet	89.71
d1h6la_		353	Thermostable phytase (3-phytase) {Bacillus amyloli	85.6
d1flga_		582	Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax	84.83
d1bpoa1		157	Clathrin heavy-chain linker domain {Rat (Rattus no	81.58

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=7.8e-33  Score=325.81  Aligned_cols=269  Identities=12%  Similarity=0.126  Sum_probs=233.8

Q ss_pred             CCCCceeEEEEcCCCCEEEEEeCCCeEEEEEcCCCC------------cccceEEEEECCCCCeEEEEECCCeEEEEEcC
Q psy12802          9 VSSNVLQDDVFNLDIVRLRSEGNVAGIWAWRGQNGR------------KSYVVKGLAFSPDSTKLAVAQSDNIIFIYKLG   76 (1637)
Q Consensus         9 ~~~~~i~~~~~spdg~~la~~~~d~~i~vwd~~~~~------------h~~~V~~~~~spd~~~la~~~~d~~i~iw~~~   76 (1637)
                      .|...|++++|||||++|++|+ ||.|+|||+.++.            |...|++++|+|||++|++|+.||+|++||+.
T Consensus        49 ~H~~~V~~v~fs~~g~~latg~-dg~V~iWd~~~~~~~~~~~~~~~~~h~~~I~~v~~s~dg~~l~s~~~dg~i~iwd~~  127 (337)
T d1gxra_          49 NHGEVVCAVTISNPTRHVYTGG-KGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLA  127 (337)
T ss_dssp             CCSSCCCEEEECSSSSEEEEEC-BSEEEEEETTSTTCCSCSEEEECSCTTSBEEEEEECTTSSEEEEEESSSEEEEEECC
T ss_pred             CCCCcEEEEEECCCCCEEEEEE-CCEEEEEEccCCcccceeEEeeecCCCCcEEEEEEcCCCCEEEEeeccccccccccc
Confidence            5789999999999999999987 8899999987542            67789999999999999999999999999987


Q ss_pred             CCCCCceeEeeccCCCCCEEEEEEcCCCC-EEEEeCCCcEEEEEcCCCce-eeecccCCcEEEEEEecCCCeEEEEeCCC
Q psy12802         77 DDWGDKKVICNKFIQQCPVTTMVWLADGP-IIYGQSDGKIKAAHVKANKT-QTLYASNSFVVALCLNVRGAGVLSGHADG  154 (1637)
Q Consensus        77 ~~~~~~~~~~~~~~~~~~v~~v~~s~~~~-l~~~~~d~~v~vwd~~~~~~-~~~~~~~~~v~~l~~s~~g~~l~s~~~dg  154 (1637)
                      ..  ..+.......|...|.++.|+|++. +++++.|+.|++|++.+++. ....+|...|.+++|++++..+++|+.||
T Consensus       128 ~~--~~~~~~~~~~~~~~v~~~~~~~~~~~l~s~~~d~~i~~~~~~~~~~~~~~~~~~~~v~~l~~s~~~~~~~~~~~d~  205 (337)
T d1gxra_         128 AP--TPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDN  205 (337)
T ss_dssp             CC----EEEEEEECSSSCEEEEEECTTSSEEEEEETTSCEEEEETTTTEEEEEECCCSSCEEEEEECTTSSEEEEEETTS
T ss_pred             cc--cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            63  2344455567899999999999999 99999999999999999988 77888999999999999999999999999


Q ss_pred             cEEEEEecCCCCcccccccccccCCCCcEEEEecCC--eEEEEecCCeEEEEe-CCCceeEEeeccCCCCCCccEEEEEE
Q psy12802        155 SIVRYYVTEDASNFDQQQGRVVQHPVPPYALSWPAG--YILAAGSDRIVTIYE-SDGRVHRIFDYTAPHYKEREFTVACS  231 (1637)
Q Consensus       155 ~i~iwd~~~~~~g~~~~~~~~~~~~~~v~~~~~~~~--~l~~~~~d~~i~iwd-~~~~~~~~~~~~~~~~~~~~i~~~~~  231 (1637)
                      .|++||+++.     +.+. ...|..+|.+++|+|+  .+++++.|+.|++|| ..+.... ..     .|...|++++|
T Consensus       206 ~v~i~d~~~~-----~~~~-~~~~~~~i~~l~~~~~~~~l~~~~~d~~i~i~d~~~~~~~~-~~-----~~~~~i~~v~~  273 (337)
T d1gxra_         206 TVRSWDLREG-----RQLQ-QHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQ-LH-----LHESCVLSLKF  273 (337)
T ss_dssp             EEEEEETTTT-----EEEE-EEECSSCEEEEEECTTSSEEEEEETTSCEEEEETTSSCEEE-EC-----CCSSCEEEEEE
T ss_pred             cccccccccc-----eeec-ccccccceEEEEEcccccccceecccccccccccccccccc-cc-----ccccccceEEE
Confidence            9999999873     3333 3468899999999983  889999999999999 5555443 33     36778999999


Q ss_pred             CCCCCEEEEEecCc-EEEEEeCCCCCccccCCCcccCCCcceeEEEEcCCCCEEEEEecCCcEEEEEc
Q psy12802        232 SPSGQAVVVGSYDN-IKLFAWSPSKSVWEEQPNKTIPNLYTISALSWKRDGSRIACGGLCGSVELFES  298 (1637)
Q Consensus       232 sp~g~~l~~~~~d~-i~i~~~~~~~~~~~~~~~~~~~~~~~i~~l~~spdg~~l~~~~~dg~v~iwd~  298 (1637)
                      +|+|++|++++.|+ |++||.......      ....|...|.+++|+|++++|++|+.||+|++||+
T Consensus       274 s~~g~~l~s~s~Dg~i~iwd~~~~~~~------~~~~~~~~v~~~~~s~d~~~l~t~s~D~~I~vWdl  335 (337)
T d1gxra_         274 AYCGKWFVSTGKDNLLNAWRTPYGASI------FQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEV  335 (337)
T ss_dssp             CTTSSEEEEEETTSEEEEEETTTCCEE------EEEECSSCEEEEEECTTSCEEEEEETTSCEEEEEE
T ss_pred             CCCCCEEEEEeCCCeEEEEECCCCCEE------EEccCCCCEEEEEEeCCCCEEEEEeCCCeEEEEEE
Confidence            99999999999999 999998876543      34557789999999999999999999999999997

PyMOL of d1gxra_

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]}	Back information, alignment and structure

>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]}	Back information, alignment and structure

>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]}	Back information, alignment and structure

>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]}	Back information, alignment and structure

>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]}	Back information, alignment and structure

>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]}	Back information, alignment and structure

>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]}	Back information, alignment and structure

>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]}	Back information, alignment and structure

>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]}	Back information, alignment and structure

>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]}	Back information, alignment and structure

>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]}	Back information, alignment and structure

>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]}	Back information, alignment and structure

>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]}	Back information, alignment and structure

>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]}	Back information, alignment and structure

>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]}	Back information, alignment and structure

>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]}	Back information, alignment and structure

>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]}	Back information, alignment and structure

>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]}	Back information, alignment and structure

>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}	Back information, alignment and structure

>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}	Back information, alignment and structure

>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]}	Back information, alignment and structure

>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]}	Back information, alignment and structure

>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]}	Back information, alignment and structure

>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]}	Back information, alignment and structure

>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]}	Back information, alignment and structure

>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]}	Back information, alignment and structure

>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]}	Back information, alignment and structure

>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]}	Back information, alignment and structure

>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]}	Back information, alignment and structure

>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]}	Back information, alignment and structure

>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]}	Back information, alignment and structure

>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1bpoa1 a.118.1.4 (A:331-487) Clathrin heavy-chain linker domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure