Psyllid ID: psy12817

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200-
TGKVIAIRREDQSVWERRAALAPSNVKRLVRSGVKVIVQPSNRRAYPVQAYANAGAIIQEDISEASIIFGVKQVPVDLLLPNKTYCMFSHTIKAQETNMPLLDAILQKNIRLVDYEKLVDDEGNRVVAFGKYAGVAGMVNILHGLGLRLLALGHHTPFMHIGPAHNYRNSMMARQAIRDAGYEISLGNMPKSIGPLTIVFTGSGNVSQGAQEIFQELPYEYVPPEMLQKVAEHGSNTKIYACEVRRRNYLERIKGGGYDYQEYNENPSLYRSLFASKIAPYASIIINGIYWAVGSPKLLTLPDAKNLLRPNHMPWLPTSDGAPPLPHRLLGICDISADPGGSIEFMNECTTIDTPFCLYDADSNKDTKSFKGPGVLVCSIDNMPTQLPMEATDFFGNLVFPYALDILQSDASKPIEEHNFSPAVQAAIIASNGELTPKFKYIEDLRQQSVKSRHKADIQTEESRNVLLLGAGYVSRPLIEYLHRDENIHITLGSLLKEDIDKDKFISFVQSDASKPIEEHNFSPAVQAAIIASNGELTPKFKYIEDLRQQSVKSRHKADIQTEESRNVLLLGAGYVSRPLIEYLHRDENIHITLGSLLKEDIDKVTNEFGRVEATLIDVNNGGSDNLSGLVRSADLVVSLLPYNLHHHVAEFCIQHGKNLVTASYLSPEMMALHERAASAGITVLNEVGLDPGIDHLLAMECIDAAHLNGGKVESFVSYCGGLPAPECSENPLRYKFSWSPRGVLLNTLSSAKYLQNSQVVDIPAGGELMRTARPLDFLPGFSFEGFANRDSLRYAQLYNIAAEAHTVVRGTLRYRGFVDAMQAIQKLGLLDLKEHPALHPSGPEICWRELVCTLLGLSTSDIFYENLKNIVADKVGNTGLEALEALGLLNDDIIVQKQNTPIDTLSHFLRQKLNIRLVDYEKLVDDEGNRVVAFGKYAGVAGMVNILHGLGLRLLALGHHTPFMHIGPAHNYRNSMMARQAIRDAGYEISLGNMPKSIGPLTIVFTGSGNVSQGAQEIFQELPYEELVCTLLGLSTSDIFYENLKNIVADKVGNTGLEALEALGLLNDDIIVQKQNTPIDTLSHFLRQKLVLDDGDRDVIVLRHDIDILWPNRSRERKSISLVVYGQPNGTTAMAKTVGLPAAIAAKMILEGEFFVTTSTSSGPTGVASESPSPSLSTANLTVLQPWRKLSAYQPPLPPK
cccEEEEEccccccccccccccHHHHHHHHHcccEEEEEccccccccHHHHHHcccEEccccccccEEEEEccccccccccccEEEEEEcccccccccHHHHHHHHHcccEEEEEEEEEccccccEEEccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccEEEEEccccccHHHHHHHHHHcccccccHHHHHHHHHcccccEEEEEEccccccHHHcccccccHHHHHccccccccccccccccccEEEEEcccccccccccccHHHHHHHcccccccccccccccccccccEEEEEEEEccccccccEEcccccccccEEEEcccccccccccccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHccEEEcccccccccccccHHHHHHHHHccccccccccccEEEEEEccccccHHHHHHHccccccEEEEEccHHHcccccccccccccccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHccccccccccccccccEEEEcccccHHHHHHHHHccccEEEEEEcccHHHHHHHHHHccccEEEEEEEcccccHHHHHHHccccEEEEccccccHHHHHHHHHHHcccEEEcccccHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHHHHccccEEEEEEEEccccccccccccccccccccHHHHHHHHcccEEEEEccEEEEEccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccHHHHHHHHHHccccccccccccccccccccHHHHHHHHHccccccHHHHHHHHHHHcccccccHHHHHHcccccccccccccccHHHHHHHHHHHHcccccccccHHccccccEEEEEccccccccccHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccEEEEEcccccccccHHHHHccccHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHccccccccccccccHHHHHHHHHHHHcccccccccEEEEEEEEEEEEccccEEEEEEEEEEEcccccccHHHccccHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHcccEEEEEEcccccccccc
cccEEEEEEccccHHHHcccccHHHHHHHHHcccEEEEEccccccccHHHHHHcccEEEEccccccEEEEEccccHHHHccccEEEEEHHHHHcHHHHHHHHHHHHHcccEEEEHHHHccccccEEEEEcHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccEEEEEEccccHHHHHHHHHHHcccEEccHHHHHHHcccccccEEEEEEEEccccEEEcccccccHHHHHHcHHHccHHHHHHHccccEEEEEcEEccccccccccHHHHHHHHcccccccccccccccccccEEEEEEEEEccccccEEEEEEEccccccEEEEcccccccccccccccEEEEEEcccccHccHHHHHHHHHHHHHHHHHHHcccccccccHccccHHHHHEEEEcccccccHHHHHHHHHHHHHHHHHccccccccccEEEEEEcccccHHHHHHHHcccccEEEEEcccccccccccccccccccccccHHHccccHHHHHHEEHccccccccHHHHHHHHHHHHHHHHHHHcccccccEEEEEccccccHHHHHHHHcccccEEEEEcHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHccccEEEEcccHHHHHHHHHHHHHHccEEEccccccHHHHccHHHHHHHccEEEcccEEccEHHHHHHHHHHHHHHHcccEEEEEEEEEEEEEcHHHccccccccccccHHHHHHHccccEEEEEccEEEEEccHHHcHHHcEEccccccEcEEEEEccEcccHHHHccccccccEEEHccEccccHHHHHHHHHHcccccccccHHcccccccccHHHHHHHHHcccccHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHcccccHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHHHHHcccccccEEcccccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHccccccccHHHHHccccHHHHHHHHHcccccHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHccccccccEEEEEEEEEEEcccccEEEEEEEEEEcccccccHHHHHHHcHHHHHHHHHHHcccEEEcccccccccEEccccccHHHHHHHHHHHHHHHHHHccccccccc
TGKVIAIRREDQSVWERRAALAPSNVKRLVRSGVKVivqpsnrraypvqaYANAGAIIqediseasiifgvkqvpvdlllpnktycmfsHTIKAQETNMPLLDAILQKNirlvdyeklvddegnrVVAFGKYAGVAGMVNILHGLGLRLLalghhtpfmhigpahnyrNSMMARQAIRDAgyeislgnmpksigpltivftgsgnvsqGAQEIFQelpyeyvppeMLQKVAehgsntkiyaCEVRRRNYLERikgggydyqeynenpslYRSLFAskiapyasIIINGIYwavgspklltlpdaknllrpnhmpwlptsdgapplphrllgicdisadpggsiefmnecttidtpfclydadsnkdtksfkgpgvlvcsidnmptqlpmeatdffgnlvfpyaldilqsdaskpieehnfspAVQAAIIAsngeltpkfkYIEDLRQQSVKsrhkadiqteESRNVLLLGagyvsrplieylhrdeNIHITLGSllkedidkdkfisfvqsdaskpieehnfspAVQAAIIAsngeltpkfkYIEDLRQQSVKsrhkadiqteESRNVLLLGagyvsrplieylhrdeNIHITLGSLLKEDIDKVTNEFGRVEATLidvnnggsdnlsglvRSADLVVSllpynlhhHVAEFCIQHgknlvtasylspeMMALHERAASAGITVlnevgldpgidHLLAMECIDaahlnggkVESFVSycgglpapecsenplrykfswsprgvlLNTLSSAkylqnsqvvdipaggelmrtarpldflpgfsfegfanrdSLRYAQLYNIAAEAHTVVRGTLRYRGFVDAMQAIQKLGLldlkehpalhpsgpeicWRELVCTLLGLSTSDIFYENLKNIVADKVGNTGLEALEALGllnddiivqkqntpidtLSHFLRQKLNIRLVDyeklvddegnrVVAFGKYAGVAGMVNILHGLGLRLLalghhtpfmhigpahnyrNSMMARQAIRDAgyeislgnmpksigpltivftgsgnvsqGAQEIFQELPYEELVCTLLGLSTSDIFYENLKNIVADKVGNTGLEALEALGllnddiivqkqntpidtLSHFLRQKlvlddgdrdvivlrhdidilwpnrsrerksISLVVygqpngttamAKTVGLPAAIAAKMILEGEFFvttstssgptgvasespspslstanltvlqpwrklsayqpplppk
tgkviairredqsvwerraalapsnvkrlvrsgvkvivqpsnrraypvQAYANAGAIIQEDISEASIIFGVKQVPVDLLLPNKTYCMFSHTIKAQETNMPLLDAILQKNIRLVDYEKLVDDEGNRVVAFGKYAGVAGMVNILHGLGLRLLALGHHTPFMHIGPAHNYRNSMMARQAIRDAGYEISLGNMPKSIGPLTIVFTGSGNVSQGAQEIFQELPYEYVPPEMLQKVAehgsntkiyacevrrRNYLERIKGGGYDYQEYNENPSLYRSLFASKIAPYASIIINGIYWAVGSPKLLTLPDAKNLLRPNHMPWLPTSDGAPPLPHRLLGICDISADPGGSIEFMNECTTIDTPFCLYDADSNKDTKSFKGPGVLVCSIDNMPTQLPMEATDFFGNLVFPYALDILQSDASKPIEEHNFSPAVQAAIIASNGELTPKFKYIEDLRQQSVKsrhkadiqteesrnvllLGAGYVSRPLIEYLHRDENIHITLGsllkedidKDKFISFVQSDASKPIEEHNFSPAVQAAIIASNGELTPKFKYIEDLRQQSVKsrhkadiqteesrnvllLGAGYVSRPLIEYLHRDENIHITLGSLLKEDIDKVTNEFGRVEATlidvnnggsdNLSGLVRSADLVVSLLPYNLHHHVAEFCIQHGKNLVTASYLSPEMMALHERAASAGITVLNEVGLDPGIDHLLAMECIDAAHLNGGKVESFVSYCGGLPAPECSENPLRYKFSWSPRGVLLNTLSSAKYLQNSQVVDIPAGGELMRTARPLDFLPGFSFEGFANRDSLRYAQLYNIAAEAHTVVRGTLRYRGFVDAMQAIQKLGLLDLKEHPALHPSGPEICWRELVCTLLGLSTSDIFYENLKNIVADKVGNTGLEALEALGLLNDDIIVQKQNTPIDTLSHFLRQKLNIRLVDYEKLVDDEGNRVVAFGKYAGVAGMVNILHGLGLRLLALGHHTPFMHIGPAHNYRNSMMARQAIRDAGYEISLGNMPKSIGPLTIVFTGSGNVSQGAQEIFQELPYEELVCTLLGLSTSDIFYENLKNIVADKVGNTGLEALEALGLLNDDIIVQKQNTPIDTLSHFLRQKLvlddgdrdvivlrhdidilwpnrsrerksiSLVVYGQPNGTTAMAKTVGLPAAIAAKMILEGEFFVTTSTSSGPTGvasespspslstanltvlqpwrklsayqpplppk
TGKVIAIRREDQSVWERRAALAPSNVKRLVRSGVKVIVQPSNRRAYPVQAYANAGAIIQEDISEASIIFGVKQVPVDLLLPNKTYCMFSHTIKAQETNMPLLDAILQKNIRLVDYEKLVDDEGNRVVAFGKYAGVAGMVNIlhglglrllalghhTPFMHIGPAHNYRNSMMARQAIRDAGYEISLGNMPKSIGPLTIVFTGSGNVSQGAQEIFQELPYEYVPPEMLQKVAEHGSNTKIYACEVRRRNYLERIKGGGYDYQEYNENPSLYRSLFASKIAPYASIIINGIYWAVGSPKLLTLPDAKNLLRPNHMPWLPTSDGAPPLPHRLLGICDISADPGGSIEFMNECTTIDTPFCLYDADSNKDTKSFKGPGVLVCSIDNMPTQLPMEATDFFGNLVFPYALDILQSDASKPIEEHNFSPAVQAAIIASNGELTPKFKYIEDLRQQSVKSRHKADIQTEESRNVLLLGAGYVSRPLIEYLHRDENIHITLGSLLKEDIDKDKFISFVQSDASKPIEEHNFSPAVQAAIIASNGELTPKFKYIEDLRQQSVKSRHKADIQTEESRNVLLLGAGYVSRPLIEYLHRDENIHITLGSLLKEDIDKVTNEFGRVEATLIDVNNGGSDNLSGLVRSADLVVSLLPYNLHHHVAEFCIQHGKNLVTASYLSPEMMALHERAASAGITVLNEVGLDPGIDHLLAMECIDAAHLNGGKVESFVSYCGGLPAPECSENPLRYKFSWSPRGVLLNTLSSAKYLQNSQVVDIPAGGELMRTARPLDFLPGFSFEGFANRDSLRYAQLYNIAAEAHTVVRGTLRYRGFVDAMQAIQKLGLLDLKEHPALHPSGPEICWRELVCTLLGLSTSDIFYENLKNIVADKVGNTglealealgllNDDIIVQKQNTPIDTLSHFLRQKLNIRLVDYEKLVDDEGNRVVAFGKYAGVAGMVNIlhglglrllalghhTPFMHIGPAHNYRNSMMARQAIRDAGYEISLGNMPKSIGPLTIVFTGSGNVSQGAQEIFQELPYEELVCTLLGLSTSDIFYENLKNIVADKVGNTglealealgllNDDIIVQKQNTPIDTLSHFLRQKLVLDDGDRDVIVLRHDIDILWPNRSRERKSISLVVYGQPNGTTAMAKTVGLPAAIAAKMILEGEFFVttstssGPTGVASESPSPSLSTANLTVLQPWRKLSAYQPPLPPK
*************VWERRAALAPSNVKRLVRSGVKVIVQPSNRRAYPVQAYANAGAIIQEDISEASIIFGVKQVPVDLLLPNKTYCMFSHTIKAQETNMPLLDAILQKNIRLVDYEKLVDDEGNRVVAFGKYAGVAGMVNILHGLGLRLLALGHHTPFMHIGPAHNYRNSMMARQAIRDAGYEISLGNMPKSIGPLTIVFTGSGNVSQGAQEIFQELPYEYVPPEMLQKVAEHGSNTKIYACEVRRRNYLERIKGGGYDYQEYNENPSLYRSLFASKIAPYASIIINGIYWAVGSPKLLTLPDAKNLLRPNHMPWLPTSDGAPPLPHRLLGICDISADPGGSIEFMNECTTIDTPFCLYDADSNKDTKSFKGPGVLVCSIDNMPTQLPMEATDFFGNLVFPYALDILQSD********NFSPAVQAAIIASNGELTPKFKYIED*******************RNVLLLGAGYVSRPLIEYLHRDENIHITLGSLLKEDIDKDKFISFVQ***********FSPAVQAAIIASNGELTPKFKYIED*******************RNVLLLGAGYVSRPLIEYLHRDENIHITLGSLLKEDIDKVTNEFGRVEATLIDVNNGGSDNLSGLVRSADLVVSLLPYNLHHHVAEFCIQHGKNLVTASYLSPEMMALHERAASAGITVLNEVGLDPGIDHLLAMECIDAAHLNGGKVESFVSYCGGLPAPECSENPLRYKFSWSPRGVLLNTLSSAKYLQNSQVVDIPAGGELMRTARPLDFLPGFSFEGFANRDSLRYAQLYNIAAEAHTVVRGTLRYRGFVDAMQAIQKLGLLDLKEHPALHPSGPEICWRELVCTLLGLSTSDIFYENLKNIVADKVGNTGLEALEALGLLNDDIIVQKQNTPIDTLSHFLRQKLNIRLVDYEKLVDDEGNRVVAFGKYAGVAGMVNILHGLGLRLLALGHHTPFMHIGPAHNYRNSMMARQAIRDAGYEISLGNMPKSIGPLTIVFTGSGNVSQGAQEIFQELPYEELVCTLLGLSTSDIFYENLKNIVADKVGNTGLEALEALGLLNDDIIVQKQNTPIDTLSHFLRQKLVLDDGDRDVIVLRHDIDILWPNRSRERKSISLVVYGQPNGTTAMAKTVGLPAAIAAKMILEGEFFVT*******************************************
*GKVIAIRREDQSVWERRAALAPSNVKRLVRSGVKVIVQPSNRRAYPVQAYANAGAIIQEDISEASIIFGVKQVPVDLLLPNKTYCMFSHTIKAQETNMPLLDAILQKNIRLVDYEKLVDDEGNRVVAFGKYAGVAGMVNILHGLGLRLLALGHHTPFMHIGPAHNYRNSMMARQAIRDAGYEISLGNMPKSIGPLTIVFTGSGNVSQGAQEIFQELPYEYVPPEMLQKVAEHGSNTKIYACEVRRRNYLERIKGGGYDYQEYNENPSLYRSLFASKIAPYASIIINGIYWAVGSPKLLTLPDAKNLLRPN*******SDGAPPLPHRLLGICDISADPGGSIEFMNECTTIDTPFCLYDADSNKDTKSFKGPGVLVCSIDNMPTQLPMEATDFFGNLVFPYALDILQSDASKPIEEHNFSPAVQAAIIASNGELTPKFKYIE************************LLGAGYVSRPLIEYLHRDENIHITLGSLLKEDIDKDKFI******************AVQAAIIASNGELTPKFK*************************VLLLGAGYVSRPLIEYLHRDENIHITLGSLLKEDIDKVTNEFGRVEATLIDVNNGGSDNLSGLVRSADLVVSLLPYNLHHHVAEFCIQHGKNLVTASYLSPEMMALHERAASAGITVLNEVGLDPGIDHLLAMECIDAAHLNGGKVESFVSYCGGLPAPECSENPLRYKFSWSPRGVLLNTLSSAKYLQNSQVVDIPAGGELMRTARPLDFLPGFSFEGFANRDSLRYAQLYNIAAEAHTVVRGTLRYRGFVDAMQAIQKLGLLDLKEHPALHPSGPEICWRELVCTLLGLSTSDIFYENLKNIVADKVGNTGLEALEALGLLNDDIIVQKQNTPIDTLSHFLRQKLNIRLVDYEKLVDDEGNRVVAFGKYAGVAGMVNILHGLGLRLLALGHHTPFMHIGPAHNYRNSMMARQAIRDAGYEISLGNMPKSIGPLTIVFTGSGNVSQGAQEIFQELPYEELVCTLLGLSTSDIFYENLKNIVADKVGNTGLEALEALGLLNDDIIVQKQNTPIDTLSHFLRQKLVLDDGDRDVIVLRHDIDILWPNRSRERKSISLVVYGQPNGTTAMAKTVGLPAAIAAKMILEGEFFVTTSTSSGPTGVASESPSPSLSTANLTVLQPWRKLSA********
TGKVIAIRREDQSVWERRAALAPSNVKRLVRSGVKVIVQPSNRRAYPVQAYANAGAIIQEDISEASIIFGVKQVPVDLLLPNKTYCMFSHTIKAQETNMPLLDAILQKNIRLVDYEKLVDDEGNRVVAFGKYAGVAGMVNILHGLGLRLLALGHHTPFMHIGPAHNYRNSMMARQAIRDAGYEISLGNMPKSIGPLTIVFTGSGNVSQGAQEIFQELPYEYVPPEMLQKVAEHGSNTKIYACEVRRRNYLERIKGGGYDYQEYNENPSLYRSLFASKIAPYASIIINGIYWAVGSPKLLTLPDAKNLLRPNHMPWLPTSDGAPPLPHRLLGICDISADPGGSIEFMNECTTIDTPFCLYDADSNKDTKSFKGPGVLVCSIDNMPTQLPMEATDFFGNLVFPYALDILQSDASKPIEEHNFSPAVQAAIIASNGELTPKFKYIEDLR************QTEESRNVLLLGAGYVSRPLIEYLHRDENIHITLGSLLKEDIDKDKFISFVQSDASKPIEEHNFSPAVQAAIIASNGELTPKFKYIEDLR************QTEESRNVLLLGAGYVSRPLIEYLHRDENIHITLGSLLKEDIDKVTNEFGRVEATLIDVNNGGSDNLSGLVRSADLVVSLLPYNLHHHVAEFCIQHGKNLVTASYLSPEMMALHERAASAGITVLNEVGLDPGIDHLLAMECIDAAHLNGGKVESFVSYCGGLPAPECSENPLRYKFSWSPRGVLLNTLSSAKYLQNSQVVDIPAGGELMRTARPLDFLPGFSFEGFANRDSLRYAQLYNIAAEAHTVVRGTLRYRGFVDAMQAIQKLGLLDLKEHPALHPSGPEICWRELVCTLLGLSTSDIFYENLKNIVADKVGNTGLEALEALGLLNDDIIVQKQNTPIDTLSHFLRQKLNIRLVDYEKLVDDEGNRVVAFGKYAGVAGMVNILHGLGLRLLALGHHTPFMHIGPAHNYRNSMMARQAIRDAGYEISLGNMPKSIGPLTIVFTGSGNVSQGAQEIFQELPYEELVCTLLGLSTSDIFYENLKNIVADKVGNTGLEALEALGLLNDDIIVQKQNTPIDTLSHFLRQKLVLDDGDRDVIVLRHDIDILWPNRSRERKSISLVVYGQPNGTTAMAKTVGLPAAIAAKMILEGEFFVTT*******************TANLTVLQPWRKLSAYQPPLPPK
*GKVIAIRREDQSVWERRAALAPSNVKRLVRSGVKVIVQPSNRRAYPVQAYANAGAIIQEDISEASIIFGVKQVPVDLLLPNKTYCMFSHTIKAQETNMPLLDAILQKNIRLVDYEKLVDDEGNRVVAFGKYAGVAGMVNILHGLGLRLLALGHHTPFMHIGPAHNYRNSMMARQAIRDAGYEISLGNMPKSIGPLTIVFTGSGNVSQGAQEIFQELPYEYVPPEMLQKVAEHGSNTKIYACEVRRRNYLERIKGGGYDYQEYNENPSLYRSLFASKIAPYASIIINGIYWAVGSPKLLTLPDAKNLLRPNHMPW**TSDGAPPLPHRLLGICDISADPGGSIEFMNECTTIDTPFCLYDADSNKDTKSFKGPGVLVCSIDNMPTQLPMEATDFFGNLVFPYALDILQSDASKPIEEHNFSPAVQAAIIASNGELTPKFKYIEDLRQQSVKSR*****QTEESRNVLLLGAGYVSRPLIEYLHRDENIHITLGSLLKEDIDKDKFISFVQSDASKPIEEHNFSPAVQAAIIASNGELTPKFKYIEDLRQQSVKSRHKADIQTEESRNVLLLGAGYVSRPLIEYLHRDENIHITLGSLLKEDIDKVTNEFGRVEATLIDVNNGGSDNLSGLVRSADLVVSLLPYNLHHHVAEFCIQHGKNLVTASYLSPEMMALHERAASAGITVLNEVGLDPGIDHLLAMECIDAAHLNGGKVESFVSYCGGLPAPECSENPLRYKFSWSPRGVLLNTLSSAKYLQNSQVVDIPAGGELMRTARPLDFLPGFSFEGFANRDSLRYAQLYNIAAEAHTVVRGTLRYRGFVDAMQAIQKLGLLDLKEHPALHPSGPEICWRELVCTLLGLSTSDIFYENLKNIVADKVGNTGLEALEALGLLNDDIIVQKQNTPIDTLSHFLRQKLNIRLVDYEKLVDDEGNRVVAFGKYAGVAGMVNILHGLGLRLLALGHHTPFMHIGPAHNYRNSMMARQAIRDAGYEISLGNMPKSIGPLTIVFTGSGNVSQGAQEIFQELPYEELVCTLLGLSTSDIFYENLKNIVADKVGNTGLEALEALGLLNDDIIVQKQNTPIDTLSHFLRQKLVLDDGDRDVIVLRHDIDILWPNRSRERKSISLVVYGQPNGTTAMAKTVGLPAAIAAKMILEGEFFVTTSTSSGPTGVASESPSPSLSTANLTVLQPWRKLSAYQPPLPP*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TGKVIAIRREDQSVWERRAALAPSNVKRLVRSGVKVIVQPSNRRAYPVQAYANAGAIIQEDISEASIIFGVKQVPVDLLLPNKTYCMFSHTIKAQETNMPLLDAILQKNIRLVDYEKLVDDEGNRVVAFGKYAGVAGMVNILHGLGLRLLALGHHTPFMHIGPAHNYRNSMMARQAIRDAGYEISLGNMPKSIGPLTIVFTGSGNVSQGAQEIFQELPYEYVPPEMLQKVAEHGSNTKIYACEVRRRNYLERIKGGGYDYQEYNENPSLYRSLFASKIAPYASIIINGIYWAVGSPKLLTLPDAKNLLRPNHMPWLPTSDGAPPLPHRLLGICDISADPGGSIEFMNECTTIDTPFCLYDADSNKDTKSFKGPGVLVCSIDNMPTQLPMEATDFFGNLVFPYALDILQSDASKPIEEHNFSPAVQAAIIASNGELTPKFKYIEDLRQQSVKSRHKADIQTEESRNVLLLGAGYVSRPLIEYLHRDENIHITLGSLLKEDIDKDKFISFVQSDASKPIEEHNFSPAVQAAIIASNGELTPKFKYIEDLRQQSVKSRHKADIQTEESRNVLLLGAGYVSRPLIEYLHRDENIHITLGSLLKEDIDKVTNEFGRVEATLIDVNNGGSDNLSGLVRSADLVVSLLPYNLHHHVAEFCIQHGKNLVTASYLSPEMMALHERAASAGITVLNEVGLDPGIDHLLAMECIDAAHLNGGKVESFVSYCGGLPAPECSENPLRYKFSWSPRGVLLNTLSSAKYLQNSQVVDIPAGGELMRTARPLDFLPGFSFEGFANRDSLRYAQLYNIAAEAHTVVRGTLRYRGFVDAMQAIQKLGLLDLKEHPALHPSGPEICWRELVCTLLGLSTSDIFYENLKNIVADKVGNTGLEALEALGLLNDDIIVQKQNTPIDTLSHFLRQKLNIRLVDYEKLVDDEGNRVVAFGKYAGVAGMVNILHGLGLRLLALGHHTPFMHIGPAHNYRNSMMARQAIRDAGYEISLGNMPKSIGPLTIVFTGSGNVSQGAQEIFQELPYEELVCTLLGLSTSDIFYENLKNIVADKVGNTGLEALEALGLLNDDIIVQKQNTPIDTLSHFLRQKLVLDDGDRDVIVLRHDIDILWPNRSRERKSISLVVYGQPNGTTAMAKTVGLPAAIAAKMILEGEFFVTTSTSSGPTGVASESPSPSLSTANLTVLQPWRKLSAYQPPLPPK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1201 2.2.26 [Sep-21-2011]
A8E657926 Alpha-aminoadipic semiald yes N/A 0.412 0.534 0.579 1e-171
Q9UDR5926 Alpha-aminoadipic semiald yes N/A 0.435 0.564 0.559 1e-169
Q99K67926 Alpha-aminoadipic semiald yes N/A 0.404 0.524 0.579 1e-167
A2VCW9926 Alpha-aminoadipic semiald yes N/A 0.447 0.579 0.531 1e-167
Q9SMZ41064 Alpha-aminoadipic semiald yes N/A 0.687 0.776 0.352 1e-148
Q9P4R4450 Saccharopine dehydrogenas N/A N/A 0.282 0.753 0.399 8e-68
O59711450 Saccharopine dehydrogenas yes N/A 0.291 0.777 0.389 1e-66
Q54NG9480 Probable saccharopine deh no N/A 0.334 0.837 0.348 4e-63
P38999446 Saccharopine dehydrogenas yes N/A 0.296 0.798 0.391 2e-61
P38998373 Saccharopine dehydrogenas no N/A 0.277 0.892 0.255 8e-19
>sp|A8E657|AASS_BOVIN Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Bos taurus GN=AASS PE=2 SV=1 Back     alignment and function desciption
 Score =  603 bits (1555), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 289/499 (57%), Positives = 375/499 (75%), Gaps = 4/499 (0%)

Query: 4   VIAIRREDQSVWERRAALAPSNVKRLVRSGVKVIVQPSNRRAYPVQAYANAGAIIQEDIS 63
           V+A+RRED + WERRA LAP +VK +   G KV++QPSNRRA   + Y  AG I+QEDIS
Sbjct: 25  VMALRREDVNAWERRAPLAPRHVKGITNLGYKVLIQPSNRRAIHDKEYVKAGGILQEDIS 84

Query: 64  EASIIFGVKQVPVDLLLPNKTYCMFSHTIKAQETNMPLLDAILQKNIRLVDYEKLVDDEG 123
           EA +I GVK+ P + L+P KTY  FSHTIKAQE NM LLD IL++ IRL+DYEK+VD  G
Sbjct: 85  EACLILGVKRPPEEKLMPKKTYAFFSHTIKAQEANMGLLDEILKQEIRLIDYEKMVDHRG 144

Query: 124 NRVVAFGKYAGVAGMVNILHGLGLRLLALGHHTPFMHIGPAHNYRNSMMARQAIRDAGYE 183
            RVVAFG++AGVAG++NILHG+GLRLLALGHHTPFMHIG AHNYRNS  A QA+RDAGYE
Sbjct: 145 IRVVAFGQWAGVAGIINILHGMGLRLLALGHHTPFMHIGMAHNYRNSGQAVQAVRDAGYE 204

Query: 184 ISLGNMPKSIGPLTIVFTGSGNVSQGAQEIFQELPYEYVPPEMLQKVAEHGSNTKIYACE 243
           ISLG MPKSIGPLT VFTG+GNVS+GAQEIF ELP EYV P  L++V+++G   K+Y   
Sbjct: 205 ISLGLMPKSIGPLTFVFTGTGNVSKGAQEIFNELPCEYVEPHELKEVSQNGDLRKVYGTV 264

Query: 244 VRRRNYLERIKGGGYDYQEYNENPSLYRSLFASKIAPYASIIINGIYWAVGSPKLLTLPD 303
           + R ++L R   G YD  EY++ P  Y S F + IAPY + +INGIYW   +P+LLT  D
Sbjct: 265 LSRHHHLVRKTDGVYDPVEYDKYPERYISRFNTDIAPYTTCLINGIYWEQNTPRLLTRQD 324

Query: 304 AKNLLRPNHMPWLPTSDGAPPLPHRLLGICDISADPGGSIEFMNECTTIDTPFCLYDADS 363
           A++LL P   P +   +G P LPH+L+ ICDISAD GGSIEFM ECTTI+ PFC+YDAD 
Sbjct: 325 AQSLLAPGKSP-VAGVEGCPALPHKLVAICDISADTGGSIEFMTECTTIERPFCMYDADQ 383

Query: 364 NKDTKSFKGPGVLVCSIDNMPTQLPMEATDFFGNLVFPYALDILQSDASKPIEEHNFSPA 423
           +    S +G G+L+CSIDN+P QLP+E+T++FG++++PY  +++ SDA++P+E  NFSP 
Sbjct: 384 HIIHDSVEGSGILMCSIDNLPAQLPIESTEYFGDMLYPYVEEMILSDATQPLESQNFSPV 443

Query: 424 VQAAIIASNGELTPKFKYIEDLRQQSVKSRHKADIQTEESRNVLLLGAGYVSRPLIEYLH 483
           V+ A+IASNG L+ K+KYI+ LR+      H   +     + VL+LG+GYVS P++EYL 
Sbjct: 444 VRDAVIASNGMLSNKYKYIQKLREN---REHAQSLSMGTKKKVLVLGSGYVSEPVLEYLL 500

Query: 484 RDENIHITLGSLLKEDIDK 502
           RD++I IT+GS +K  I++
Sbjct: 501 RDDSIEITVGSDMKNQIEQ 519
Bifunctional enzyme that catalyzes the first two steps in lysine degradation. The N-terminal and the C-terminal contain lysine-oxoglutarate reductase and saccharopine dehydrogenase activity, respectively.
Bos taurus (taxid: 9913)
EC: 1EC: .EC: 5EC: .EC: 1EC: .EC: 9
>sp|Q9UDR5|AASS_HUMAN Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Homo sapiens GN=AASS PE=1 SV=1 Back     alignment and function description
>sp|Q99K67|AASS_MOUSE Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Mus musculus GN=Aass PE=2 SV=1 Back     alignment and function description
>sp|A2VCW9|AASS_RAT Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Rattus norvegicus GN=Aass PE=2 SV=1 Back     alignment and function description
>sp|Q9SMZ4|AASS_ARATH Alpha-aminoadipic semialdehyde synthase OS=Arabidopsis thaliana GN=LKR/SDH PE=1 SV=1 Back     alignment and function description
>sp|Q9P4R4|LYS9_MAGO7 Saccharopine dehydrogenase [NADP(+), L-glutamate-forming] OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=LYS3 PE=1 SV=2 Back     alignment and function description
>sp|O59711|LYS9_SCHPO Saccharopine dehydrogenase [NADP(+), L-glutamate-forming] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys9 PE=3 SV=1 Back     alignment and function description
>sp|Q54NG9|SCPDH_DICDI Probable saccharopine dehydrogenase [NADP(+), L-glutamate-forming] OS=Dictyostelium discoideum GN=sdh PE=2 SV=1 Back     alignment and function description
>sp|P38999|LYS9_YEAST Saccharopine dehydrogenase [NADP(+), L-glutamate-forming] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS9 PE=1 SV=1 Back     alignment and function description
>sp|P38998|LYS1_YEAST Saccharopine dehydrogenase [NAD(+), L-lysine-forming] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1201
332018902 1402 Alpha-aminoadipic semialdehyde synthase, 0.411 0.352 0.79 0.0
383859607942 PREDICTED: alpha-aminoadipic semialdehyd 0.412 0.525 0.791 0.0
156548972950 PREDICTED: alpha-aminoadipic semialdehyd 0.416 0.526 0.788 0.0
170028405930 alpha-aminoadipic semialdehyde synthase, 0.413 0.534 0.741 0.0
340720412919 PREDICTED: alpha-aminoadipic semialdehyd 0.412 0.539 0.784 0.0
350404583919 PREDICTED: alpha-aminoadipic semialdehyd 0.412 0.539 0.784 0.0
195434344931 GK15303 [Drosophila willistoni] gi|19416 0.417 0.538 0.735 0.0
380017974918 PREDICTED: LOW QUALITY PROTEIN: alpha-am 0.415 0.543 0.774 0.0
195577377928 GD22468 [Drosophila simulans] gi|1941905 0.416 0.538 0.734 0.0
40215478972 SD02276p [Drosophila melanogaster] 0.416 0.514 0.734 0.0
>gi|332018902|gb|EGI59448.1| Alpha-aminoadipic semialdehyde synthase, mitochondrial [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  819 bits (2116), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/500 (79%), Positives = 447/500 (89%)

Query: 2   GKVIAIRREDQSVWERRAALAPSNVKRLVRSGVKVIVQPSNRRAYPVQAYANAGAIIQED 61
           GK+IAIRREDQSVWERRA LAP+NV+RLVRSGVKVIVQPS+RRAYP Q Y  AGA++QED
Sbjct: 495 GKIIAIRREDQSVWERRAPLAPANVRRLVRSGVKVIVQPSDRRAYPAQVYQAAGALLQED 554

Query: 62  ISEASIIFGVKQVPVDLLLPNKTYCMFSHTIKAQETNMPLLDAILQKNIRLVDYEKLVDD 121
           IS AS+IFGVKQVPVD L+PNKTYC FSHTIKAQE+NMPLLDAIL+KNIRL+DYEKL D 
Sbjct: 555 ISSASVIFGVKQVPVDQLIPNKTYCFFSHTIKAQESNMPLLDAILEKNIRLLDYEKLTDA 614

Query: 122 EGNRVVAFGKYAGVAGMVNILHGLGLRLLALGHHTPFMHIGPAHNYRNSMMARQAIRDAG 181
            G RVVAFGKYAGVAGMVNILHGLGLRLLALGHHTPFMHIGPAHNYR+S MARQAIR AG
Sbjct: 615 NGQRVVAFGKYAGVAGMVNILHGLGLRLLALGHHTPFMHIGPAHNYRDSAMARQAIRGAG 674

Query: 182 YEISLGNMPKSIGPLTIVFTGSGNVSQGAQEIFQELPYEYVPPEMLQKVAEHGSNTKIYA 241
           YEI+LG MPKSIGPLT VFTGSGNVSQG QE+FQELP+EYVPPEML+KVAEHG  TKIY 
Sbjct: 675 YEIALGAMPKSIGPLTFVFTGSGNVSQGGQEVFQELPHEYVPPEMLRKVAEHGDTTKIYG 734

Query: 242 CEVRRRNYLERIKGGGYDYQEYNENPSLYRSLFASKIAPYASIIINGIYWAVGSPKLLTL 301
           CEVRRR++L+R +G G+D +EY+++P LY S F+ KIAPYAS+IINGIYWAV SPKLLT+
Sbjct: 735 CEVRRRHHLKRKEGDGFDPEEYDQHPELYISTFSKKIAPYASVIINGIYWAVDSPKLLTI 794

Query: 302 PDAKNLLRPNHMPWLPTSDGAPPLPHRLLGICDISADPGGSIEFMNECTTIDTPFCLYDA 361
           PDAK LLRP + PWLP S GAP LPHR+LGICDISADPGGSIEFMNECTTIDTPFCLYDA
Sbjct: 795 PDAKYLLRPANTPWLPISVGAPALPHRMLGICDISADPGGSIEFMNECTTIDTPFCLYDA 854

Query: 362 DSNKDTKSFKGPGVLVCSIDNMPTQLPMEATDFFGNLVFPYALDILQSDASKPIEEHNFS 421
           D NKDTKSFKGPGVLVCSIDNMPTQLP EATDFFGNL++PYALDI+QSDA KP+ EHNFS
Sbjct: 855 DRNKDTKSFKGPGVLVCSIDNMPTQLPKEATDFFGNLLYPYALDIIQSDAKKPLNEHNFS 914

Query: 422 PAVQAAIIASNGELTPKFKYIEDLRQQSVKSRHKADIQTEESRNVLLLGAGYVSRPLIEY 481
           PAV  AII SNG+LTP F+YI++LRQ + +SRHKAD + ++S+ V++LGAGYVS PL+EY
Sbjct: 915 PAVHDAIIVSNGKLTPNFEYIQELRQMNQRSRHKADNREQQSKTVVVLGAGYVSAPLVEY 974

Query: 482 LHRDENIHITLGSLLKEDID 501
           LHRD+NI + + S LK++ D
Sbjct: 975 LHRDKNIRLIVASQLKDEAD 994

Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383859607|ref|XP_003705284.1| PREDICTED: alpha-aminoadipic semialdehyde synthase, mitochondrial-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|156548972|ref|XP_001607166.1| PREDICTED: alpha-aminoadipic semialdehyde synthase, mitochondrial-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|170028405|ref|XP_001842086.1| alpha-aminoadipic semialdehyde synthase, mitochondrial [Culex quinquefasciatus] gi|167874241|gb|EDS37624.1| alpha-aminoadipic semialdehyde synthase, mitochondrial [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|340720412|ref|XP_003398633.1| PREDICTED: alpha-aminoadipic semialdehyde synthase, mitochondrial-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350404583|ref|XP_003487153.1| PREDICTED: alpha-aminoadipic semialdehyde synthase, mitochondrial-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|195434344|ref|XP_002065163.1| GK15303 [Drosophila willistoni] gi|194161248|gb|EDW76149.1| GK15303 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|380017974|ref|XP_003692916.1| PREDICTED: LOW QUALITY PROTEIN: alpha-aminoadipic semialdehyde synthase, mitochondrial-like [Apis florea] Back     alignment and taxonomy information
>gi|195577377|ref|XP_002078547.1| GD22468 [Drosophila simulans] gi|194190556|gb|EDX04132.1| GD22468 [Drosophila simulans] Back     alignment and taxonomy information
>gi|40215478|gb|AAR82744.1| SD02276p [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1201
MGI|MGI:1353573926 Aass "aminoadipate-semialdehyd 0.404 0.524 0.554 1.3e-239
RGD|1310811926 Aass "aminoadipate-semialdehyd 0.404 0.524 0.552 1.3e-237
FB|FBgn0025687928 LKR "lysine ketoglutarate redu 0.416 0.538 0.708 9.9e-229
WB|WBGene00019819934 R02D3.1 [Caenorhabditis elegan 0.408 0.525 0.525 7.4e-222
UNIPROTKB|D4A608925 D4A608 "Uncharacterized protei 0.402 0.523 0.454 7.2e-202
UNIPROTKB|D4ACE9925 D4ACE9 "Uncharacterized protei 0.402 0.523 0.450 1.1e-200
UNIPROTKB|Q6GN76927 aass "MGC82978 protein" [Xenop 0.410 0.531 0.581 1.8e-170
UNIPROTKB|A8E657926 AASS "Alpha-aminoadipic semial 0.437 0.566 0.533 4.9e-168
UNIPROTKB|F1PEA3915 AASS "Uncharacterized protein" 0.436 0.572 0.534 1.7e-167
UNIPROTKB|F1MY13926 AASS "Alpha-aminoadipic semial 0.437 0.566 0.530 5.6e-167
MGI|MGI:1353573 Aass "aminoadipate-semialdehyde synthase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 1413 (502.5 bits), Expect = 1.3e-239, Sum P(2) = 1.3e-239
 Identities = 273/492 (55%), Positives = 354/492 (71%)

Query:     4 VIAIRREDQSVWERRAALAPSNVKRLVRSGVKVIVQPSNRRAYPVQAYANAGAIIQEDIS 63
             V+A+RRED + WERRA LAP ++K + + G KV++QPSNRRA   + Y  AG I+QEDI+
Sbjct:    25 VMALRREDVNAWERRAPLAPKHIKGITKLGYKVLIQPSNRRAIHDKEYVRAGGILQEDIT 84

Query:    64 EASIIFGVKQVPVDLLLPNKTYCMFSHTIKAQETNMPLLDAILQKNIRLVDYEKLVDDEG 123
             EA +I GVK+ P + L+  KTY  FSHTIKAQE NM LLD +L++ IRL+DYEK+VD  G
Sbjct:    85 EACLILGVKRPPEEKLMSKKTYAFFSHTIKAQEANMNLLDEVLKQEIRLIDYEKMVDHRG 144

Query:   124 NRVVAFGKYAGVAGMVNIXXXXXXXXXXXXXXTPFMHIGPAHNYRNSMMARQAIRDAGYE 183
             +R+VAFG++AGVAGM+NI              TPFMH+G AHNYRNS  A QA+RDAGYE
Sbjct:   145 SRIVAFGQWAGVAGMINILHGMGLRLLALGHHTPFMHLGMAHNYRNSSQAVQAVRDAGYE 204

Query:   184 ISLGNMPKSIGPLTIVFTGSGNVSQGAQEIFQELPYEYVPPEMLQKVAEHGSNTKIYACE 243
             ISLG MPKSIGPLT VFTG+GNVS+GAQE+F ELP EYV P  L++V++ G   K+Y   
Sbjct:   205 ISLGLMPKSIGPLTFVFTGTGNVSKGAQEVFNELPCEYVEPHELREVSKTGDLRKVYGTV 264

Query:   244 VRRRNYLERIKGGGYDYQEYNENPSLYRSLFASKIAPYASIIINGIYWAVGSPKLLTLPD 303
             + R ++L R   G YD  EY + P  Y S F + IAPY + +INGIYW   +P+LLT  D
Sbjct:   265 LSRHHHLVRKTDGVYDPVEYEKYPERYTSRFNTDIAPYTTCLINGIYWEQNTPRLLTRQD 324

Query:   304 AKNLLRPNHMPWLPTSDGAPPLPHRLLGICDISADPGGSIEFMNECTTIDTPFCLYDADS 363
             A++LL P     +P  +G P LPH+L+ ICDISAD GGSI+FM ECTTI+ PFC+YDAD 
Sbjct:   325 AQSLLVPVKSSVVPV-EGCPELPHKLVAICDISADTGGSIDFMTECTTIERPFCMYDADQ 383

Query:   364 NKDTKSFKGPGVLVCSIDNMPTQLPMEATDFFGNLVFPYALDILQSDASKPIEEHNFSPA 423
                  S +G G+L+CSIDN+P QLP+EAT++FG++++PY  ++L SDAS+P+E  NFSP 
Sbjct:   384 QIIHDSVEGSGILMCSIDNLPAQLPIEATEYFGDMLYPYVEEMLLSDASQPLESQNFSPV 443

Query:   424 VQAAIIASNGELTPKFKYIEDLRQQSVKSRHKAD-IQTEESRNVLLLGAGYVSRPLIEYL 482
             V+ A+I SNG LT K+KYI+ LR+    SR +   +     + VL+LG+GYVS P++EYL
Sbjct:   444 VRDAVITSNGLLTDKYKYIQKLRE----SRERIQFLSMSTKKKVLVLGSGYVSGPVLEYL 499

Query:   483 HRDENIHITLGS 494
              RD NI ITLGS
Sbjct:   500 SRDNNIEITLGS 511
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0005739 "mitochondrion" evidence=TAS
GO:0006091 "generation of precursor metabolites and energy" evidence=TAS
GO:0008152 "metabolic process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0019477 "L-lysine catabolic process" evidence=IDA
GO:0047130 "saccharopine dehydrogenase (NADP+, L-lysine-forming) activity" evidence=IEA
GO:0047131 "saccharopine dehydrogenase (NAD+, L-glutamate-forming) activity" evidence=IDA
GO:0055114 "oxidation-reduction process" evidence=IDA
RGD|1310811 Aass "aminoadipate-semialdehyde synthase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0025687 LKR "lysine ketoglutarate reductase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00019819 R02D3.1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|D4A608 D4A608 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4ACE9 D4ACE9 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6GN76 aass "MGC82978 protein" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|A8E657 AASS "Alpha-aminoadipic semialdehyde synthase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PEA3 AASS "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MY13 AASS "Alpha-aminoadipic semialdehyde synthase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9UDR5AASS_HUMAN1, ., 5, ., 1, ., 90.55990.43540.5647yesN/A
A2VCW9AASS_RAT1, ., 5, ., 1, ., 90.53160.44710.5799yesN/A
A8E657AASS_BOVIN1, ., 5, ., 1, ., 90.57910.41210.5345yesN/A
Q99K67AASS_MOUSE1, ., 5, ., 1, ., 90.57920.40460.5248yesN/A
Q9SMZ4AASS_ARATH1, ., 5, ., 1, ., 90.35280.68770.7763yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.5.1.80.824
4th Layer1.5.1.90.824
4th Layer2.5.1.44LOW CONFIDENCE prediction!
3rd Layer1.5.10.766

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1201
cd12189433 cd12189, LKR_SDH_like, bifunctional lysine ketoglu 0.0
PLN028191042 PLN02819, PLN02819, lysine-ketoglutarate reductase 0.0
cd05199319 cd05199, SDH_like, Saccharopine Dehydrogenase like 1e-91
pfam03435380 pfam03435, Saccharop_dh, Saccharopine dehydrogenas 2e-71
cd12189433 cd12189, LKR_SDH_like, bifunctional lysine ketoglu 1e-66
COG1748389 COG1748, LYS9, Saccharopine dehydrogenase and rela 1e-46
PLN02819 1042 PLN02819, PLN02819, lysine-ketoglutarate reductase 9e-37
cd12188351 cd12188, SDH, Saccharopine Dehydrogenase NAD-bindi 2e-32
pfam05222135 pfam05222, AlaDh_PNT_N, Alanine dehydrogenase/PNT, 3e-29
smart01003133 smart01003, AlaDh_PNT_N, Alanine dehydrogenase/PNT 4e-26
pfam01262150 pfam01262, AlaDh_PNT_C, Alanine dehydrogenase/PNT, 3e-23
cd05199319 cd05199, SDH_like, Saccharopine Dehydrogenase like 1e-21
cd01620317 cd01620, Ala_dh_like, Alanine dehydrogenase and re 2e-19
smart01002149 smart01002, AlaDh_PNT_C, Alanine dehydrogenase/PNT 2e-18
PLN028191042 PLN02819, PLN02819, lysine-ketoglutarate reductase 7e-13
cd12189433 cd12189, LKR_SDH_like, bifunctional lysine ketoglu 4e-10
pfam03435380 pfam03435, Saccharop_dh, Saccharopine dehydrogenas 1e-08
cd05304363 cd05304, Rubrum_tdh, Rubrum transdehydrogenase NAD 2e-06
cd12181295 cd12181, ceo_syn, N(5)-(carboxyethyl)ornithine syn 2e-06
cd05305359 cd05305, L-AlaDH, Alanine dehydrogenase NAD-bindin 2e-05
pfam01262150 pfam01262, AlaDh_PNT_C, Alanine dehydrogenase/PNT, 4e-05
COG1748389 COG1748, LYS9, Saccharopine dehydrogenase and rela 4e-04
COG0686371 COG0686, Ald, Alanine dehydrogenase [Amino acid tr 9e-04
cd12188351 cd12188, SDH, Saccharopine Dehydrogenase NAD-bindi 0.001
smart01002149 smart01002, AlaDh_PNT_C, Alanine dehydrogenase/PNT 0.001
COG3288356 COG3288, PntA, NAD/NADP transhydrogenase alpha sub 0.002
>gnl|CDD|240665 cd12189, LKR_SDH_like, bifunctional lysine ketoglutarate reductase /saccharopine dehydrogenase enzyme Back     alignment and domain information 
 Score =  747 bits (1931), Expect = 0.0
 Identities = 266/445 (59%), Positives = 335/445 (75%), Gaps = 14/445 (3%)

Query: 4   VIAIRREDQSVWERRAALAPSNVKRLVRS-GVKVIVQPSNRRAYPVQAYANAGAIIQEDI 62
           VI IRRED+++WERRA L PS+V+ LV+  GVKV+VQPSNRRA+P Q Y  AGAIIQED+
Sbjct: 1   VIGIRREDKNIWERRAPLTPSHVRELVKKPGVKVLVQPSNRRAFPDQEYEAAGAIIQEDL 60

Query: 63  SEASIIFGVKQVPVDLLLPNKTYCMFSHTIKAQETNMPLLDAILQKNIRLVDYEKLVDDE 122
           S+A +I GVK+ P+D LLP+KTY  FSHTIKAQ  NMPLLDAIL+KNIRL+DYE +VD+ 
Sbjct: 61  SDADLILGVKEPPIDKLLPDKTYAFFSHTIKAQPYNMPLLDAILEKNIRLIDYELIVDES 120

Query: 123 GNRVVAFGKYAGVAGMVNILHGLGLRLLALGHHTPFMHIGPAHNYRNSMMARQAIRDAGY 182
           G R+VAFG +AGVAGM++ILHGLGLRLLALG+ TPF+HIG A+NY +   A+QA+RDAGY
Sbjct: 121 GKRLVAFGWFAGVAGMIDILHGLGLRLLALGYSTPFLHIGRAYNYPSLEEAKQAVRDAGY 180

Query: 183 EISLGNMPKSIGPLTIVFTGSGNVSQGAQEIFQELPYEYVPPEMLQKVAEHG-SNTKIYA 241
           EI+LG +PKS+GPL  VFTGSGNVSQGAQEIF+ELP+EYV P  L ++A+ G    K+Y 
Sbjct: 181 EIALGGLPKSLGPLVFVFTGSGNVSQGAQEIFEELPHEYVEPSDLPELAKSGADRNKVYG 240

Query: 242 CEVRRRNYLERIKGGGYDYQEYNENPSLYRSLFASKIAPYASIIINGIYWAVGSPKLLTL 301
           C V   +YLER  GG +D  +Y  NP LY S+F  KIAPY S++INGIYW    P+LLT 
Sbjct: 241 CVVTPEDYLERKDGGPFDRADYYANPELYESVFHEKIAPYLSVLINGIYWDPRFPRLLTN 300

Query: 302 PDAKNLLRPNHMPWLPTSDGAPPLPHRLLGICDISADPGGSIEFMNECTTIDTPFCLYDA 361
              + LLRP            P  PHRLL I DIS D GGSIEF+ + TTID+PF +YD 
Sbjct: 301 EQLQALLRP------------PAGPHRLLAIADISCDIGGSIEFLTKATTIDSPFYVYDP 348

Query: 362 DSNKDTKSFKGPGVLVCSIDNMPTQLPMEATDFFGNLVFPYALDILQSDASKPIEEHNFS 421
           D++K   S  G G+LV S+DN+P +LP EA++ FG+ + PY  D+ +SDASKP+EE    
Sbjct: 349 DTDKIHDSVSGDGILVMSVDNLPAELPREASEHFGDALLPYVPDLAKSDASKPLEESELP 408

Query: 422 PAVQAAIIASNGELTPKFKYIEDLR 446
           P ++ A IASNG+LTPK++YI++LR
Sbjct: 409 PVLRRATIASNGKLTPKYEYIQELR 433

Bifunctional lysine ketoglutarate reductase /saccharopine dehydrogenase protein is a pair of enzymes linked on a single polypeptide chain that catalyze the initial, consecutive steps of lysine degradation. These proteins are related to the 2-domain saccharopine dehydrogenases. Along with formate dehydrogenase and similar enzymes, SDH consists paired domains resembling Rossmann folds in which the NAD-binding domain is inserted within the linear sequence of the catalytic domain. In this bifunctional enzyme, the LKR domain is N-terminal of the SDH domain. These proteins have a close match to the active site motif of SDHs, and an NAD-binding site motif that is a partial match to that found in SDH and other FDH-related proteins. Length = 433
>gnl|CDD|215439 PLN02819, PLN02819, lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>gnl|CDD|240623 cd05199, SDH_like, Saccharopine Dehydrogenase like proteins Back     alignment and domain information
>gnl|CDD|217556 pfam03435, Saccharop_dh, Saccharopine dehydrogenase Back     alignment and domain information
>gnl|CDD|240665 cd12189, LKR_SDH_like, bifunctional lysine ketoglutarate reductase /saccharopine dehydrogenase enzyme Back     alignment and domain information
>gnl|CDD|224662 COG1748, LYS9, Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|215439 PLN02819, PLN02819, lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>gnl|CDD|240664 cd12188, SDH, Saccharopine Dehydrogenase NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|218508 pfam05222, AlaDh_PNT_N, Alanine dehydrogenase/PNT, N-terminal domain Back     alignment and domain information
>gnl|CDD|214967 smart01003, AlaDh_PNT_N, Alanine dehydrogenase/PNT, N-terminal domain Back     alignment and domain information
>gnl|CDD|216396 pfam01262, AlaDh_PNT_C, Alanine dehydrogenase/PNT, C-terminal domain Back     alignment and domain information
>gnl|CDD|240623 cd05199, SDH_like, Saccharopine Dehydrogenase like proteins Back     alignment and domain information
>gnl|CDD|240621 cd01620, Ala_dh_like, Alanine dehydrogenase and related dehydrogenases Back     alignment and domain information
>gnl|CDD|214966 smart01002, AlaDh_PNT_C, Alanine dehydrogenase/PNT, C-terminal domain Back     alignment and domain information
>gnl|CDD|215439 PLN02819, PLN02819, lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>gnl|CDD|240665 cd12189, LKR_SDH_like, bifunctional lysine ketoglutarate reductase /saccharopine dehydrogenase enzyme Back     alignment and domain information
>gnl|CDD|217556 pfam03435, Saccharop_dh, Saccharopine dehydrogenase Back     alignment and domain information
>gnl|CDD|240629 cd05304, Rubrum_tdh, Rubrum transdehydrogenase NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240658 cd12181, ceo_syn, N(5)-(carboxyethyl)ornithine synthase Back     alignment and domain information
>gnl|CDD|240630 cd05305, L-AlaDH, Alanine dehydrogenase NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|216396 pfam01262, AlaDh_PNT_C, Alanine dehydrogenase/PNT, C-terminal domain Back     alignment and domain information
>gnl|CDD|224662 COG1748, LYS9, Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223758 COG0686, Ald, Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|240664 cd12188, SDH, Saccharopine Dehydrogenase NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|214966 smart01002, AlaDh_PNT_C, Alanine dehydrogenase/PNT, C-terminal domain Back     alignment and domain information
>gnl|CDD|225826 COG3288, PntA, NAD/NADP transhydrogenase alpha subunit [Energy production and conversion] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1201
PLN028191042 lysine-ketoglutarate reductase/saccharopine dehydr 100.0
KOG0172|consensus445 100.0
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 100.0
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 100.0
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 100.0
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 100.0
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 100.0
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 100.0
COG3288356 PntA NAD/NADP transhydrogenase alpha subunit [Ener 100.0
PF05222136 AlaDh_PNT_N: Alanine dehydrogenase/PNT, N-terminal 99.97
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 99.96
PRK08306296 dipicolinate synthase subunit A; Reviewed 99.84
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 99.71
COG3268382 Uncharacterized conserved protein [Function unknow 99.4
KOG2733|consensus423 99.37
PRK13304265 L-aspartate dehydrogenase; Reviewed 99.09
TIGR01921324 DAP-DH diaminopimelate dehydrogenase. This model r 99.09
PRK13302271 putative L-aspartate dehydrogenase; Provisional 99.09
COG0673342 MviM Predicted dehydrogenases and related proteins 99.08
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 99.01
KOG0172|consensus445 98.97
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 98.95
PRK11579346 putative oxidoreductase; Provisional 98.94
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 98.9
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 98.87
PRK00048257 dihydrodipicolinate reductase; Provisional 98.82
PRK10206344 putative oxidoreductase; Provisional 98.81
PRK12549284 shikimate 5-dehydrogenase; Reviewed 98.77
PRK12548289 shikimate 5-dehydrogenase; Provisional 98.74
PRK13303265 L-aspartate dehydrogenase; Provisional 98.73
PRK14027283 quinate/shikimate dehydrogenase; Provisional 98.72
TIGR01761343 thiaz-red thiazolinyl imide reductase. This reduct 98.72
TIGR00036266 dapB dihydrodipicolinate reductase. 98.68
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 98.68
KOG2741|consensus351 98.65
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 98.63
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 98.63
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 98.62
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 98.62
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 98.53
PRK12550272 shikimate 5-dehydrogenase; Reviewed 98.51
PRK06270341 homoserine dehydrogenase; Provisional 98.43
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 98.3
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 98.26
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 98.26
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 98.26
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 98.22
PRK08618325 ornithine cyclodeaminase; Validated 98.2
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 98.2
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 98.19
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 98.18
TIGR03855229 NAD_NadX aspartate dehydrogenase. Members of this 98.16
PRK06349426 homoserine dehydrogenase; Provisional 98.14
PRK13301267 putative L-aspartate dehydrogenase; Provisional 98.13
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 98.13
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 98.11
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 98.09
PRK13940414 glutamyl-tRNA reductase; Provisional 98.09
PLN02712667 arogenate dehydrogenase 98.06
CHL00194317 ycf39 Ycf39; Provisional 98.03
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 98.02
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 98.02
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 98.01
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 98.01
PRK08300302 acetaldehyde dehydrogenase; Validated 97.99
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 97.98
KOG0409|consensus327 97.97
PRK06141314 ornithine cyclodeaminase; Validated 97.97
PRK08306296 dipicolinate synthase subunit A; Reviewed 97.97
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 97.95
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 97.95
PLN00203519 glutamyl-tRNA reductase 97.9
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 97.9
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 97.9
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 97.9
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 97.87
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 97.87
PLN02350493 phosphogluconate dehydrogenase (decarboxylating) 97.86
PRK11908347 NAD-dependent epimerase/dehydratase family protein 97.85
COG0569225 TrkA K+ transport systems, NAD-binding component [ 97.85
COG4091438 Predicted homoserine dehydrogenase [Amino acid tra 97.84
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 97.82
PRK07340304 ornithine cyclodeaminase; Validated 97.82
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 97.81
PRK05447385 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P 97.79
PLN02427386 UDP-apiose/xylose synthase 97.78
COG2910211 Putative NADH-flavin reductase [General function p 97.74
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 97.73
PRK08291330 ectoine utilization protein EutC; Validated 97.72
PRK06046326 alanine dehydrogenase; Validated 97.72
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 97.72
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 97.71
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 97.71
PRK08374336 homoserine dehydrogenase; Provisional 97.65
PRK06392326 homoserine dehydrogenase; Provisional 97.65
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 97.63
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 97.62
PLN03209576 translocon at the inner envelope of chloroplast su 97.62
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 97.61
PRK15059292 tartronate semialdehyde reductase; Provisional 97.61
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 97.6
PRK07680273 late competence protein ComER; Validated 97.6
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 97.58
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 97.58
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 97.57
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 97.56
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 97.56
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 97.54
PRK08219227 short chain dehydrogenase; Provisional 97.52
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 97.52
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 97.51
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 97.51
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 97.51
PTZ00142470 6-phosphogluconate dehydrogenase; Provisional 97.5
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 97.5
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 97.5
PRK07502307 cyclohexadienyl dehydrogenase; Validated 97.49
cd01483143 E1_enzyme_family Superfamily of activating enzymes 97.48
COG2085211 Predicted dinucleotide-binding enzymes [General fu 97.48
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 97.47
PRK08223287 hypothetical protein; Validated 97.45
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.44
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 97.43
COG0460333 ThrA Homoserine dehydrogenase [Amino acid transpor 97.43
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 97.42
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 97.41
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 97.4
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 97.4
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 97.37
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 97.36
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 97.35
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 97.35
PLN02214342 cinnamoyl-CoA reductase 97.35
PLN02858 1378 fructose-bisphosphate aldolase 97.35
TIGR00873467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 97.33
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 97.33
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 97.33
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 97.32
PRK06407301 ornithine cyclodeaminase; Provisional 97.32
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 97.32
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 97.32
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 97.3
PRK08267260 short chain dehydrogenase; Provisional 97.3
PRK05600370 thiamine biosynthesis protein ThiF; Validated 97.3
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 97.28
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 97.27
PLN02858 1378 fructose-bisphosphate aldolase 97.27
PRK09496453 trkA potassium transporter peripheral membrane com 97.26
PRK07589346 ornithine cyclodeaminase; Validated 97.26
COG3804350 Uncharacterized conserved protein related to dihyd 97.26
PRK08328231 hypothetical protein; Provisional 97.23
PRK06823315 ornithine cyclodeaminase; Validated 97.21
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 97.21
PRK08655437 prephenate dehydrogenase; Provisional 97.2
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 97.19
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 97.18
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 97.18
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 97.18
PRK15116268 sulfur acceptor protein CsdL; Provisional 97.15
PLN02896353 cinnamyl-alcohol dehydrogenase 97.15
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 97.14
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 97.13
PRK09496453 trkA potassium transporter peripheral membrane com 97.13
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 97.13
KOG1502|consensus327 97.12
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 97.11
PRK14874334 aspartate-semialdehyde dehydrogenase; Provisional 97.11
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.08
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 97.08
PRK07326237 short chain dehydrogenase; Provisional 97.05
PRK06182273 short chain dehydrogenase; Validated 97.04
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 97.03
PRK06101240 short chain dehydrogenase; Provisional 97.03
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 97.02
PRK07454241 short chain dehydrogenase; Provisional 97.02
COG5310481 Homospermidine synthase [Secondary metabolites bio 97.01
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 97.01
PLN02650351 dihydroflavonol-4-reductase 97.0
PLN02256304 arogenate dehydrogenase 97.0
PLN02353473 probable UDP-glucose 6-dehydrogenase 97.0
PRK07102243 short chain dehydrogenase; Provisional 96.98
PRK06196315 oxidoreductase; Provisional 96.98
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 96.97
PLN02688266 pyrroline-5-carboxylate reductase 96.97
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 96.97
PRK05884223 short chain dehydrogenase; Provisional 96.96
TIGR00978341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 96.96
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 96.96
PRK07411390 hypothetical protein; Validated 96.96
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 96.96
PRK12829264 short chain dehydrogenase; Provisional 96.96
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 96.95
PRK06153393 hypothetical protein; Provisional 96.94
PRK10538248 malonic semialdehyde reductase; Provisional 96.94
PRK04148134 hypothetical protein; Provisional 96.94
PLN02695370 GDP-D-mannose-3',5'-epimerase 96.92
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 96.92
COG0300265 DltE Short-chain dehydrogenases of various substra 96.91
PRK07024257 short chain dehydrogenase; Provisional 96.91
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.9
PRK06194287 hypothetical protein; Provisional 96.9
PRK07417279 arogenate dehydrogenase; Reviewed 96.89
PRK11863313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 96.89
PRK07825273 short chain dehydrogenase; Provisional 96.89
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 96.88
PRK06813346 homoserine dehydrogenase; Validated 96.88
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 96.88
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 96.87
PRK07523255 gluconate 5-dehydrogenase; Provisional 96.86
PRK06482276 short chain dehydrogenase; Provisional 96.86
TIGR01546333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 96.86
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 96.85
PLN02253280 xanthoxin dehydrogenase 96.85
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 96.85
PRK06180277 short chain dehydrogenase; Provisional 96.84
PRK07453322 protochlorophyllide oxidoreductase; Validated 96.84
PRK05866293 short chain dehydrogenase; Provisional 96.84
PRK08265261 short chain dehydrogenase; Provisional 96.83
PLN00198338 anthocyanidin reductase; Provisional 96.83
PLN00016378 RNA-binding protein; Provisional 96.81
PRK09186256 flagellin modification protein A; Provisional 96.81
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 96.8
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 96.8
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.78
cd01486307 Apg7 Apg7 is an E1-like protein, that activates tw 96.77
PLN02240352 UDP-glucose 4-epimerase 96.76
PRK08507275 prephenate dehydrogenase; Validated 96.76
PRK07904253 short chain dehydrogenase; Provisional 96.76
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 96.76
PLN02583297 cinnamoyl-CoA reductase 96.75
PRK05717255 oxidoreductase; Validated 96.75
PRK12320699 hypothetical protein; Provisional 96.75
PRK06138252 short chain dehydrogenase; Provisional 96.75
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 96.74
PRK09291257 short chain dehydrogenase; Provisional 96.74
PRK07060245 short chain dehydrogenase; Provisional 96.74
PRK05693274 short chain dehydrogenase; Provisional 96.74
PRK05993277 short chain dehydrogenase; Provisional 96.73
PRK05867253 short chain dehydrogenase; Provisional 96.73
PRK05479330 ketol-acid reductoisomerase; Provisional 96.72
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 96.72
PLN02686367 cinnamoyl-CoA reductase 96.72
PRK06057255 short chain dehydrogenase; Provisional 96.71
PRK07890258 short chain dehydrogenase; Provisional 96.71
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 96.71
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 96.71
PRK10669558 putative cation:proton antiport protein; Provision 96.7
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 96.7
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 96.7
PRK14982340 acyl-ACP reductase; Provisional 96.7
PRK14852989 hypothetical protein; Provisional 96.7
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 96.7
PRK06949258 short chain dehydrogenase; Provisional 96.7
PRK08309177 short chain dehydrogenase; Provisional 96.69
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 96.69
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.68
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 96.68
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.68
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.67
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 96.67
PRK08340259 glucose-1-dehydrogenase; Provisional 96.67
PRK07814263 short chain dehydrogenase; Provisional 96.66
PRK08177225 short chain dehydrogenase; Provisional 96.65
PRK07774250 short chain dehydrogenase; Provisional 96.64
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.64
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 96.63
PRK15182425 Vi polysaccharide biosynthesis protein TviB; Provi 96.63
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 96.63
TIGR01381664 E1_like_apg7 E1-like protein-activating enzyme Gsa 96.63
PRK08643256 acetoin reductase; Validated 96.63
PRK12939250 short chain dehydrogenase; Provisional 96.62
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 96.62
PRK08664349 aspartate-semialdehyde dehydrogenase; Reviewed 96.62
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 96.62
TIGR01851310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 96.62
PRK07877722 hypothetical protein; Provisional 96.62
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.61
PRK07063260 short chain dehydrogenase; Provisional 96.61
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 96.6
PLN02712667 arogenate dehydrogenase 96.59
PRK06199379 ornithine cyclodeaminase; Validated 96.58
PRK05865 854 hypothetical protein; Provisional 96.58
PRK07067257 sorbitol dehydrogenase; Provisional 96.58
PRK05875276 short chain dehydrogenase; Provisional 96.58
PRK09466810 metL bifunctional aspartate kinase II/homoserine d 96.57
PRK03659601 glutathione-regulated potassium-efflux system prot 96.56
PRK07074257 short chain dehydrogenase; Provisional 96.56
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 96.55
PRK06197306 short chain dehydrogenase; Provisional 96.55
PRK08339263 short chain dehydrogenase; Provisional 96.54
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 96.53
PRK06718202 precorrin-2 dehydrogenase; Reviewed 96.53
PRK07478254 short chain dehydrogenase; Provisional 96.53
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 96.52
PTZ00325321 malate dehydrogenase; Provisional 96.52
PRK06500249 short chain dehydrogenase; Provisional 96.52
PRK12828239 short chain dehydrogenase; Provisional 96.52
PRK06139330 short chain dehydrogenase; Provisional 96.5
PRK08605332 D-lactate dehydrogenase; Validated 96.49
PRK07576264 short chain dehydrogenase; Provisional 96.47
PRK06172253 short chain dehydrogenase; Provisional 96.46
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 96.46
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 96.46
PRK03562621 glutathione-regulated potassium-efflux system prot 96.46
PRK09436819 thrA bifunctional aspartokinase I/homoserine dehyd 96.45
PRK08277278 D-mannonate oxidoreductase; Provisional 96.45
PLN02260668 probable rhamnose biosynthetic enzyme 96.44
PRK05876275 short chain dehydrogenase; Provisional 96.44
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 96.44
PRK06179270 short chain dehydrogenase; Provisional 96.44
PRK07109334 short chain dehydrogenase; Provisional 96.44
PRK06181263 short chain dehydrogenase; Provisional 96.44
PF04455103 Saccharop_dh_N: LOR/SDH bifunctional enzyme conser 96.44
PRK08251248 short chain dehydrogenase; Provisional 96.42
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 96.42
PRK07677252 short chain dehydrogenase; Provisional 96.41
PRK08263275 short chain dehydrogenase; Provisional 96.41
PRK08264238 short chain dehydrogenase; Validated 96.41
PRK06124256 gluconate 5-dehydrogenase; Provisional 96.41
PRK09072263 short chain dehydrogenase; Provisional 96.4
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 96.38
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 96.38
PLN02696454 1-deoxy-D-xylulose-5-phosphate reductoisomerase 96.36
PRK14851679 hypothetical protein; Provisional 96.36
PRK08040336 putative semialdehyde dehydrogenase; Provisional 96.36
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.35
PRK05854313 short chain dehydrogenase; Provisional 96.35
TIGR01296339 asd_B aspartate-semialdehyde dehydrogenase (peptid 96.35
PRK08213259 gluconate 5-dehydrogenase; Provisional 96.35
PRK08085254 gluconate 5-dehydrogenase; Provisional 96.34
PRK06953222 short chain dehydrogenase; Provisional 96.33
PRK05872296 short chain dehydrogenase; Provisional 96.32
PRK10675338 UDP-galactose-4-epimerase; Provisional 96.32
PRK13403335 ketol-acid reductoisomerase; Provisional 96.31
PLN02572442 UDP-sulfoquinovose synthase 96.29
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 96.29
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 96.28
PRK08589272 short chain dehydrogenase; Validated 96.25
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 96.25
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 96.25
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.25
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 96.25
PLN02928347 oxidoreductase family protein 96.25
PRK12827249 short chain dehydrogenase; Provisional 96.24
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 96.24
PRK13243333 glyoxylate reductase; Reviewed 96.24
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 96.23
PRK07062265 short chain dehydrogenase; Provisional 96.22
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 96.21
TIGR02130275 dapB_plant dihydrodipicolinate reductase. This nar 96.2
PRK06940275 short chain dehydrogenase; Provisional 96.2
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 96.19
PLN00203519 glutamyl-tRNA reductase 96.18
PRK12367245 short chain dehydrogenase; Provisional 96.18
PRK05650270 short chain dehydrogenase; Provisional 96.16
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 96.16
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.16
PRK06924251 short chain dehydrogenase; Provisional 96.16
PRK07097265 gluconate 5-dehydrogenase; Provisional 96.15
PRK07775274 short chain dehydrogenase; Provisional 96.14
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 96.13
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.13
PRK12746254 short chain dehydrogenase; Provisional 96.12
PRK09242257 tropinone reductase; Provisional 96.12
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 96.12
PRK06914280 short chain dehydrogenase; Provisional 96.12
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 96.11
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 96.1
PRK06545359 prephenate dehydrogenase; Validated 96.1
PTZ00079454 NADP-specific glutamate dehydrogenase; Provisional 96.09
PRK09135249 pteridine reductase; Provisional 96.08
PRK07806248 short chain dehydrogenase; Provisional 96.08
PRK07424406 bifunctional sterol desaturase/short chain dehydro 96.08
PRK07035252 short chain dehydrogenase; Provisional 96.08
PRK06947248 glucose-1-dehydrogenase; Provisional 96.07
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 96.07
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 96.06
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 96.06
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.06
PRK08268507 3-hydroxy-acyl-CoA dehydrogenase; Validated 96.06
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 96.05
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 96.05
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 96.04
PRK12742237 oxidoreductase; Provisional 96.04
PLN02206442 UDP-glucuronate decarboxylase 96.03
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 96.01
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 96.01
PRK07856252 short chain dehydrogenase; Provisional 96.01
TIGR02415254 23BDH acetoin reductases. One member of this famil 96.0
PLN02166436 dTDP-glucose 4,6-dehydratase 95.99
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.99
PLN02653340 GDP-mannose 4,6-dehydratase 95.99
PRK12480330 D-lactate dehydrogenase; Provisional 95.98
PRK08628258 short chain dehydrogenase; Provisional 95.97
PRK06483236 dihydromonapterin reductase; Provisional 95.96
PRK12921305 2-dehydropantoate 2-reductase; Provisional 95.95
PTZ00117319 malate dehydrogenase; Provisional 95.92
PRK05678291 succinyl-CoA synthetase subunit alpha; Validated 95.92
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.91
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 95.9
PLN02383344 aspartate semialdehyde dehydrogenase 95.9
PRK08324681 short chain dehydrogenase; Validated 95.9
PLN03139386 formate dehydrogenase; Provisional 95.9
PRK06198260 short chain dehydrogenase; Provisional 95.89
PRK06598369 aspartate-semialdehyde dehydrogenase; Reviewed 95.89
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 95.88
KOG1209|consensus289 95.88
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 95.88
PTZ00075476 Adenosylhomocysteinase; Provisional 95.86
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 95.84
PRK07831262 short chain dehydrogenase; Provisional 95.84
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.83
PLN02928347 oxidoreductase family protein 95.83
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 95.83
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 95.8
TIGR00243389 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomeras 95.8
COG0059338 IlvC Ketol-acid reductoisomerase [Amino acid trans 95.8
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 95.79
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 95.78
PRK07023243 short chain dehydrogenase; Provisional 95.76
PRK05855582 short chain dehydrogenase; Validated 95.76
PRK08017256 oxidoreductase; Provisional 95.76
PRK06125259 short chain dehydrogenase; Provisional 95.76
PRK08229341 2-dehydropantoate 2-reductase; Provisional 95.75
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 95.75
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 95.75
PRK12480330 D-lactate dehydrogenase; Provisional 95.74
PRK14806735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 95.71
COG0677436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 95.71
PRK06841255 short chain dehydrogenase; Provisional 95.71
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.71
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 95.7
PRK06223307 malate dehydrogenase; Reviewed 95.69
PRK00676338 hemA glutamyl-tRNA reductase; Validated 95.68
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 95.67
PRK12937245 short chain dehydrogenase; Provisional 95.66
PRK08226263 short chain dehydrogenase; Provisional 95.66
PRK09134258 short chain dehydrogenase; Provisional 95.66
PRK07832272 short chain dehydrogenase; Provisional 95.66
PRK14030445 glutamate dehydrogenase; Provisional 95.65
PRK07201657 short chain dehydrogenase; Provisional 95.64
TIGR01532325 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas 95.64
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 95.63
PRK08862227 short chain dehydrogenase; Provisional 95.63
PRK12935247 acetoacetyl-CoA reductase; Provisional 95.62
PLN02477410 glutamate dehydrogenase 95.61
PRK05599246 hypothetical protein; Provisional 95.61
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 95.61
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 95.6
PRK08605332 D-lactate dehydrogenase; Validated 95.6
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 95.6
PRK08703239 short chain dehydrogenase; Provisional 95.59
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.59
PLN02700377 homoserine dehydrogenase family protein 95.58
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 95.57
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 95.57
PRK09414445 glutamate dehydrogenase; Provisional 95.56
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 95.56
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 95.56
PRK07574385 formate dehydrogenase; Provisional 95.55
PRK13243333 glyoxylate reductase; Reviewed 95.54
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 95.53
PRK06114254 short chain dehydrogenase; Provisional 95.52
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 95.51
cd01490435 Ube1_repeat2 Ubiquitin activating enzyme (E1), rep 95.51
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 95.5
PRK06398258 aldose dehydrogenase; Validated 95.5
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 95.48
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 95.47
PRK08278273 short chain dehydrogenase; Provisional 95.46
PTZ00345365 glycerol-3-phosphate dehydrogenase; Provisional 95.46
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 95.45
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 95.45
PRK12824245 acetoacetyl-CoA reductase; Provisional 95.45
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.44
KOG2017|consensus427 95.44
TIGR01019286 sucCoAalpha succinyl-CoA synthetase, alpha subunit 95.43
PRK00141473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.43
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 95.42
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 95.41
PLN02775286 Probable dihydrodipicolinate reductase 95.38
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.37
COG0476254 ThiF Dinucleotide-utilizing enzymes involved in mo 95.36
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 95.36
PRK07201657 short chain dehydrogenase; Provisional 95.34
TIGR02279503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 95.34
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 95.31
TIGR03450351 mycothiol_INO1 inositol 1-phosphate synthase, Acti 95.3
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 95.3
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 95.3
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 95.29
PRK12743256 oxidoreductase; Provisional 95.28
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 95.27
cd05297423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 95.26
PRK07069251 short chain dehydrogenase; Validated 95.26
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 95.26
TIGR01327525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 95.24
PLN02358338 glyceraldehyde-3-phosphate dehydrogenase 95.24
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 95.23
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 95.18
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information 
Probab=100.00  E-value=3.4e-202  Score=1868.12  Aligned_cols=919  Identities=40%  Similarity=0.688  Sum_probs=839.2

Q ss_pred             CcEEEEEecCCCCCCceeecChHHHHHHHhCCC-----EEEEeCCCCCCCCchHHhhcCcEEccCccCCcEEEEecCCCc
Q psy12817          2 GKVIAIRREDQSVWERRAALAPSNVKRLVRSGV-----KVIVQPSNRRAYPVQAYANAGAIIQEDISEASIIFGVKQVPV   76 (1201)
Q Consensus         2 ~~~IGI~rE~~~~~ErRvpLtP~~V~~L~~~G~-----~VlVE~sagr~f~D~eY~~AGA~I~edls~adiIlgVKepp~   76 (1201)
                      +.+|||+||++++|||||||||++|++|++.|+     +|+||+|++|+|+|++|++|||+|++++++||+|||||+|++
T Consensus         5 ~~~IgI~kE~~~~~E~RVaLtP~~v~~L~~~G~~~~~~~V~VE~gA~a~f~D~~Y~~AGA~I~~~~~~adiIl~VkeP~~   84 (1042)
T PLN02819          5 NGVVGILAETVNKWERRAPLTPSHCARLLHSGKDRTVSRIIVQPSSKRIHHDAQYEDVGCEISEDLSDCGLILGVKQPKL   84 (1042)
T ss_pred             CcEEEEEecCCCCCCCccCcCHHHHHHHHHCCCCCCCCEEEEcCCCCCCCChHHHHHCCCEEECCCCCCCEEEEECCCCH
Confidence            678999999855699999999999999999998     999999999999999999999999999999999999999999


Q ss_pred             cCCCCCcEEEEEcCccccccCCHHHHHHHHhcCCeEEEeccccccCCCceeeccchhhhHHHHHHHHHHHHHHHhccCCC
Q psy12817         77 DLLLPNKTYCMFSHTIKAQETNMPLLDAILQKNIRLVDYEKLVDDEGNRVVAFGKYAGVAGMVNILHGLGLRLLALGHHT  156 (1201)
Q Consensus        77 ~~L~~~kt~i~FsHtiKaQ~~N~~lLd~ll~k~itlIdyE~i~d~~g~Rlvafg~~AgiAG~~avL~alg~rlL~~g~~t  156 (1201)
                      +.++++++|++|+|++|+|++|++++++|+++++|+||||.|+|++|+|+++||+|||++|++++||++|+|+|++++||
T Consensus        85 eell~~~~~i~fs~~~~aq~~n~~ll~~l~~k~it~~ayE~i~~~~G~rl~~fg~~AG~~g~~~~l~~~g~~~L~~~~~~  164 (1042)
T PLN02819         85 EMLLPDRAYAFFSHTHKAQPENMPLLDKILEERVSLFDYELIVGDHGKRLVAFGKYAGRAGMIDFFRGLGQRLLSLGYST  164 (1042)
T ss_pred             HHhcCCCEEEEEecccccccCCHHHHHHHHHcCCeEEEEeceECCCCCEEeechHHHHHHHHHHHHHHHHHHHHhccCCC
Confidence            88999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CccccCCCccccChHHHHHHHHhhhhhhhcCCCCCccCCeEEEEEcCcHHHHHHHHHHhhCCCcccCcccchhhhh----
Q psy12817        157 PFMHIGPAHNYRNSMMARQAIRDAGYEISLGNMPKSIGPLTIVFTGSGNVSQGAQEIFQELPYEYVPPEMLQKVAE----  232 (1201)
Q Consensus       157 Pfl~l~~~~~y~~~~~a~~av~~~G~~I~~gg~p~~i~P~~vvv~G~G~vg~GAi~~a~~Lg~~~V~~~dlr~~~~----  232 (1201)
                      |||+++++|+|+|+++|++||+++|++|++||+|+.++|++|||||+||||+||+++|+.|||++|+|++||++..    
T Consensus       165 pf~~l~~~~~y~~~~~~~~a~~~~G~~i~~~g~p~gv~P~~vVi~G~G~Vg~gA~~i~~~lg~~~v~~~~l~~l~~~~~~  244 (1042)
T PLN02819        165 PFLSLGSSYMYSSLAAAKAAVISVGEEIASSGLPLGICPLVFVFTGSGNVSQGAQEIFKLLPHTFVEPSKLPELKGISQN  244 (1042)
T ss_pred             cccccccccccCCHHHHHHHHHhccceeeccCCCCCCCCeEEEEeCCchHHHHHHHHHhhcCCCccCHHHHHHHHHhhcC
Confidence            9999999999999999999999999999999999779999999999999999999999999999999999999842    


Q ss_pred             -cCCcc--EEEecchhHHhhHHHhc-CCcccccccccCcccccchhhhhcCCcCcEEEEceecCCCCCcccCHHHHhccc
Q psy12817        233 -HGSNT--KIYACEVRRRNYLERIK-GGGYDYQEYNENPSLYRSLFASKIAPYASIIINGIYWAVGSPKLLTLPDAKNLL  308 (1201)
Q Consensus       233 -~ga~v--kvy~~~~~~~~~~e~~~-gg~f~~~ey~~~pe~y~s~f~~~i~p~~DvlIn~~~w~~~~PrLIT~e~v~~lm  308 (1201)
                       .+...  ++|+|.+.+++++++++ |++||+.|||+|||+|+|.|+++++|++||||||+||.+++|+|||++|++++|
T Consensus       245 ~~~~~~~~~~y~~~~~~~~~~~~~~~~~~f~~~~y~~~Pe~y~s~F~~~~~~~advlIn~i~~~~~~P~lvt~~~~~~~m  324 (1042)
T PLN02819        245 KISTKRVYQVYGCVVTSQDMVEHKDPSKQFDKADYYAHPEHYNPVFHEKIAPYASVIVNCMYWEKRFPRLLTTKQLQDLT  324 (1042)
T ss_pred             CccccccceeeeeecChHHHhhccCCccccchhhhccCchhccchhHHHhHhhCCEEEeeeecCCCCCceeCHHHHHHhh
Confidence             22221  39999999999999998 688999999999999999999999999999999999999999999999888889


Q ss_pred             CCCCCCCCCCCCCCCCCCCceeEEEeeccCCCCCeeeeccccCCCCCeeeccCCCCccccccccCCeEEEeeCCcCCCch
Q psy12817        309 RPNHMPWLPTSDGAPPLPHRLLGICDISADPGGSIEFMNECTTIDTPFCLYDADSNKDTKSFKGPGVLVCSIDNMPTQLP  388 (1201)
Q Consensus       309 kpg~~~~~~~~~~~~~~p~rlsvIvDIS~D~GGsiE~~~~~TTid~P~~~yd~~~~~~~~~~~~~GV~i~~VdNLPs~LP  388 (1201)
                      |||         +     +||+||||||||+||||||++++|||++|||.|||.+++.++++..+||+||||||||++||
T Consensus       325 k~G---------~-----~~l~vI~DVs~D~gG~ie~~~~~Tt~~~P~~~~~~~~~~~~~~~~~~gv~~~~VdNlP~~lP  390 (1042)
T PLN02819        325 RKG---------G-----CPLVGVCDITCDIGGSIEFLNKTTSIEKPFFRYNPSNNSYHDDMDGDGILCMAVDILPTEFA  390 (1042)
T ss_pred             cCC---------C-----ccceEEEEEccCCCCCeeecccCCCCcCCeEeecccccccccccCCCCeEEEEECCccccCH
Confidence            998         3     47999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhHHHHHHHHhcCCCCcccccCCCHHHHhcccccCCeecCCCchHHHHHHhhhhcccccc-cccchhhhhh
Q psy12817        389 MEATDFFGNLVFPYALDILQSDASKPIEEHNFSPAVQAAIIASNGELTPKFKYIEDLRQQSVKSRHKAD-IQTEESRNVL  467 (1201)
Q Consensus       389 ~eAS~~fs~~L~pyl~~l~~~~~~~~~~~~~~~~~l~~Avi~~~G~Lt~~~~yi~~lr~~~~~~~~~~~-~~~~~~~~v~  467 (1201)
                      +|||++||++|+||+..|++.+..     ...++.|++|+|+++|+||++|+||++||+.+.+...... .|++.+++|.
T Consensus       391 r~AS~~f~n~llpyv~~la~~g~~-----~~~~~~l~~a~~~~~G~lT~~~~yi~~~~~~~~~~~~~~~~~~~~~~~~v~  465 (1042)
T PLN02819        391 KEASQHFGNILSPFVGSLASMKEL-----AELPSHLRRACIAHRGSLTPLFEYIPRMRNSNAELAQDTVSSQSTFNILVS  465 (1042)
T ss_pred             HHHHHHHHHHHHHHHHHHHhCCch-----hccCHHHhcceeeeCCEecCchHHHHHHHhcccccccccccccccceEEEE
Confidence            999999999999999999977631     2468999999999999999999999999998755443322 2345566666


Q ss_pred             hccCCcccccchhhccccccchhhcccccccccccccchhccccCCCCcccccCCChhHHHHHHhccCCcCCccccchhh
Q psy12817        468 LLGAGYVSRPLIEYLHRDENIHITLGSLLKEDIDKDKFISFVQSDASKPIEEHNFSPAVQAAIIASNGELTPKFKYIEDL  547 (1201)
Q Consensus       468 ~~gsg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  547 (1201)
                      ++|                                ||||+||||+++|.|+..|             |    +|++++|+
T Consensus       466 l~g--------------------------------hl~d~~lin~~ld~i~~~g-------------g----~~~~~~~~  496 (1042)
T PLN02819        466 LSG--------------------------------HLFDKFLINEALDVIEAAG-------------G----SFHLAKCQ  496 (1042)
T ss_pred             eee--------------------------------ecccchhhhhhhhhhhccC-------------C----ceeeeeec
Confidence            655                                9999999999999999876             4    78888888


Q ss_pred             hhhhhccccccccc-------------------------------------------------------ccCCCeEEEEc
Q psy12817        548 RQQSVKSRHKADIQ-------------------------------------------------------TEESRNVLLLG  572 (1201)
Q Consensus       548 ~~q~~~~~s~~~~~-------------------------------------------------------~~~mkKVLILG  572 (1201)
                      .+|+.++.|++.++                                                       ...|+||+|||
T Consensus       497 ~gqs~~~~S~~~l~v~a~d~~~L~~i~~~l~~la~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~rIlVLG  576 (1042)
T PLN02819        497 VGQSADAESYSELEVGADDKEVLDQIIDSLTRLANPNEDYISPAREANKIFLKIGKVQQENECNEKAEVTKKSQNVLILG  576 (1042)
T ss_pred             cccCcccccceeeecccCcHHHHHHHHHHHHHhccccccccccchhhhhhhhhhhcccccccccccccccccCCcEEEEC
Confidence            88888777777654                                                       12488999999


Q ss_pred             CchhHHHHHHHHHhCCCCe-------------EEEEeCCHHHHHHHHHHcCCeeEEEeecCCCCchHHHhhccCCcEEEE
Q psy12817        573 AGYVSRPLIEYLHRDENIH-------------ITLGSLLKEDIDKVTNEFGRVEATLIDVNNGGSDNLSGLVRSADLVVS  639 (1201)
Q Consensus       573 AG~VG~~va~~La~~~~~~-------------VtVadR~~ekAe~La~~~~~v~~v~lDV~D~~~e~L~elI~~~DVVIs  639 (1201)
                      ||+||++++++|++.++.+             |+|+|++.++++++++.+++++++.+|+.|  .+++.++++++|+||+
T Consensus       577 AG~VG~~~a~~La~~~~~~~~~~~~~~~~~~lV~VaD~~~~~a~~la~~~~~~~~v~lDv~D--~e~L~~~v~~~DaVIs  654 (1042)
T PLN02819        577 AGRVCRPAAEYLASVKTISYYGDDSEEPTDVHVIVASLYLKDAKETVEGIENAEAVQLDVSD--SESLLKYVSQVDVVIS  654 (1042)
T ss_pred             CCHHHHHHHHHHHhCcCccccccccccccccEEEEECCCHHHHHHHHHhcCCCceEEeecCC--HHHHHHhhcCCCEEEE
Confidence            9999999999999877655             999999999999999988888999999998  8899999999999999


Q ss_pred             cCCCcccHHHHHHHHHcCCeEEEccCChHHHHHHHHHHHHcCCEEEeccccCchhHHHHHHHHHHHhhhcCCcEEEEEee
Q psy12817        640 LLPYNLHHHVAEFCIQHGKNLVTASYLSPEMMALHERAASAGITVLNEVGLDPGIDHLLAMECIDAAHLNGGKVESFVSY  719 (1201)
Q Consensus       640 ~lP~~~h~~VakacIeaGkh~VD~Syvs~e~~eLde~AkeAGVtil~e~GlDPGIdhmlA~~~idei~~~ggkV~sf~s~  719 (1201)
                      |+|+.+|..++++|+++|+||||++|.++++++|+++|+++|+++++++|||||++||+|++++++.++.+|+|.+|.+|
T Consensus       655 alP~~~H~~VAkaAieaGkHvv~eky~~~e~~~L~e~Ak~AGV~~m~e~GlDPGid~~lA~~~Id~~~~~~GkI~s~~s~  734 (1042)
T PLN02819        655 LLPASCHAVVAKACIELKKHLVTASYVSEEMSALDSKAKEAGITILCEMGLDPGIDHMMAMKMIDDAHERGGKVKSFTSY  734 (1042)
T ss_pred             CCCchhhHHHHHHHHHcCCCEEECcCCHHHHHHHHHHHHHcCCEEEECCccCHHHHHHHHHHHHHhhcccCCcEEEEEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999899999999999


Q ss_pred             cCCCCCCCCCCCccccccccChHHHHHHhccceeeeeCCeEEEecCCcccccccccccc--CCCceEEEeeCCCccchhh
Q psy12817        720 CGGLPAPECSENPLRYKFSWSPRGVLLNTLSSAKYLQNSQVVDIPAGGELMRTARPLDF--LPGFSFEGFANRDSLRYAQ  797 (1201)
Q Consensus       720 cGGLPaPe~~~nPL~YkfSWSp~gvL~a~~~~A~~l~dG~~v~Vp~~~~l~~~~~~idf--~pg~~lE~ypNRDSl~Y~~  797 (1201)
                      |||||+|++++|||+|||||||+|+|++++|||+|++||++++|++. +||+.+++++|  +||++||+||||||++|++
T Consensus       735 ~GGLP~pe~~~npL~YkfsWSp~gvi~~~~npa~~i~~G~~~~V~~~-~l~~~~~~~~~~~~p~~~lE~~pNRdSl~y~~  813 (1042)
T PLN02819        735 CGGLPSPEAANNPLAYKFSWNPAGAIKAGQNPAVYKSNGQIIHVDGE-NLFASAVRFRLPNLPAFALECLPNRDSLVYGE  813 (1042)
T ss_pred             EcCccCcccCCCcccccccCCHHHHHHHhcCcceeeECCEEEEecch-hhhhhccccccccCCCcceEEccCCCcchhHH
Confidence            99999999999999999999999999999999999999999999985 99999999876  7999999999999999999


Q ss_pred             hcccccccccccccceeccCHHHHHHHHHHcCCCCCCccccCCCCCCccCHHHHHHHHcCCCCCch-----hHHHHHHHH
Q psy12817        798 LYNIAAEAHTVVRGTLRYRGFVDAMQAIQKLGLLDLKEHPALHPSGPEICWRELVCTLLGLSTSDI-----FYENLKNIV  872 (1201)
Q Consensus       798 ~YgI~~~~~Tl~rgTLRy~Gf~e~~~~L~~LGLl~~ep~~~l~~~~~~it~r~~l~~lL~~~~~~~-----~~~~~~~~~  872 (1201)
                      .|||+.+++|++||||||+||+++|++|++|||+++++++++.. +.++||+++++++|+.+.++.     .++.+..  
T Consensus       814 ~Ygi~~~a~tl~RgTLRy~Gf~~~~~~l~~LGl~~~~~~~~~~~-~~~~tw~~~~~~~l~~~~~~~~~~~~~~~~~~~--  890 (1042)
T PLN02819        814 LYGIEKEAATIFRGTLRYEGFSMIMATLSKLGLFDSENHPLLST-GKRTTYGALLDALLLQDGHNENGPLAGEEEISK--  890 (1042)
T ss_pred             HhCCCcccceeeEEEEecCCHHHHHHHHHHcCCCCCCccccccC-CCCCCHHHHHHHHhCCCCcccccccccchhHHH--
Confidence            99997789999999999999999999999999999999997754 457899999999999743221     0111111  


Q ss_pred             HhhhcCcchhHHHhhccccchhhhcccCCCcchhhhHHHhhhhhhhhcccccccccCcceeecccccccccchhhhccch
Q psy12817        873 ADKVGNTGLEALEALGLLNDDIIVQKQNTPIDTLSHFLRQKLNIRLVDYEKLVDDEGNRVVAFGKYAGVAGMVNILHGLG  952 (1201)
Q Consensus       873 ~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~d~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  952 (1201)
                                                                                                      
T Consensus       891 --------------------------------------------------------------------------------  890 (1042)
T PLN02819        891 --------------------------------------------------------------------------------  890 (1042)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhhhcCCCCCccccCCCcccchhhhHHHHhhhcccccccCCCCCCCCCceeeecCCCccccchhhhhhcCchhHHHHhh
Q psy12817        953 LRLLALGHHTPFMHIGPAHNYRNSMMARQAIRDAGYEISLGNMPKSIGPLTIVFTGSGNVSQGAQEIFQELPYEELVCTL 1032 (1201)
Q Consensus       953 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~e~~~~~~~~~~~~~~ 1032 (1201)
                       +++..+++                                                                       
T Consensus       891 -~~~~~~~~-----------------------------------------------------------------------  898 (1042)
T PLN02819        891 -RLAKLGHS-----------------------------------------------------------------------  898 (1042)
T ss_pred             -HHHhhhcc-----------------------------------------------------------------------
Confidence             11111111                                                                       


Q ss_pred             ccCCCchhhhhhhhhhhcccchhhHHHHHHHhCCCCCccccCCCCCHHHHHHHHHHhhcCCCCCCccEEEEEeeEEEEeC
Q psy12817       1033 LGLSTSDIFYENLKNIVADKVGNTGLEALEALGLLNDDIIVQKQNTPIDTLSHFLRQKLVLDDGDRDVIVLRHDIDILWP 1112 (1201)
Q Consensus      1033 ~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~lg~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~d~~~~~h~~~~~~~ 1112 (1201)
                                      ........++++|+|||||+++.+...++||+|+||++|++||.|+++|||||||||+|+++|+
T Consensus       899 ----------------~~~~~~~~~~~~l~~lgl~~~~~v~~~~~tp~d~l~~~Le~kl~y~~~e~DmVvl~h~~~~e~~  962 (1042)
T PLN02819        899 ----------------KNRETAAKAAKTIVFLGLDEETEVPKSCKSIFDVTCYRMEEKLAYSGNEQDMVLLHHEVEVEFP  962 (1042)
T ss_pred             ----------------cchhhHHHHHHHhhhhcccccccccCCCCCHHHHHHHHHHHHhCCCCCCCeEEEEEEEEEEEEC
Confidence                            0011145779999999999988555578999999999999999999999999999999999999


Q ss_pred             CCce-EEEEEeEEEEcCCCC---cchhhhccchhHHHHHHHHHcCccceeeccc
Q psy12817       1113 NRSR-ERKSISLVVYGQPNG---TTAMAKTVGLPAAIAAKMILEGEFFVTTSTS 1162 (1201)
Q Consensus      1113 ~~~~-~~~~~~l~~~g~~~~---~~ama~tvg~p~ai~~~~~l~~~~~~~~~~~ 1162 (1201)
                      +|++ |++++||++||++++   +||||||||+|+||||+|||+|+|+.||+..
T Consensus       963 ~g~~~~~~t~tlv~~Gd~~~g~~~SAMAktVG~P~aiaa~lil~g~I~~~Gv~~ 1016 (1042)
T PLN02819        963 DSKRIEKHSATLLEFGEIKNGRTTTAMAKTVGIPAAIGALLLLEGKIKTRGVLR 1016 (1042)
T ss_pred             CCCceEEEEEEEEEecCcCCCCcccHHHHhhcchHHHHHHHHhCCCcCCCeeeC
Confidence            9998 999999999999985   8999999999999999999999999999976

>KOG0172|consensus Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>COG3288 PntA NAD/NADP transhydrogenase alpha subunit [Energy production and conversion] Back     alignment and domain information
>PF05222 AlaDh_PNT_N: Alanine dehydrogenase/PNT, N-terminal domain; InterPro: IPR007886 Alanine dehydrogenases (1 Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>COG3268 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2733|consensus Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>KOG0172|consensus Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>KOG2741|consensus Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>TIGR03855 NAD_NadX aspartate dehydrogenase Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>KOG0409|consensus Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>COG3804 Uncharacterized conserved protein related to dihydrodipicolinate reductase [Function unknown] Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>KOG1502|consensus Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG5310 Homospermidine synthase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06813 homoserine dehydrogenase; Validated Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF04455 Saccharop_dh_N: LOR/SDH bifunctional enzyme conserved region ; InterPro: IPR007545 Lysine-oxoglutarate reductase/Saccharopine dehydrogenase (LOR/SDH) is a bifunctional enzyme Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PLN02696 1-deoxy-D-xylulose-5-phosphate reductoisomerase Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR02130 dapB_plant dihydrodipicolinate reductase Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK05678 succinyl-CoA synthetase subunit alpha; Validated Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>KOG1209|consensus Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00243 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02700 homoserine dehydrogenase family protein Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>KOG2017|consensus Back     alignment and domain information
>TIGR01019 sucCoAalpha succinyl-CoA synthetase, alpha subunit Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PLN02775 Probable dihydrodipicolinate reductase Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG0476 ThiF Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>TIGR03450 mycothiol_INO1 inositol 1-phosphate synthase, Actinobacterial type Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PLN02358 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1201
1ff9_A450 Apo Saccharopine Reductase Length = 450 1e-65
1ff9_A450 Apo Saccharopine Reductase Length = 450 4e-11
2axq_A467 Apo Histidine-Tagged Saccharopine Dehydrogenase (L- 2e-61
2axq_A467 Apo Histidine-Tagged Saccharopine Dehydrogenase (L- 1e-10
2q99_A381 Crystal Structure Of Saccharopine Dehydrogenase Fro 5e-18
2qrj_A394 Crystal Structure Of Sulfate-Bound Saccharopine Deh 6e-18
3ugk_A373 Crystal Structure Of C205s Mutant And Saccharopine 7e-18
3abi_A365 Crystal Structure Of L-Lysine Dehydrogenase From Hy 4e-16
>pdb|1FF9|A Chain A, Apo Saccharopine Reductase Length = 450 Back     alignment and structure 
Iteration: 1

 Score =  248 bits (634), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 129/297 (43%), Positives = 188/297 (63%), Gaps = 8/297 (2%)
Query: 565 SRNVLLLGAGYVSRPLIEYLHRDENIHITLGSLLKEDIDKVTNEFGRVEATLIDVNNGGS 624
           +++VL+LG+G+V+RP ++ L  D  I +T+     E   K++          +DVN+  +
Sbjct: 3   TKSVLMLGSGFVTRPTLDVL-TDSGIKVTVACRTLESAKKLSAGVQHSTPISLDVNDDAA 61
Query: 625 DNLSGLVRSADLVVSLLPYNLHHHVAEFCIQHGKNLVTASYLSPEMMALHERAASAGITV 684
             L   V   DLV+SL+PY  H  V +  I+  K++VT SY+SP MM L + A  AGITV
Sbjct: 62  --LDAEVAKHDLVISLIPYTFHATVIKSAIRQKKHVVTTSYVSPAMMELDQAAKDAGITV 119
Query: 685 LNEVGLDPGIDHLLAMECIDAAHLNGGKVESFVSYCGGLPAPECSENPLRYKFSWSPRGV 744
           +NE+GLDPGIDHL A++ I+  H  GGK+++F+SYCGGLPAPE S+NPL YKFSWS RGV
Sbjct: 120 MNEIGLDPGIDHLYAIKTIEEVHAAGGKIKTFLSYCGGLPAPESSDNPLGYKFSWSSRGV 179
Query: 745 LLNTLSSAKYLQNSQVVDIPAGGELMRTARPLDFLPGFSFEGFANRDSLRYAQLYNIAAE 804
           LL   ++A + ++ +V ++ AG ELM TA+P    PGF+F  + NRDS  Y + Y I  E
Sbjct: 180 LLALRNAASFYKDGKVTNV-AGPELMATAKPYFIYPGFAFVAYPNRDSTPYKERYQI-PE 237
Query: 805 AHTVVRGTLRYRGFVDAMQAIQKLGLLDLKEHPALHPSGPEICWRELVCTLLGLSTS 861
           A  +VRGTLRY+GF   ++ +  +G L  +E P L  + P   W+E    ++  S++
Sbjct: 238 ADNIVRGTLRYQGFPQFIKVLVDIGFLSDEEQPFLKEAIP---WKEATQKIVKASSA 291
>pdb|1FF9|A Chain A, Apo Saccharopine Reductase Length = 450 Back     alignment and structure
>pdb|2AXQ|A Chain A, Apo Histidine-Tagged Saccharopine Dehydrogenase (L-Glu Forming) From Saccharomyces Cerevisiae Length = 467 Back     alignment and structure
>pdb|2AXQ|A Chain A, Apo Histidine-Tagged Saccharopine Dehydrogenase (L-Glu Forming) From Saccharomyces Cerevisiae Length = 467 Back     alignment and structure
>pdb|2Q99|A Chain A, Crystal Structure Of Saccharopine Dehydrogenase From Saccharomyces Cerevisiae Length = 381 Back     alignment and structure
>pdb|2QRJ|A Chain A, Crystal Structure Of Sulfate-Bound Saccharopine Dehydrogenase (L-Lys Forming) From Saccharomyces Cerevisiae Length = 394 Back     alignment and structure
>pdb|3UGK|A Chain A, Crystal Structure Of C205s Mutant And Saccharopine Dehydrogenase From Saccharomyces Cerevisiae. Length = 373 Back     alignment and structure
>pdb|3ABI|A Chain A, Crystal Structure Of L-Lysine Dehydrogenase From Hyperthermophilic Archaeon Pyrococcus Horikoshii Length = 365 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1201
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 4e-82
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 3e-16
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 4e-80
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 4e-22
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 6e-08
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 1e-76
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 1e-17
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 3e-05
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 6e-66
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 1e-05
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 1e-05
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 7e-16
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 5e-07
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 1e-06
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 1e-06
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 4e-06
2ph5_A480 Homospermidine synthase; alpha-beta protein, struc 6e-04
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 8e-04
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Length = 394 Back     alignment and structure
 Score =  273 bits (698), Expect = 4e-82
 Identities = 94/423 (22%), Positives = 151/423 (35%), Gaps = 81/423 (19%)

Query: 4   VIAIRREDQSVWERRAALAPSNVKRLVRSGVKVIVQPSNRRAYPVQAYANAGAIIQEDIS 63
            + +R E     E RAAL P+ VK+L+  G K+ V+ S +  + +  Y  AGAII    S
Sbjct: 26  TLHLRAE-TKPLEARAALTPTTVKKLIAKGFKIYVEDSPQSTFNINEYRQAGAIIVPAGS 84

Query: 64  E-----ASIIFGVKQVPVDLLLP-NKTYCMFSHTIKAQETNMPLLDAILQKNIRLVDYEK 117
                   II G+K++P     P    +  F+H  K Q     +L   ++ +  L D E 
Sbjct: 85  WKTAPRDRIIIGLKEMPETDTFPLVHEHIQFAHCYKDQAGWQNVLMRFIKGHGTLYDLEF 144

Query: 118 LVDDEGNRVVAFGKYAGVAGMVNILHGLGLRLLALGHHTPFMHIGPAHNYRNSMMARQAI 177
           L +D+G RV AFG YAG AG    +     +      H+    +     Y N    +  +
Sbjct: 145 LENDQGRRVAAFGFYAGFAGAALGVRDWAFK----QTHSDDEDLPAVSPYPN---EKALV 197

Query: 178 RDAGYEISLGNMPKSIGPLTIVFTGSGNVSQGAQEIFQELPYEYVPPEMLQKVAEHGSNT 237
           +D   +        +  P  ++    G    GA ++  ++                    
Sbjct: 198 KDVTKDYKEALATGARKPTVLIIGALGRCGSGAIDLLHKV-------------------- 237

Query: 238 KIYACEVRRRNYLERIKGGGYDYQEYNENPSLYRSLFASKIAPYASIIINGIYWAVGSPK 297
            I    + + +  E  +GG +D                    P A I IN IY +     
Sbjct: 238 GIPDANILKWDIKETSRGGPFDE------------------IPQADIFINCIYLSKPIAP 279

Query: 298 LLTLPDAKNLLRPNHMPWLPTSDGAPPLPHRLLGICDISADPGG---SIEFMNECTTIDT 354
              +    N  R                      + D+SAD       I      T  + 
Sbjct: 280 FTNMEKLNNPNRRL------------------RTVVDVSADTTNPHNPIPIYTVATVFNK 321

Query: 355 PFCLYDADSNKDTKSFKGPGVLVCSIDNMPTQLPMEATDFFGNLVFPYALDILQSDASKP 414
           P  L          +  GP + V SID++P+ LP EA++FF + + P    + Q   +  
Sbjct: 322 PTVLVP--------TTAGPKLSVISIDHLPSLLPREASEFFSHDLLPSLELLPQRKTAPV 373

Query: 415 IEE 417
              
Sbjct: 374 WVR 376
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Length = 394 Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Length = 467 Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Length = 467 Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Length = 467 Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Length = 450 Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Length = 450 Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Length = 450 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Length = 118 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Length = 118 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Length = 405 Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Length = 381 Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Length = 401 Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Length = 384 Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Length = 480 Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Length = 361 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1201
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 100.0
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 100.0
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 100.0
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 100.0
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 100.0
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 100.0
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 100.0
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 100.0
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 100.0
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 100.0
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 100.0
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 100.0
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 100.0
2ph5_A480 Homospermidine synthase; alpha-beta protein, struc 99.8
2rir_A300 Dipicolinate synthase, A chain; structural genomic 99.59
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 99.45
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 99.31
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 99.26
4had_A350 Probable oxidoreductase protein; structural genomi 99.23
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 99.22
4gqa_A412 NAD binding oxidoreductase; structural genomics, P 99.2
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 99.19
4h3v_A390 Oxidoreductase domain protein; structural genomics 99.19
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 99.18
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 99.18
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 99.18
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 99.17
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 99.17
4fb5_A393 Probable oxidoreductase protein; PSI-biology, nysg 99.17
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 99.16
3euw_A344 MYO-inositol dehydrogenase; protein structure init 99.16
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 99.14
3ohs_X334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 99.14
1zh8_A340 Oxidoreductase; TM0312, structural genomics, JO ce 99.14
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 99.13
1ydw_A362 AX110P-like protein; structural genomics, protein 99.12
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 99.12
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 99.12
3i23_A349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 99.1
3moi_A387 Probable dehydrogenase; structural genomics, PSI2, 99.09
1h6d_A433 Precursor form of glucose-fructose oxidoreductase; 99.09
3dty_A398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 99.09
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 99.09
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, struct 99.09
3v5n_A417 Oxidoreductase; structural genomics, PSI-biology, 99.08
3e82_A364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 99.07
3f4l_A345 Putative oxidoreductase YHHX; structural genomics, 99.07
3kux_A352 Putative oxidoreductase; oxidoreductase family, cs 99.07
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 99.07
3fhl_A362 Putative oxidoreductase; NAD-binding domain, PSI-2 99.04
2ixa_A444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 99.03
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural g 99.03
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 99.02
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 99.01
3gdo_A358 Uncharacterized oxidoreductase YVAA; structural ge 99.01
3oqb_A383 Oxidoreductase; structural genomics, protein struc 98.99
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 98.98
3u3x_A361 Oxidoreductase; structural genomics, PSI-biology, 98.97
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 98.96
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 98.95
3oa2_A318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 98.95
4gmf_A372 Yersiniabactin biosynthetic protein YBTU; rossmann 98.89
3btv_A438 Galactose/lactose metabolism regulatory protein GA 98.89
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 98.88
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 98.87
2nvw_A479 Galactose/lactose metabolism regulatory protein GA 98.87
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 98.86
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 98.82
3upl_A446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 98.82
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 98.8
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 98.79
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 98.77
3ip3_A337 Oxidoreductase, putative; structural genomics, PSI 98.76
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 98.76
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 98.75
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 98.75
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 98.74
4ew6_A330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 98.7
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 98.68
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 98.67
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 98.67
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 98.66
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrro 98.66
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 98.65
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 98.65
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 98.62
3do5_A327 HOM, homoserine dehydrogenase; NP_069768.1, putati 98.56
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 98.51
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 98.51
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 98.43
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 98.43
3mtj_A444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 98.41
3ing_A325 Homoserine dehydrogenase; NP_394635.1, structural 98.41
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 98.33
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 98.32
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 98.31
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 98.3
1lss_A140 TRK system potassium uptake protein TRKA homolog; 98.27
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 98.27
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 98.26
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 98.26
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 98.26
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 98.25
1r0k_A388 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 98.24
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 98.24
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 98.24
3c8m_A331 Homoserine dehydrogenase; structural genomics, APC 98.24
2czc_A334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 98.22
1ebf_A358 Homoserine dehydrogenase; dinucleotide, NAD, dimer 98.21
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 98.2
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 98.2
2ejw_A332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 98.19
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 98.19
3l6d_A306 Putative oxidoreductase; structural genomics, prot 98.17
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 98.17
1nvm_B312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 98.16
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 98.16
1xq6_A253 Unknown protein; structural genomics, protein stru 98.15
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 98.14
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 98.14
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 98.14
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 98.14
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 98.13
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 98.12
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 98.12
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 98.11
1vpd_A299 Tartronate semialdehyde reductase; structural geno 98.11
3slg_A372 PBGP3 protein; structural genomics, seattle struct 98.11
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 98.09
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 98.08
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 98.07
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 98.06
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 98.05
2wm3_A299 NMRA-like family domain containing protein 1; unkn 98.05
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 98.04
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 98.03
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 98.03
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 98.02
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 98.02
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 98.02
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 98.02
3c85_A183 Putative glutathione-regulated potassium-efflux S 98.01
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 98.01
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 98.01
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 98.0
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 97.98
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 97.98
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 97.97
2rir_A300 Dipicolinate synthase, A chain; structural genomic 97.97
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 97.96
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 97.96
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 97.95
1j5p_A253 Aspartate dehydrogenase; TM1643, structural genomi 97.94
3qha_A296 Putative oxidoreductase; seattle structural genomi 97.93
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 97.93
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 97.91
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 97.9
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 97.89
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 97.89
1yb4_A295 Tartronic semialdehyde reductase; structural genom 97.89
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 97.89
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.88
3ius_A286 Uncharacterized conserved protein; APC63810, silic 97.88
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 97.87
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 97.87
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 97.87
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 97.86
3a06_A376 1-deoxy-D-xylulose 5-phosphate reductoisomerase; M 97.85
4ezb_A317 Uncharacterized conserved protein; structural geno 97.84
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 97.84
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 97.84
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 97.83
1cf2_P337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 97.83
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 97.83
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 97.83
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 97.82
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 97.81
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 97.78
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 97.78
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 97.78
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 97.77
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 97.76
1b7g_O340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 97.76
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 97.76
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 97.76
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 97.75
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 97.74
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 97.73
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 97.72
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 97.71
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 97.7
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 97.69
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 97.68
2ozp_A345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 97.67
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 97.67
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 97.66
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 97.66
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 97.65
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 97.65
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 97.64
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 97.61
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 97.61
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 97.61
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 97.61
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 97.58
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 97.58
2ep5_A350 350AA long hypothetical aspartate-semialdehyde deh 97.58
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 97.57
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 97.56
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 97.56
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 97.56
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 97.54
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 97.54
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 97.54
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 97.53
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 97.51
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 97.51
2duw_A145 Putative COA-binding protein; ligand binding prote 97.5
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 97.5
1pgj_A478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 97.5
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 97.5
1xyg_A359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 97.5
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 97.5
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 97.5
4g65_A461 TRK system potassium uptake protein TRKA; structur 97.5
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 97.5
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 97.48
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 97.48
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 97.48
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 97.47
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 97.47
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 97.47
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 97.46
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 97.46
2yv2_A297 Succinyl-COA synthetase alpha chain; COA-binding d 97.46
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 97.46
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 97.44
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 97.44
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 97.44
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 97.44
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 97.44
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 97.42
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 97.42
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 97.42
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 97.42
2d59_A144 Hypothetical protein PH1109; COA binding, structur 97.42
4gsl_A615 Ubiquitin-like modifier-activating enzyme ATG7; ub 97.41
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 97.41
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 97.4
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 97.4
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 97.39
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 97.39
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 97.39
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 97.39
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 97.39
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 97.38
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 97.38
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 97.38
4g65_A461 TRK system potassium uptake protein TRKA; structur 97.38
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 97.38
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 97.37
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 97.37
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 97.37
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 97.36
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 97.36
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 97.36
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 97.34
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 97.34
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 97.34
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 97.33
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 97.33
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 97.33
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 97.33
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 97.32
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 97.32
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 97.32
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 97.31
1ys4_A354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 97.31
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 97.31
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 97.3
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 97.3
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 97.3
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 97.3
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 97.29
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 97.29
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 97.29
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 97.29
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 97.29
1nff_A260 Putative oxidoreductase RV2002; directed evolution 97.28
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 97.28
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 97.28
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 97.28
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 97.27
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 97.27
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 97.27
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 97.27
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 97.27
3slk_A795 Polyketide synthase extender module 2; rossmann fo 97.26
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 97.26
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 97.26
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 97.25
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 97.25
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 97.24
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 97.24
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 97.24
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 97.24
1spx_A278 Short-chain reductase family member (5L265); paral 97.24
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 97.23
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 97.23
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 97.23
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 97.23
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 97.22
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 97.22
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 97.21
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 97.21
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 97.21
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 97.2
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 97.2
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 97.2
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 97.19
4dqx_A277 Probable oxidoreductase protein; structural genomi 97.19
2nqt_A352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 97.18
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 97.17
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 97.17
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 97.16
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 97.16
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 97.16
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 97.16
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 97.15
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 97.15
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 97.15
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 97.15
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 97.15
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 97.14
3imf_A257 Short chain dehydrogenase; structural genomics, in 97.14
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 97.14
4f6c_A427 AUSA reductase domain protein; thioester reductase 97.14
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 97.13
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 97.13
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 97.13
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 97.13
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 97.13
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 97.13
3tjr_A301 Short chain dehydrogenase; structural genomics, se 97.13
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 97.12
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 97.12
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 97.12
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 97.12
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 97.12
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 97.11
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 97.11
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 97.11
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 97.11
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 97.11
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 97.11
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 97.1
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 97.1
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 97.1
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 97.1
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 97.09
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 97.09
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 97.09
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 97.08
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 97.08
4dpk_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 97.08
4dpl_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 97.08
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 97.08
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 97.08
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 97.08
1xkq_A280 Short-chain reductase family member (5D234); parra 97.08
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 97.07
3cxt_A291 Dehydrogenase with different specificities; rossma 97.07
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 97.07
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 97.06
4eso_A255 Putative oxidoreductase; NADP, structural genomics 97.06
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 97.06
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 97.05
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 97.05
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 97.05
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 97.05
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 97.05
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 97.05
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 97.04
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 97.04
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 97.04
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 97.04
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 97.03
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 97.03
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 97.03
1xhl_A297 Short-chain dehydrogenase/reductase family member 97.02
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 97.01
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 97.01
3rih_A293 Short chain dehydrogenase or reductase; structural 97.0
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 97.0
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 97.0
1xq1_A266 Putative tropinone reducatse; structural genomics, 97.0
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 97.0
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 97.0
2yyy_A343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 97.0
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 97.0
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 96.99
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 96.99
2dvm_A439 Malic enzyme, 439AA long hypothetical malate oxido 96.99
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 96.99
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 96.98
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 96.98
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 96.98
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 96.97
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 96.97
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 96.97
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 96.96
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 96.96
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 96.95
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 96.95
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 96.94
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 96.94
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 96.94
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 96.93
3tox_A280 Short chain dehydrogenase; structural genomics, PS 96.93
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 96.93
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 96.93
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 96.91
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 96.91
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 96.91
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 96.9
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 96.9
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 96.9
1z45_A699 GAL10 bifunctional protein; epimerase, mutarotase, 96.89
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 96.89
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 96.89
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 96.89
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 96.89
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 96.87
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 96.87
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 96.87
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 96.87
1gad_O330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 96.86
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 96.86
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 96.86
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 96.86
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 96.86
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.85
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 96.85
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 96.85
2r00_A336 Aspartate-semialdehyde dehydrogenase; conformation 96.84
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 96.84
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 96.84
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 96.84
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 96.84
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 96.84
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 96.84
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 96.83
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 96.83
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 96.82
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 96.82
1lnq_A336 MTHK channels, potassium channel related protein; 96.82
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 96.81
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 96.81
3gem_A260 Short chain dehydrogenase; structural genomics, AP 96.8
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 96.8
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 96.78
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 96.76
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 96.76
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 96.74
1iuk_A140 Hypothetical protein TT1466; structural genomics, 96.73
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 96.73
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.72
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.7
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 96.7
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 96.7
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 96.68
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 96.67
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 96.67
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 96.67
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 96.67
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 96.66
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 96.66
2fp4_A305 Succinyl-COA ligase [GDP-forming] alpha-chain, mit 96.65
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 96.64
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 96.64
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 96.63
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 96.63
3hsk_A381 Aspartate-semialdehyde dehydrogenase; candida albi 96.62
2hjs_A340 USG-1 protein homolog; aspartate-semialdehyde dehy 96.62
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 96.62
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 96.62
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 96.62
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 96.61
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 96.6
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 96.59
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 96.59
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 96.57
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 96.57
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 96.56
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 96.56
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 96.55
1rm4_O337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 96.54
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 96.54
3tsc_A277 Putative oxidoreductase; structural genomics, seat 96.54
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 96.52
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=4e-76  Score=695.15  Aligned_cols=418  Identities=39%  Similarity=0.689  Sum_probs=381.5

Q ss_pred             cCCCeEEEEcCchhHHHHHHHHHhCCCCeEEEEeCCHHHHHHHHHHcCCeeEEEeecCCCCchHHHhhccCCcEEEEcCC
Q psy12817        563 EESRNVLLLGAGYVSRPLIEYLHRDENIHITLGSLLKEDIDKVTNEFGRVEATLIDVNNGGSDNLSGLVRSADLVVSLLP  642 (1201)
Q Consensus       563 ~~mkKVLILGAG~VG~~va~~La~~~~~~VtVadR~~ekAe~La~~~~~v~~v~lDV~D~~~e~L~elI~~~DVVIs~lP  642 (1201)
                      .++++|+|+|+|.+|+.++..|++.++.+|++++|+.++++++++. .++..+.+|+.|  .+++.++++++|+||||+|
T Consensus        21 l~~k~VlIiGAGgiG~aia~~L~~~~g~~V~v~~R~~~ka~~la~~-~~~~~~~~D~~d--~~~l~~~l~~~DvVIn~tp   97 (467)
T 2axq_A           21 HMGKNVLLLGSGFVAQPVIDTLAANDDINVTVACRTLANAQALAKP-SGSKAISLDVTD--DSALDKVLADNDVVISLIP   97 (467)
T ss_dssp             --CEEEEEECCSTTHHHHHHHHHTSTTEEEEEEESSHHHHHHHHGG-GTCEEEECCTTC--HHHHHHHHHTSSEEEECSC
T ss_pred             CCCCEEEEECChHHHHHHHHHHHhCCCCeEEEEECCHHHHHHHHHh-cCCcEEEEecCC--HHHHHHHHcCCCEEEECCc
Confidence            4578999999999999999999998778999999999999998876 367777889987  7789999999999999999


Q ss_pred             CcccHHHHHHHHHcCCeEEEccCChHHHHHHHHHHHHcCCEEEeccccCchhHHHHHHHHHHHhhhcCCcEEEEEeecCC
Q psy12817        643 YNLHHHVAEFCIQHGKNLVTASYLSPEMMALHERAASAGITVLNEVGLDPGIDHLLAMECIDAAHLNGGKVESFVSYCGG  722 (1201)
Q Consensus       643 ~~~h~~VakacIeaGkh~VD~Syvs~e~~eLde~AkeAGVtil~e~GlDPGIdhmlA~~~idei~~~ggkV~sf~s~cGG  722 (1201)
                      ..++..++++|+++|+||+|.+|..+.+..+.+.|+++|+++++++|++||+++++++++++++++.|+++.+|.+|||+
T Consensus        98 ~~~~~~v~~a~l~~g~~vvd~~~~~p~~~~Ll~~Ak~aGv~~i~g~G~~PG~~~~~a~~li~q~~~~g~~~~s~~~wtG~  177 (467)
T 2axq_A           98 YTFHPNVVKSAIRTKTDVVTSSYISPALRELEPEIVKAGITVMNEIGLDPGIDHLYAVKTIDEVHRAGGKLKSFLSYCGG  177 (467)
T ss_dssp             GGGHHHHHHHHHHHTCEEEECSCCCHHHHHHHHHHHHHTCEEECSCBBTTBHHHHHHHHHHHHHHHTTCEEEEEEEEEEE
T ss_pred             hhhhHHHHHHHHhcCCEEEEeecCCHHHHHHHHHHHHcCCEEEecCCcCccchHHHHHHHHHHHHhccCcceEEEEEecc
Confidence            98888999999999999999999889999999999999999999999999999999999999998888999999999999


Q ss_pred             CCCCCCCCCccccccccChHHHHHHhccceeeeeCCeEEEecCCccccccccccccCCCceEEEeeCCCccchhhhcccc
Q psy12817        723 LPAPECSENPLRYKFSWSPRGVLLNTLSSAKYLQNSQVVDIPAGGELMRTARPLDFLPGFSFEGFANRDSLRYAQLYNIA  802 (1201)
Q Consensus       723 LPaPe~~~nPL~YkfSWSp~gvL~a~~~~A~~l~dG~~v~Vp~~~~l~~~~~~idf~pg~~lE~ypNRDSl~Y~~~YgI~  802 (1201)
                      .|.|+.++||++|+|+|||++++.++.+++++++||++++++++ +.++...+++|+||+.+|+||||||+.|.+.|+|+
T Consensus       178 ~p~~~~~~~~l~y~fsws~~g~i~~~~~~a~~~~~G~~~~v~~~-~~~~~~~~~~~~~g~~~e~~~~~~~~~~~e~y~i~  256 (467)
T 2axq_A          178 LPAPEDSDNPLGYKFSWSSRGVLLALRNSAKYWKDGKIETVSSE-DLMATAKPYFIYPGYAFVCYPNRDSTLFKDLYHIP  256 (467)
T ss_dssp             EECGGGCCSTTSCCBSSCCHHHHHGGGSCEEEEETTEEEEECTT-THHHHCEECCSSTTCCEEEEECSBCTHHHHHTTCT
T ss_pred             cCCcccccccccCcCCCCHHHHHHHhcCCeEEEECCEEEEecCh-hhhccccccccCCCccEEEecCCCcchhhhhhCCC
Confidence            99888899999999999999999999999999999999999997 55566677888899999999999999999999998


Q ss_pred             cccccccccceeccCHHHHHHHHHHcCCCCCCccccCCCCCCccCHHHHHHHHcCCCCCchhHHHHHHHHHhhhcCcchh
Q psy12817        803 AEAHTVVRGTLRYRGFVDAMQAIQKLGLLDLKEHPALHPSGPEICWRELVCTLLGLSTSDIFYENLKNIVADKVGNTGLE  882 (1201)
Q Consensus       803 ~~~~Tl~rgTLRy~Gf~e~~~~L~~LGLl~~ep~~~l~~~~~~it~r~~l~~lL~~~~~~~~~~~~~~~~~~~~~~~~~~  882 (1201)
                       +++|+.||||||+||+++|++|++|||++++|++++   +.+++|++|++++||.+.+  ++++|...+..+++++   
T Consensus       257 -~~~~~~r~tlR~~g~~~~~~~L~~lGl~~~~~~~~~---~~~i~~~~~~~~~l~~~~~--~~~~l~~~~~~~~~~~---  327 (467)
T 2axq_A          257 -EAETVIRGTLRYQGFPEFVKALVDMGMLKDDANEIF---SKPIAWNEALKQYLGAKST--SKEDLIASIDSKATWK---  327 (467)
T ss_dssp             -TCSEEEEEEEEETTHHHHHHHHHHTTTTCCSBCGGG---SSCCBHHHHHHHHHTCSSS--SHHHHHHHHHTTCCCS---
T ss_pred             -CcceeEEEEEEeCCHHHHHHHHHHcCCCCCCccccc---CCCcCHHHHHHHhcCCCcc--cHHHHHHHHHhhhcCC---
Confidence             999999999999999999999999999999999864   3579999999999997553  5677777666555421   


Q ss_pred             HHHhhccccchhhhcccCCCcchhhhHHHhhhhhhhhcccccccccCcceeecccccccccchhhhccchhhhhhcCCCC
Q psy12817        883 ALEALGLLNDDIIVQKQNTPIDTLSHFLRQKLNIRLVDYEKLVDDEGNRVVAFGKYAGVAGMVNILHGLGLRLLALGHHT  962 (1201)
Q Consensus       883 ~l~~~~~~~~~~~~~~~~~~~d~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  962 (1201)
                                                                                                      
T Consensus       328 --------------------------------------------------------------------------------  327 (467)
T 2axq_A          328 --------------------------------------------------------------------------------  327 (467)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             CccccCCCcccchhhhHHHHhhhcccccccCCCCCCCCCceeeecCCCccccchhhhhhcCchhHHHHhhccCCCchhhh
Q psy12817        963 PFMHIGPAHNYRNSMMARQAIRDAGYEISLGNMPKSIGPLTIVFTGSGNVSQGAQEIFQELPYEELVCTLLGLSTSDIFY 1042 (1201)
Q Consensus       963 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~ 1042 (1201)
                                                                                                      
T Consensus       328 --------------------------------------------------------------------------------  327 (467)
T 2axq_A          328 --------------------------------------------------------------------------------  327 (467)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhhhhhcccchhhHHHHHHHhCCCCCccccCCCCCHHHHHHHHHHhhcCCCCCCccEEEEEeeEEEEeCCCceEEEEEe
Q psy12817       1043 ENLKNIVADKVGNTGLEALEALGLLNDDIIVQKQNTPIDTLSHFLRQKLVLDDGDRDVIVLRHDIDILWPNRSRERKSIS 1122 (1201)
Q Consensus      1043 ~~l~~~~~~~~~~~~~~~~~~lg~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~d~~~~~h~~~~~~~~~~~~~~~~~ 1122 (1201)
                             ++.+..+++++|+|||||+++ ++++++||+|+||++|++||+|+++|||||||||+|+|+|+||++++++++
T Consensus       328 -------~~~~~~~~~~~l~~~G~~~~~-~~~~~~~~~d~l~~~l~~~l~~~~~e~D~v~l~~~~~~~~~~g~~~~~~~~  399 (467)
T 2axq_A          328 -------DDEDRERILSGFAWLGLFSDA-KITPRGNALDTLCARLEELMQYEDNERDMVVLQHKFGIEWADGTTETRTST  399 (467)
T ss_dssp             -------CHHHHHHHHHHHHHTTTTSSC-BCCCCSBHHHHHHHHHHHHSBCCTTCCEEEEEEEEEEEECTTSCEEEEEEE
T ss_pred             -------chhHHHHHHHHHHhcCCCCCC-ccCCCCCHHHHHHHHHHHhhccCCCCCceEEEEEEEEEEecCCcEEEEEEE
Confidence                   011134679999999999987 666789999999999999999999999999999999999999999999999


Q ss_pred             EEEEcCCCCcchhhhccchhHHHHHHHHHcCccceeecc
Q psy12817       1123 LVVYGQPNGTTAMAKTVGLPAAIAAKMILEGEFFVTTST 1161 (1201)
Q Consensus      1123 l~~~g~~~~~~ama~tvg~p~ai~~~~~l~~~~~~~~~~ 1161 (1201)
                      |++||+++|+||||+|||+|+||||+|||+|+|+.+|++
T Consensus       400 ~~~y~~~~g~sama~tvG~p~ai~a~~i~~g~i~~~Gv~  438 (467)
T 2axq_A          400 LVDYGKVGGYSSMAATVGYPVAIATKFVLDGTIKGPGLL  438 (467)
T ss_dssp             EEEECCTTSCCHHHHHHHHHHHHHHHHHHTTSSCCSEEE
T ss_pred             EEEecCCCCceEEehhhchhHHHHHHHHhCCccCCCccc
Confidence            999999999999999999999999999999999999998
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>3a06_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; MEP pathway, isoprene biosynthesis, metal- NADP, oxidoreductase; HET: NDP; 2.00A {Thermotoga maritima} PDB: 3a14_A* Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1201
d1e5qa2267 d.81.1.2 (A:125-391) Saccharopine reductase {Rice 5e-64
d1e5qa2267 d.81.1.2 (A:125-391) Saccharopine reductase {Rice 2e-22
d1e5qa1182 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase 1e-16
d1e5qa1182 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase 2e-04
d1pjca2193 c.23.12.2 (A:1-135,A:304-361) L-alanine dehydrogen 4e-11
>d1e5qa2 d.81.1.2 (A:125-391) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 267 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FwdE/GAPDH domain-like
superfamily: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain
family: Homoserine dehydrogenase-like
domain: Saccharopine reductase
species: Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]

 Score =  216 bits (551), Expect = 5e-64
 Identities = 92/231 (39%), Positives = 135/231 (58%), Gaps = 11/231 (4%)

Query: 690 LDPGIDHLLAMECIDAAHLNGGKVESFVSYCGGLPAPECSENPLRYKFSWSPRGVLLNTL 749
           LDPGIDHL A++ I+  H  GGK+++F+SYCGGLPAPE S+NPL YKFSWS RGVLL   
Sbjct: 1   LDPGIDHLYAIKTIEEVHAAGGKIKTFLSYCGGLPAPESSDNPLGYKFSWSSRGVLLALR 60

Query: 750 SSAKYLQNSQVVDIPAGGELMRTARPLDFLPGFSFEGFANRDSLRYAQLYNIAAEAHTVV 809
           ++A + ++ +V ++  G ELM TA+P    PGF+F  + NRDS  Y + Y I  EA  +V
Sbjct: 61  NAASFYKDGKVTNVA-GPELMATAKPYFIYPGFAFVAYPNRDSTPYKERYQI-PEADNIV 118

Query: 810 RGTLRYRGFVDAMQAIQKLGLLDLKEHPALHPSGPEICWRELVCTLLGLSTSD---IFYE 866
           RGTLRY+GF   ++ +  +G L  +E P L  + P   W+E    ++  S++    I   
Sbjct: 119 RGTLRYQGFPQFIKVLVDIGFLSDEEQPFLKEAIP---WKEATQKIVKASSASEQDIVST 175

Query: 867 NLKNIVADKVGNTG--LEALEALGLLNDDIIVQKQNTPIDTLSHFLRQKLN 915
            + N   +        +  L+ LG+ +D  I   +   +DTL   L +K+ 
Sbjct: 176 IVSNATFESTEEQKRIVAGLKWLGIFSDKKIT-PRGNALDTLCATLEEKMQ 225
>d1e5qa2 d.81.1.2 (A:125-391) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 267 Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 182 Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 182 Back     information, alignment and structure
>d1pjca2 c.23.12.2 (A:1-135,A:304-361) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Length = 193 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1201
d1e5qa2267 Saccharopine reductase {Rice blast fungus (Magnapo 100.0
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 100.0
d1l7da2194 Nicotinamide nucleotide transhydrogenase dI compon 99.97
d1pjca2193 L-alanine dehydrogenase {Phormidium lapideum [TaxI 99.96
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 99.96
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 99.53
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 99.27
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 99.05
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 98.99
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 98.96
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 98.92
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 98.9
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 98.86
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 98.82
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 98.73
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 98.73
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 98.7
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 98.69
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 98.57
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 98.49
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 98.46
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 98.44
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 98.42
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 98.36
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 98.25
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 98.21
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 98.06
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 98.04
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 97.99
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 97.97
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 97.96
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 97.93
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 97.92
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 97.82
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 97.75
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 97.72
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 97.64
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.63
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 97.61
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 97.6
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 97.6
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.58
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 97.57
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 97.55
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 97.55
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 97.54
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 97.5
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 97.44
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 97.44
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 97.44
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 97.4
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 97.36
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 97.35
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 97.33
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 97.33
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.27
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 97.26
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 97.26
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 97.22
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 97.18
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 97.15
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 97.15
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 97.14
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 97.13
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 97.1
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 97.07
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 97.05
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 97.03
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 97.03
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 97.02
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 97.01
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 97.01
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 97.0
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 97.0
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 97.0
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 96.99
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 96.98
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 96.97
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 96.95
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 96.93
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 96.93
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 96.91
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 96.9
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.9
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 96.88
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.87
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 96.86
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 96.86
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 96.85
d1id1a_153 Rck domain from putative potassium channel Kch {Es 96.84
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 96.83
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 96.83
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 96.83
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 96.79
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 96.79
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 96.78
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 96.78
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 96.76
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 96.75
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 96.74
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 96.74
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 96.73
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 96.72
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 96.69
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 96.67
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 96.67
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 96.66
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 96.66
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 96.65
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 96.64
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 96.64
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 96.64
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 96.63
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 96.63
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 96.62
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 96.62
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 96.6
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 96.58
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 96.53
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 96.52
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 96.44
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 96.43
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 96.42
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.39
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 96.39
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 96.39
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 96.39
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 96.32
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 96.31
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 96.29
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 96.29
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 96.24
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 96.22
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 96.18
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 96.18
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 96.15
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 96.13
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 96.11
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 96.08
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 96.07
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 96.05
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.02
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 96.01
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 96.0
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 95.99
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 95.98
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 95.98
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 95.98
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 95.98
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 95.97
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 95.96
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 95.95
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 95.95
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 95.94
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 95.93
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 95.92
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 95.91
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 95.89
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 95.88
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 95.87
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 95.85
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 95.78
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 95.77
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 95.74
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 95.74
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 95.73
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 95.72
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 95.7
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 95.69
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 95.69
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 95.66
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 95.65
d1e5qa2267 Saccharopine reductase {Rice blast fungus (Magnapo 95.61
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 95.57
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 95.5
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 95.49
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 95.49
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 95.47
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 95.46
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 95.45
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 95.41
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 95.39
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 95.37
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 95.31
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 95.29
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 95.21
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 95.2
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 95.19
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 95.1
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 95.1
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 95.09
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 95.07
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 95.06
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 95.06
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 94.93
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 94.89
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 94.88
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 94.83
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 94.81
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 94.81
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 94.76
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 94.76
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 94.62
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 94.61
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 94.53
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 94.43
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 94.39
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 94.25
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 94.22
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 94.2
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 94.15
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 94.14
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 94.07
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 94.07
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 94.06
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 93.89
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 93.75
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.75
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 93.66
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 93.51
d1u8fo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.44
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 93.42
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 93.41
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 93.36
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 93.33
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.22
d2b4ro1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.21
d3cmco1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.21
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 93.18
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 92.78
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 92.66
d1yova1529 Amyloid beta precursor protein-binding protein 1, 92.53
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 92.43
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 92.43
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 92.09
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 91.92
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 91.91
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 91.84
d1gr0a1243 Myo-inositol 1-phosphate synthase {Mycobacterium t 91.79
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 91.72
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 91.71
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 91.63
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 91.58
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 91.53
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 91.48
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 91.39
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 91.14
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 91.11
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 91.09
d1hdgo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 90.93
d1rm4a1172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 90.93
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 90.92
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 90.88
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 90.72
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 90.69
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 90.68
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 90.64
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 90.49
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 90.33
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 90.32
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 90.14
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 90.02
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 89.88
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 89.84
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 89.73
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 89.44
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 89.32
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 89.29
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 89.16
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 89.11
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 88.95
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 88.89
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 88.84
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 88.74
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 88.71
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 88.34
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 87.79
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 87.6
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 87.49
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 87.19
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 87.14
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 86.86
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 86.85
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 86.8
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 86.79
d1oi7a1121 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 86.76
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 86.6
d1gsoa2105 Glycinamide ribonucleotide synthetase (GAR-syn), N 86.52
d2nu7a1119 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 86.48
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 86.36
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 86.25
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 85.97
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 85.56
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 85.47
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 85.39
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 85.31
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 85.13
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 85.08
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 84.96
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 84.9
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 84.57
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 84.54
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 84.35
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 84.31
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 84.2
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 84.07
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 83.79
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 83.47
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 83.37
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 83.26
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 82.97
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 82.93
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 82.77
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 82.75
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 82.51
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 82.34
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 81.98
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 81.97
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 81.59
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 81.59
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 81.31
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 81.29
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 81.17
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 80.66
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 80.52
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 80.4
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 80.32
>d1e5qa2 d.81.1.2 (A:125-391) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FwdE/GAPDH domain-like
superfamily: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain
family: Homoserine dehydrogenase-like
domain: Saccharopine reductase
species: Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]

Probab=100.00  E-value=3.9e-65  Score=558.78  Aligned_cols=265  Identities=39%  Similarity=0.744  Sum_probs=235.2

Q ss_pred             cCchhHHHHHHHHHHHhhhcCCcEEEEEeecCCCCCCCCCCCccccccccChHHHHHHhccceeeeeCCeEEEecCCccc
Q psy12817        690 LDPGIDHLLAMECIDAAHLNGGKVESFVSYCGGLPAPECSENPLRYKFSWSPRGVLLNTLSSAKYLQNSQVVDIPAGGEL  769 (1201)
Q Consensus       690 lDPGIdhmlA~~~idei~~~ggkV~sf~s~cGGLPaPe~~~nPL~YkfSWSp~gvL~a~~~~A~~l~dG~~v~Vp~~~~l  769 (1201)
                      ||||||||+||++|+++++.||+|++|.|||||||+|++++|||+|||||||++||++++++|+|++||+.++|++. ++
T Consensus         1 LdPGidhm~A~~~i~~~~~~~g~i~~f~s~cGGLp~p~~~~np~~YkfsWsp~gvi~~~~~~A~~~~~G~~~~v~~~-~~   79 (267)
T d1e5qa2           1 LDPGIDHLYAIKTIEEVHAAGGKIKTFLSYCGGLPAPESSDNPLGYKFSWSSRGVLLALRNAASFYKDGKVTNVAGP-EL   79 (267)
T ss_dssp             BTTBHHHHHHHHHHHHHHHTTCEEEEEEEEEEEEECGGGCCSTTSCCBSSCHHHHHHHTTCCEEEEETTEEEEECGG-GS
T ss_pred             CCCcHHHHHHHHHHHHHHhcCCcEEEEEEEecCccCCCCCCCCccceEEeccchhHHHhcCcceeeeCCeEEEECCH-Hh
Confidence            79999999999999999999999999999999999999999999999999999999999999999999999999986 77


Q ss_pred             cccccccccCCCceEEEeeCCCccchhhhcccccccccccccceeccCHHHHHHHHHHcCCCCCCccccCCCCCCccCHH
Q psy12817        770 MRTARPLDFLPGFSFEGFANRDSLRYAQLYNIAAEAHTVVRGTLRYRGFVDAMQAIQKLGLLDLKEHPALHPSGPEICWR  849 (1201)
Q Consensus       770 ~~~~~~idf~pg~~lE~ypNRDSl~Y~~~YgI~~~~~Tl~rgTLRy~Gf~e~~~~L~~LGLl~~ep~~~l~~~~~~it~r  849 (1201)
                      ++..+++++++++.||+||||||++|.+.|+++ +|+||+||||||||||+.|+.|++|||+++++.+.+.   ..+||+
T Consensus        80 ~~~~~~~~~~~~~~~E~~pnrdsl~y~~~y~~~-~i~t~~rgTLRy~G~~~~~~~l~~lGl~~~~~~~~l~---~~~t~~  155 (267)
T d1e5qa2          80 MATAKPYFIYPGFAFVAYPNRDSTPYKERYQIP-EADNIVRGTLRYQGFPQFIKVLVDIGFLSDEEQPFLK---EAIPWK  155 (267)
T ss_dssp             GGGCEECCSSTTBCEEEEECSBCTTHHHHTTCT-TCSEEEEEEEEETTHHHHHHHHHHTTTTCCCCCGGGG---SCCBHH
T ss_pred             hhhceeeeccCCcceEEEecCCCcchhhhhcCc-chhhhhhhhhcccchHHHHHHHHHHHhccCCcccccc---CCCCHH
Confidence            888889998889999999999999999999998 9999999999999999999999999999999988653   578999


Q ss_pred             HHHHHHcCCCCCchhHHHHHHHHHhhhcCcchhHHHhhccccchhhhcccCCCcchhhhHHHhhhhhhhhcccccccccC
Q psy12817        850 ELVCTLLGLSTSDIFYENLKNIVADKVGNTGLEALEALGLLNDDIIVQKQNTPIDTLSHFLRQKLNIRLVDYEKLVDDEG  929 (1201)
Q Consensus       850 ~~l~~lL~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~d~l~~~l~~~~~~~~~~~~~~~~~~~  929 (1201)
                      ++++.+++.+..+  ++++...+.....                                                    
T Consensus       156 ~~~~~~l~~~~~~--~~~~~~~~~~~~~----------------------------------------------------  181 (267)
T d1e5qa2         156 EATQKIVKASSAS--EQDIVSTIVSNAT----------------------------------------------------  181 (267)
T ss_dssp             HHHHHHHTCSSSS--HHHHHHHHHHHSC----------------------------------------------------
T ss_pred             HHHHHHhCcCCcc--hhHHHHHHHhhcc----------------------------------------------------
Confidence            9999999974422  2222211111000                                                    


Q ss_pred             cceeecccccccccchhhhccchhhhhhcCCCCCccccCCCcccchhhhHHHHhhhcccccccCCCCCCCCCceeeecCC
Q psy12817        930 NRVVAFGKYAGVAGMVNILHGLGLRLLALGHHTPFMHIGPAHNYRNSMMARQAIRDAGYEISLGNMPKSIGPLTIVFTGS 1009 (1201)
Q Consensus       930 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1009 (1201)
                                                     .                                                
T Consensus       182 -------------------------------~------------------------------------------------  182 (267)
T d1e5qa2         182 -------------------------------F------------------------------------------------  182 (267)
T ss_dssp             -------------------------------C------------------------------------------------
T ss_pred             -------------------------------c------------------------------------------------
Confidence                                           0                                                


Q ss_pred             CccccchhhhhhcCchhHHHHhhccCCCchhhhhhhhhhhcccchhhHHHHHHHhCCCCCccccCCCCCHHHHHHHHHHh
Q psy12817       1010 GNVSQGAQEIFQELPYEELVCTLLGLSTSDIFYENLKNIVADKVGNTGLEALEALGLLNDDIIVQKQNTPIDTLSHFLRQ 1089 (1201)
Q Consensus      1010 g~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~lg~~~~~~~~~~~~~~~~~~~~~l~~ 1089 (1201)
                                                             .+....+.++++|+|||||+++ ++++++||+|+||++|++
T Consensus       183 ---------------------------------------~~~~~~~~i~~~L~wLGlf~~~-~v~~~~tp~d~L~~~Le~  222 (267)
T d1e5qa2         183 ---------------------------------------ESTEEQKRIVAGLKWLGIFSDK-KITPRGNALDTLCATLEE  222 (267)
T ss_dssp             ---------------------------------------SSHHHHHHHHHHHHHHTTTSSS-BCCCCSSHHHHHHHHHHH
T ss_pred             ---------------------------------------cccchHHHHHHHHHHhcCCCCC-ccCCCCCHHHHHHHHHHH
Confidence                                                   0001146789999999999988 567889999999999999


Q ss_pred             hcCCCCCCccEEEEEeeEEEEeCCCceEEEEEeEEEEcCCCCc
Q psy12817       1090 KLVLDDGDRDVIVLRHDIDILWPNRSRERKSISLVVYGQPNGT 1132 (1201)
Q Consensus      1090 ~~~~~~~~~d~~~~~h~~~~~~~~~~~~~~~~~l~~~g~~~~~ 1132 (1201)
                      ||+|+++|||||||||+|+|+|+||++|+++||||+||+|+|.
T Consensus       223 Kl~~~~~ErDMIvM~H~f~~~~~dG~~e~~tstlv~~G~p~G~  265 (267)
T d1e5qa2         223 KMQFEEGERDLVMLQHKFEIENKDGSRETRTSSLCEYGAPIGS  265 (267)
T ss_dssp             HSBCCTTCCEEEEEEEEEEEECTTSCEEEEEEEEEEECCCTTS
T ss_pred             HhCCCCCCceEEEEEEEEEEEcCCCCeEEEEEeEEEEcCCCCC
Confidence            9999999999999999999999999999999999999999984
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1l7da2 c.23.12.2 (A:1-143,A:327-377) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1pjca2 c.23.12.2 (A:1-135,A:304-361) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1e5qa2 d.81.1.2 (A:125-391) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1gr0a1 c.2.1.3 (A:14-200,A:312-367) Myo-inositol 1-phosphate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1oi7a1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2nu7a1 c.2.1.8 (A:2-120) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure