Psyllid ID: psy12864


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------
MTWVLADYTAANTTELSVHKGQQVEVVHNSSAPPDWALGSGIEMTWVLADYTATNTTELSVHKGQQVEVVHNSSAPPDWALVRLSLGEECSEGLVPTCVLKQPPPSVLRTATSPSKRITLPIEQDLGRPGLDKSFYGDRQTTPKRIQ
cEEEEEccccccccccccccccccccccccccccccccccccEEEEEEEEcccccccEEEEEcccEEEEEEcccccccEEEEEEcccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccc
cEEEEEEcccccccccccccccEccccccccccccccccccEEEEEEEEEEEcccccEEEEEcccEEEEEEcccccccEEEEEEccccccccccccHHHcccccccccccccccccccccccHcccccccccccccccccccccccc
MTWVLADYTaanttelsvhkgQQVEvvhnssappdwalgsgiEMTWVLADYtatnttelsvhkgQQVEvvhnssappdWALVRLSLgeecseglvptcvlkqpppsvlrtatspskritlpieqdlgrpgldksfygdrqttpkriq
MTWVLADYTaanttelsvhkGQQVEVVHNSSAPPDWALGSGIEMTWVLADYTATNTTELSVHKGQQVEVVHNSSAPPDWALVRLSLGEECSEGLVptcvlkqpppsvlrtatspskritlpieqdlgrpgldksfygdrqttpkriq
MTWVLADYTAANTTELSVHKGQQVEVVHNSSAPPDWALGSGIEMTWVLADYTATNTTELSVHKGQQVEVVHNSSAPPDWALVRLSLGEECSEGLVPTCVLKQPPPSVLRTATSPSKRITLPIEQDLGRPGLDKSFYGDRQTTPKRIQ
**WVLADYTAANTTELSVHKGQQVEVVHNSSAPPDWALGSGIEMTWVLADYTATNTTELSVHKGQQVEVVHNSSAPPDWALVRLSLGEECSEGLVPTCVL***********************************************
*******************************************MTWVLADYTATNTTELSVHKGQQVEVVHNSSAPPDWALVRLSLGEECSEGLVPTCV************************************************
MTWVLADYTAANTTELSVHKGQQVEVVHNSSAPPDWALGSGIEMTWVLADYTATNTTELSVHKGQQVEVVHNSSAPPDWALVRLSLGEECSEGLVPTCVLKQPPPSVLRTATSPSKRITLPIEQDLGRPGLDKSFYGD*********
*TW****Y*****************************LGSGIEMTWVLADYTATNTTELSVHKGQQVEVVHNSSAPPDWALVRLSLGEECSEGLVP***************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTWVLADYTAANTTELSVHKGQQVEVVHNSSAPPDWALGSGIEMTWVLADYTATNTTELSVHKGQQVEVVHNSSAPPDWALVRLSLGEECSEGLVPTCVLKQPPPSVLRTATSPSKRITLPIEQDLGRPGLDKSFYGDRQTTPKRIQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query147 2.2.26 [Sep-21-2011]
O75962 3097 Triple functional domain yes N/A 0.401 0.019 0.457 2e-08
Q0KL02 3102 Triple functional domain yes N/A 0.401 0.019 0.457 2e-08
Q1LUA6 3028 Triple functional domain no N/A 0.428 0.020 0.428 7e-08
P97924 2959 Kalirin OS=Rattus norvegi no N/A 0.428 0.021 0.428 9e-07
A2CG49 2964 Kalirin OS=Mus musculus G no N/A 0.428 0.021 0.428 1e-06
O60229 2985 Kalirin OS=Homo sapiens G no N/A 0.428 0.021 0.412 5e-06
>sp|O75962|TRIO_HUMAN Triple functional domain protein OS=Homo sapiens GN=TRIO PE=1 SV=2 Back     alignment and function desciption
 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 37/59 (62%)

Query: 38   LGSGIEMTWVLADYTATNTTELSVHKGQQVEVVHNSSAPPDWALVRLSLGEECSEGLVP 96
            L  G E+T V+ D+TA N+ EL++ +GQ VEV+      PDW LVR +     +EGLVP
Sbjct: 1654 LSGGCELTVVIHDFTACNSNELTIRRGQTVEVLERPHDKPDWCLVRTTDRSPAAEGLVP 1712




Promotes the exchange of GDP by GTP. Together with leukocyte antigen-related (LAR) protein, it could play a role in coordinating cell-matrix and cytoskeletal rearrangements necessary for cell migration and cell growth.
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q0KL02|TRIO_MOUSE Triple functional domain protein OS=Mus musculus GN=Trio PE=1 SV=3 Back     alignment and function description
>sp|Q1LUA6|TRIO_DANRE Triple functional domain protein OS=Danio rerio GN=trio PE=3 SV=1 Back     alignment and function description
>sp|P97924|KALRN_RAT Kalirin OS=Rattus norvegicus GN=Kalrn PE=1 SV=3 Back     alignment and function description
>sp|A2CG49|KALRN_MOUSE Kalirin OS=Mus musculus GN=Kalrn PE=1 SV=1 Back     alignment and function description
>sp|O60229|KALRN_HUMAN Kalirin OS=Homo sapiens GN=KALRN PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query147
189235151 1387 PREDICTED: similar to AGAP006107-PB [Tri 0.605 0.064 0.489 3e-12
270003787 2475 hypothetical protein TcasGA2_TC003063 [T 0.537 0.031 0.488 3e-11
242007895 2251 Huntingtin-associated protein-interactin 0.557 0.036 0.466 2e-10
158295353 2302 AGAP006107-PA [Anopheles gambiae str. PE 0.489 0.031 0.56 3e-10
328725240167 PREDICTED: hypothetical protein LOC10057 0.503 0.443 0.473 4e-10
158295355 744 AGAP006107-PB [Anopheles gambiae str. PE 0.462 0.091 0.577 4e-10
328706380 2247 PREDICTED: triple functional domain prot 0.435 0.028 0.5 6e-10
328706376 2254 PREDICTED: triple functional domain prot 0.435 0.028 0.5 6e-10
328706378 2220 PREDICTED: triple functional domain prot 0.435 0.028 0.5 6e-10
328706374 2227 PREDICTED: triple functional domain prot 0.435 0.028 0.5 7e-10
>gi|189235151|ref|XP_968430.2| PREDICTED: similar to AGAP006107-PB [Tribolium castaneum] Back     alignment and taxonomy information
 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 57/98 (58%), Gaps = 9/98 (9%)

Query: 33  PPDWALGSGIEMTWVLADYTATNTTELSVHKGQQVEVVHNSSAPPDWALVRL-----SLG 87
           P   AL   +EMTWV++D+TAT   ELSV KGQQVEVV   S+ PD+ LVR+        
Sbjct: 60  PSQSALAGVLEMTWVVSDFTATCPQELSVTKGQQVEVVEVCSSKPDYCLVRMPTRGTDHD 119

Query: 88  EECSEGLVPTCVLKQPPPSVLRTATSPSKRITLPIEQD 125
               EGLVP  VLKQPP       +SPS+R  L  E D
Sbjct: 120 SSVPEGLVPLAVLKQPPAP----RSSPSRRAPLDHELD 153




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270003787|gb|EFA00235.1| hypothetical protein TcasGA2_TC003063 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242007895|ref|XP_002424753.1| Huntingtin-associated protein-interacting protein, putative [Pediculus humanus corporis] gi|212508256|gb|EEB12015.1| Huntingtin-associated protein-interacting protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|158295353|ref|XP_316167.4| AGAP006107-PA [Anopheles gambiae str. PEST] gi|157015996|gb|EAA11276.4| AGAP006107-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|328725240|ref|XP_003248395.1| PREDICTED: hypothetical protein LOC100573786 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|158295355|ref|XP_001688787.1| AGAP006107-PB [Anopheles gambiae str. PEST] gi|157015997|gb|EDO63793.1| AGAP006107-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|328706380|ref|XP_003243075.1| PREDICTED: triple functional domain protein-like isoform 4 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328706376|ref|XP_003243073.1| PREDICTED: triple functional domain protein-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328706378|ref|XP_003243074.1| PREDICTED: triple functional domain protein-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328706374|ref|XP_003243072.1| PREDICTED: triple functional domain protein-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query147
FB|FBgn0024277 2263 trio "trio" [Drosophila melano 0.482 0.031 0.532 1e-09
UNIPROTKB|F1PVV4 3053 TRIO "Uncharacterized protein" 0.401 0.019 0.474 1.8e-09
UNIPROTKB|I3L9H1528 LOC100737382 "Uncharacterized 0.666 0.185 0.336 2.5e-09
UNIPROTKB|F1MLS2 3067 TRIO "Uncharacterized protein" 0.401 0.019 0.474 5.7e-08
MGI|MGI:1927230 3102 Trio "triple functional domain 0.401 0.019 0.457 7.2e-08
RGD|1308360 3052 Trio "triple functional domain 0.401 0.019 0.457 8.8e-08
UNIPROTKB|D4A5M7 1548 D4A5M7 "Uncharacterized protei 0.401 0.038 0.457 9.2e-08
MGI|MGI:2685385 2964 Kalrn "kalirin, RhoGEF kinase" 0.428 0.021 0.428 1.4e-07
UNIPROTKB|E7EWP2 2309 TRIO "Triple functional domain 0.401 0.025 0.457 1.4e-07
UNIPROTKB|E7EPJ7 2500 TRIO "Triple functional domain 0.401 0.023 0.457 1.6e-07
FB|FBgn0024277 trio "trio" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 157 (60.3 bits), Expect = 1.0e-09, P = 1.0e-09
 Identities = 41/77 (53%), Positives = 50/77 (64%)

Query:    35 DWALGSGIEMTWVLADYTATN-TTELSVHKGQQVEVVHNSSA-PPDWALVRLSLGEE--- 89
             D  LG+  E TWV+ADY AT+ + ELSV KGQQVE+V   +A  PD+ LVRL+   +   
Sbjct:  1636 DNKLGNQ-EATWVVADYIATSGSNELSVSKGQQVEIVEPPTAGEPDFCLVRLNPQHDDAA 1694

Query:    90 CSEGLVPTCVLKQPPPS 106
               EGLVP  VLK PP S
Sbjct:  1695 VQEGLVPVSVLKPPPGS 1711




GO:0005089 "Rho guanyl-nucleotide exchange factor activity" evidence=ISS;IDA;NAS
GO:0007422 "peripheral nervous system development" evidence=IGI;IMP
GO:0007411 "axon guidance" evidence=IGI;IMP;TAS
GO:0007417 "central nervous system development" evidence=IGI;IMP
GO:0030036 "actin cytoskeleton organization" evidence=IEP;IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0007266 "Rho protein signal transduction" evidence=IDA
GO:0035023 "regulation of Rho protein signal transduction" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005543 "phospholipid binding" evidence=IEA
GO:0050770 "regulation of axonogenesis" evidence=IGI
GO:0016319 "mushroom body development" evidence=IMP
GO:0048675 "axon extension" evidence=IMP
GO:0045887 "positive regulation of synaptic growth at neuromuscular junction" evidence=IMP
GO:0071772 "response to BMP stimulus" evidence=IGI
GO:0007412 "axon target recognition" evidence=IGI
GO:0007480 "imaginal disc-derived leg morphogenesis" evidence=IMP
GO:0046331 "lateral inhibition" evidence=IMP
UNIPROTKB|F1PVV4 TRIO "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|I3L9H1 LOC100737382 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MLS2 TRIO "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1927230 Trio "triple functional domain (PTPRF interacting)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1308360 Trio "triple functional domain (PTPRF interacting)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4A5M7 D4A5M7 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2685385 Kalrn "kalirin, RhoGEF kinase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E7EWP2 TRIO "Triple functional domain protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E7EPJ7 TRIO "Triple functional domain protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query147
cd1185262 cd11852, SH3_Kalirin_1, First Src homology 3 domai 1e-18
cd1185262 cd11852, SH3_Kalirin_1, First Src homology 3 domai 1e-10
cd1176454 cd11764, SH3_Eps8, Src Homology 3 domain of Epider 6e-07
smart0032656 smart00326, SH3, Src homology 3 domains 9e-07
cd0017451 cd00174, SH3, Src Homology 3 domain superfamily 1e-06
pfam0001847 pfam00018, SH3_1, SH3 domain 6e-06
cd1185653 cd11856, SH3_p47phox_like, Src homology 3 domains 7e-06
cd0017451 cd00174, SH3, Src Homology 3 domain superfamily 7e-05
cd1191255 cd11912, SH3_Bzz1_1, First Src Homology 3 domain o 8e-05
cd1180252 cd11802, SH3_Endophilin_B, Src homology 3 domain o 2e-04
cd1176454 cd11764, SH3_Eps8, Src Homology 3 domain of Epider 3e-04
cd1185653 cd11856, SH3_p47phox_like, Src homology 3 domains 7e-04
cd1184552 cd11845, SH3_Src_like, Src homology 3 domain of Sr 7e-04
pfam0765353 pfam07653, SH3_2, Variant SH3 domain 7e-04
cd1180252 cd11802, SH3_Endophilin_B, Src homology 3 domain o 8e-04
smart0032656 smart00326, SH3, Src homology 3 domains 0.001
cd1176756 cd11767, SH3_Nck_3, Third Src Homology 3 domain of 0.002
cd1180057 cd11800, SH3_DNMBP_C2_like, Second C-terminal Src 0.003
>gnl|CDD|212786 cd11852, SH3_Kalirin_1, First Src homology 3 domain of the RhoGEF kinase, Kalirin Back     alignment and domain information
 Score = 74.0 bits (182), Expect = 1e-18
 Identities = 28/62 (45%), Positives = 39/62 (62%), Gaps = 2/62 (3%)

Query: 43  EMTWVLADYTATNTTELSVHKGQQVEVVHNSSAPPDWALVRLSLGEECS--EGLVPTCVL 100
           E+T V+ D+ AT++ EL+V KGQ VEV+   S+ PDW LVR    +     EGLVP+ +L
Sbjct: 1   ELTVVIEDFEATSSQELTVSKGQTVEVLERPSSRPDWCLVRTLEQDNSPPQEGLVPSSIL 60

Query: 101 KQ 102
             
Sbjct: 61  CI 62


Kalirin, also called Duo, Duet, or TRAD, is a large neuronal dual Rho guanine nucleotide exchange factor (RhoGEF) that activates Rac1, RhoA, and RhoG using two RhoGEF domains. Kalirin exists in many isoforms generated by alternative splicing and the use of multiple promoters; the major isoforms are kalirin-7, -9, and -12, which differ at their C-terminal ends. Kalirin-12, the longest isoform, contains an N-terminal Sec14p domain, spectrin-like repeats, two RhoGEF domains, two SH3 domains, as well as Ig, FNIII, and kinase domains at the C-terminal end. Kalirin-7 contains only a single RhoGEF domain and does not contain an SH3 domain. Kalirin, through its many isoforms, interacts with many different proteins and is able to localize to different locations within the cell. It influences neurite initiation, axon growth, dendritic morphogenesis, vesicle trafficking, neuronal maintenance, and neurodegeneration. SH3 domains are protein interaction domains that bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs. They play versatile and diverse roles in the cell including the regulation of enzymes, changing the subcellular localization of signaling pathway components, and mediating the formation of multiprotein complex assemblies. Length = 62

>gnl|CDD|212786 cd11852, SH3_Kalirin_1, First Src homology 3 domain of the RhoGEF kinase, Kalirin Back     alignment and domain information
>gnl|CDD|212698 cd11764, SH3_Eps8, Src Homology 3 domain of Epidermal growth factor receptor kinase substrate 8 and similar proteins Back     alignment and domain information
>gnl|CDD|214620 smart00326, SH3, Src homology 3 domains Back     alignment and domain information
>gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily Back     alignment and domain information
>gnl|CDD|215659 pfam00018, SH3_1, SH3 domain Back     alignment and domain information
>gnl|CDD|212790 cd11856, SH3_p47phox_like, Src homology 3 domains of the p47phox subunit of NADPH oxidase and similar domains Back     alignment and domain information
>gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily Back     alignment and domain information
>gnl|CDD|212845 cd11912, SH3_Bzz1_1, First Src Homology 3 domain of Bzz1 and similar domains Back     alignment and domain information
>gnl|CDD|212736 cd11802, SH3_Endophilin_B, Src homology 3 domain of Endophilin-B Back     alignment and domain information
>gnl|CDD|212698 cd11764, SH3_Eps8, Src Homology 3 domain of Epidermal growth factor receptor kinase substrate 8 and similar proteins Back     alignment and domain information
>gnl|CDD|212790 cd11856, SH3_p47phox_like, Src homology 3 domains of the p47phox subunit of NADPH oxidase and similar domains Back     alignment and domain information
>gnl|CDD|212779 cd11845, SH3_Src_like, Src homology 3 domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|219499 pfam07653, SH3_2, Variant SH3 domain Back     alignment and domain information
>gnl|CDD|212736 cd11802, SH3_Endophilin_B, Src homology 3 domain of Endophilin-B Back     alignment and domain information
>gnl|CDD|214620 smart00326, SH3, Src homology 3 domains Back     alignment and domain information
>gnl|CDD|212701 cd11767, SH3_Nck_3, Third Src Homology 3 domain of Nck adaptor proteins Back     alignment and domain information
>gnl|CDD|212734 cd11800, SH3_DNMBP_C2_like, Second C-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba, and similar domains Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 147
KOG4226|consensus379 99.87
PF1460449 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 99.53
PF0001848 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho 99.45
KOG1029|consensus1118 99.42
PF0765355 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 99.39
smart0032658 SH3 Src homology 3 domains. Src homology 3 (SH3) d 99.32
cd0017454 SH3 Src homology 3 domains; SH3 domains bind to pr 99.31
KOG3557|consensus 721 99.09
KOG4226|consensus 379 99.03
KOG4348|consensus 627 99.02
KOG2199|consensus 462 98.77
KOG0515|consensus752 98.76
KOG3875|consensus362 98.76
KOG1029|consensus 1118 98.74
KOG4278|consensus 1157 98.73
KOG0162|consensus1106 98.57
KOG4348|consensus 627 98.46
KOG2996|consensus865 98.36
KOG4792|consensus293 98.27
KOG2856|consensus472 98.26
KOG4225|consensus 489 98.18
KOG4225|consensus489 98.14
KOG0197|consensus 468 98.11
KOG1118|consensus366 98.06
KOG2070|consensus 661 97.98
KOG1843|consensus473 97.45
PF0001848 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho 97.37
PF0823955 SH3_3: Bacterial SH3 domain; InterPro: IPR013247 S 97.34
PF1460449 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 97.23
KOG3655|consensus484 97.22
KOG3601|consensus 222 97.2
KOG2546|consensus483 97.17
KOG3601|consensus222 96.95
PRK10884206 SH3 domain-containing protein; Provisional 96.89
PF0765355 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 96.81
KOG1264|consensus 1267 96.77
smart0028763 SH3b Bacterial SH3 domain homologues. 96.68
PF1460389 hSH3: Helically-extended SH3 domain; PDB: 1RI9_A. 96.58
KOG3771|consensus460 96.51
cd0017454 SH3 Src homology 3 domains; SH3 domains bind to pr 96.45
KOG2528|consensus 490 96.38
KOG1702|consensus264 96.31
KOG3523|consensus695 96.26
smart0032658 SH3 Src homology 3 domains. Src homology 3 (SH3) d 96.25
KOG3725|consensus375 96.24
KOG3632|consensus1335 96.17
PF0634755 SH3_4: Bacterial SH3 domain; InterPro: IPR010466 S 96.06
KOG4773|consensus 386 95.89
KOG4429|consensus421 93.89
COG3103205 SH3 domain protein [Signal transduction mechanisms 93.87
KOG4792|consensus293 93.77
KOG2199|consensus 462 93.11
KOG1451|consensus812 91.98
KOG3632|consensus1335 91.64
PRK13914 481 invasion associated secreted endopeptidase; Provis 90.79
KOG0609|consensus 542 90.71
KOG2996|consensus 865 90.31
KOG3565|consensus640 90.25
KOG2222|consensus 848 89.9
KOG0040|consensus 2399 88.67
KOG0199|consensus 1039 85.89
KOG3705|consensus580 85.67
KOG3775|consensus 482 85.6
KOG4575|consensus 874 84.89
KOG1843|consensus473 84.23
KOG2856|consensus472 84.22
>KOG4226|consensus Back     alignment and domain information
Probab=99.87  E-value=3.4e-22  Score=171.06  Aligned_cols=111  Identities=32%  Similarity=0.469  Sum_probs=92.2

Q ss_pred             eEEEeeeccccccccceeeceEEEEeecCCCCCCcccC----------Ccc-----------------------------
Q psy12864          2 TWVLADYTAANTTELSVHKGQQVEVVHNSSAPPDWALG----------SGI-----------------------------   42 (147)
Q Consensus         2 t~vvanfsa~~~~ELsl~kGq~VeVle~~~~~~~W~~~----------g~~-----------------------------   42 (147)
                      .+|..+|.|..++||+|.||..|.|+|++.  .+||.+          +++                             
T Consensus       110 AvVKf~Y~a~~eDELsLtKGtrv~vmEKss--DGWWrG~~ng~VGWFPSNYv~E~~ds~~gd~~s~~~~~~~A~a~n~~~  187 (379)
T KOG4226|consen  110 AVVKFNYVAEREDELSLTKGTRVTVMEKSS--DGWWRGSYNGQVGWFPSNYVTEEVDSAAGDSPSFLSLRKAASASNGQG  187 (379)
T ss_pred             eEEEEeeccccccccccccCcEEEEEEecc--CcceecccCCeeccccccceehhccccccCCccceecchhhcccCCCC
Confidence            478999999999999999999999999983  445422          110                             


Q ss_pred             ----eEEEEEeeeccCCCceeeeecCCEEEEEeCCCCCCCcEEEEecCCCCCeecccccceeecCCCCC-CccCCCCCcc
Q psy12864         43 ----EMTWVLADYTATNTTELSVHKGQQVEVVHNSSAPPDWALVRLSLGEECSEGLVPTCVLKQPPPSV-LRTATSPSKR  117 (147)
Q Consensus        43 ----e~~~Vi~dF~Ar~~~ELSv~kGq~VEIlE~~~~~p~WwLvR~~~~~~gqeGlVP~n~L~~~~~~~-~~~~~~p~~~  117 (147)
                          .+++++|.|++.+++||+|+|||++||||++++||+||.+|+.   .||.||||.||+......+ ..-+-+|+.+
T Consensus       188 s~vl~vVvaLYsFsssndeELsFeKGerleivd~Pe~DPdWwkarn~---~G~vGLVPrNYv~vl~d~~~ts~~~~~s~~  264 (379)
T KOG4226|consen  188 SRVLHVVVALYSFSSSNDEELSFEKGERLEIVDKPENDPDWWKARNA---RGQVGLVPRNYVVVLSDGPSTSKALHPSHA  264 (379)
T ss_pred             ceEEEEEEEEecccCCChhhcccccCceeEeccCCCCCchHHhhccc---CCccceeecceEEEeccCccccccCCcccc
Confidence                4789999999999999999999999999999999999999986   7999999999997753332 2245666654



>PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A Back     alignment and domain information
>PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>smart00326 SH3 Src homology 3 domains Back     alignment and domain information
>cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies Back     alignment and domain information
>KOG3557|consensus Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>KOG4348|consensus Back     alignment and domain information
>KOG2199|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG3875|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>KOG4348|consensus Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>KOG2856|consensus Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>KOG1118|consensus Back     alignment and domain information
>KOG2070|consensus Back     alignment and domain information
>KOG1843|consensus Back     alignment and domain information
>PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>PF08239 SH3_3: Bacterial SH3 domain; InterPro: IPR013247 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A Back     alignment and domain information
>KOG3655|consensus Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>KOG2546|consensus Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>smart00287 SH3b Bacterial SH3 domain homologues Back     alignment and domain information
>PF14603 hSH3: Helically-extended SH3 domain; PDB: 1RI9_A Back     alignment and domain information
>KOG3771|consensus Back     alignment and domain information
>cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies Back     alignment and domain information
>KOG2528|consensus Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>KOG3523|consensus Back     alignment and domain information
>smart00326 SH3 Src homology 3 domains Back     alignment and domain information
>KOG3725|consensus Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>PF06347 SH3_4: Bacterial SH3 domain; InterPro: IPR010466 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG4773|consensus Back     alignment and domain information
>KOG4429|consensus Back     alignment and domain information
>COG3103 SH3 domain protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>KOG2199|consensus Back     alignment and domain information
>KOG1451|consensus Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>PRK13914 invasion associated secreted endopeptidase; Provisional Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG3565|consensus Back     alignment and domain information
>KOG2222|consensus Back     alignment and domain information
>KOG0040|consensus Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>KOG3705|consensus Back     alignment and domain information
>KOG3775|consensus Back     alignment and domain information
>KOG4575|consensus Back     alignment and domain information
>KOG1843|consensus Back     alignment and domain information
>KOG2856|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query147
1u3o_A82 Solution Structure Of Rat Kalirin N-Terminal Sh3 Do 5e-08
4afz_C84 Human Chymase - Fynomer Complex Length = 84 8e-04
4afq_C85 Human Chymase - Fynomer Complex Length = 85 8e-04
>pdb|1U3O|A Chain A, Solution Structure Of Rat Kalirin N-Terminal Sh3 Domain Length = 82 Back     alignment and structure

Iteration: 1

Score = 53.1 bits (126), Expect = 5e-08, Method: Compositional matrix adjust. Identities = 28/67 (41%), Positives = 39/67 (58%) Query: 34 PDWALGSGIEMTWVLADYTATNTTELSVHKGQQVEVVHNSSAPPDWALVRLSLGEECSEG 93 P L G E+T VL D++A +++ELS+ GQ VE++ S P W LVR + EG Sbjct: 9 PGSTLSGGCELTVVLQDFSAAHSSELSIQVGQTVELLERPSERPGWCLVRTTERSPPQEG 68 Query: 94 LVPTCVL 100 LVP+ L Sbjct: 69 LVPSSTL 75
>pdb|4AFZ|C Chain C, Human Chymase - Fynomer Complex Length = 84 Back     alignment and structure
>pdb|4AFQ|C Chain C, Human Chymase - Fynomer Complex Length = 85 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query147
1u3o_A82 Huntingtin-associated protein-interacting protein; 1e-21
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 2e-08
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 1e-07
1awj_A77 ITK; transferase, regulatory intramolecular comple 2e-07
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 2e-07
1i07_A60 Epidermal growth factor receptor kinase substrate 3e-07
1i07_A60 Epidermal growth factor receptor kinase substrate 4e-04
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 4e-07
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 4e-07
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 5e-07
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 1e-04
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 5e-07
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 7e-07
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 7e-07
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 8e-07
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 9e-07
1wxb_A68 Epidermal growth factor receptor pathway substrate 9e-07
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 1e-06
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 8e-04
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 1e-06
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 2e-06
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 2e-04
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 2e-06
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 2e-06
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 2e-06
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 3e-06
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 7e-04
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 3e-06
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 4e-04
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 4e-06
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 5e-06
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 7e-06
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 7e-06
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 7e-06
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 6e-04
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 8e-06
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 8e-06
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 8e-06
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 9e-06
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 6e-04
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 1e-05
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 6e-04
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 2e-05
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 7e-04
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 2e-05
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 7e-04
1ug1_A92 KIAA1010 protein; structural genomics, SH3 domain, 4e-05
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 5e-05
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 6e-05
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 6e-05
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 8e-04
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 6e-05
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 9e-05
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 1e-04
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 1e-04
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 1e-04
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 1e-04
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 1e-04
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 1e-04
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 3e-04
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 2e-04
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 2e-04
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 2e-04
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 4e-04
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 2e-04
1gri_A 217 Growth factor bound protein 2; SH2, SH3, signal tr 2e-04
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 3e-04
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 3e-04
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 3e-04
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 5e-04
2dil_A69 Proline-serine-threonine phosphatase-interacting p 6e-04
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 6e-04
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 7e-04
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 7e-04
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 8e-04
>1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
 Score = 81.6 bits (201), Expect = 1e-21
 Identities = 29/77 (37%), Positives = 40/77 (51%)

Query: 30  SSAPPDWALGSGIEMTWVLADYTATNTTELSVHKGQQVEVVHNSSAPPDWALVRLSLGEE 89
           S   P   L  G E+T VL D++A +++ELS+  GQ VE++   S  P W LVR +    
Sbjct: 5   SPGIPGSTLSGGCELTVVLQDFSAAHSSELSIQVGQTVELLERPSERPGWCLVRTTERSP 64

Query: 90  CSEGLVPTCVLKQPPPS 106
             EGLVP+  L      
Sbjct: 65  PQEGLVPSSTLCISHSR 81


>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Length = 77 Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Length = 60 Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Length = 60 Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Length = 67 Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Length = 67 Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Length = 68 Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Length = 71 Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Length = 71 Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Length = 71 Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Length = 60 Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Length = 60 Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 58 Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Length = 67 Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Length = 63 Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Length = 63 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A 1qwf_A 1prl_C ... Length = 84 Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A 1qwf_A 1prl_C ... Length = 84 Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Length = 120 Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Length = 79 Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Length = 79 Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 79 Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 79 Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} PDB: 3h0i_A 3h0f_A* Length = 73 Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} PDB: 3h0i_A 3h0f_A* Length = 73 Back     alignment and structure
>1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 92 Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Length = 69 Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Length = 93 Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Length = 90 Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Length = 57 Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Length = 65 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 81 Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 81 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Length = 86 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Length = 58 Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Length = 108 Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Length = 65 Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Length = 62 Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Length = 62 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query147
1u3o_A82 Huntingtin-associated protein-interacting protein; 99.9
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 99.73
2lj0_A65 Sorbin and SH3 domain-containing protein 1; R85FL, 99.59
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 99.58
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 99.57
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 99.57
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 99.57
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 99.57
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 99.56
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 99.56
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 99.56
2da9_A70 SH3-domain kinase binding protein 1; structural ge 99.55
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 99.55
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 99.55
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 99.55
1i07_A60 Epidermal growth factor receptor kinase substrate 99.55
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 99.54
1v1c_A71 Obscurin; muscle, sarcomere, adapter, myogenesis, 99.54
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 99.54
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 99.54
1uti_A58 GRB2-related adaptor protein 2; signaling protein 99.54
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 99.54
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 99.54
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 99.54
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 99.54
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 99.54
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 99.53
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 99.53
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 99.53
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 99.53
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 99.53
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 99.53
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 99.53
2lx7_A60 GAS-7, growth arrest-specific protein 7; structura 99.53
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 99.52
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 99.52
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 99.52
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 99.52
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 99.52
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.52
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 99.52
2dil_A69 Proline-serine-threonine phosphatase-interacting p 99.52
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 99.52
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 99.51
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 99.51
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 99.51
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 99.51
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 99.51
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 99.51
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 99.51
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 99.51
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 99.51
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 99.51
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 99.51
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 99.51
1wxb_A68 Epidermal growth factor receptor pathway substrate 99.5
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 99.5
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 99.5
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 99.5
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 99.5
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 99.5
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 99.5
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 99.5
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 99.5
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 99.5
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 99.5
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 99.5
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 99.5
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 99.5
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 99.5
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 99.5
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 99.5
2j6f_A62 CD2-associated protein; metal-binding, immune resp 99.5
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 99.5
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 99.49
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 99.49
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 99.49
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 99.49
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 99.49
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} 99.49
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 99.49
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 99.49
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 99.49
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 99.48
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 99.48
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 99.48
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 99.48
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 99.48
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 99.48
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 99.48
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 99.48
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 99.47
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 99.47
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 99.47
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 99.47
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 99.47
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 99.47
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 99.47
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 99.47
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 99.47
2cuc_A70 SH3 domain containing ring finger 2; structural ge 99.47
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 99.46
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 99.46
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 99.46
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 99.46
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 99.46
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 99.46
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 99.46
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 99.46
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 99.46
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 99.46
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 99.46
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 99.45
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 99.45
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 99.45
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 99.45
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 99.45
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 99.45
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 99.45
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 99.45
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 99.45
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 99.45
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 99.45
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 99.17
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 99.45
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 99.45
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 99.44
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.44
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 99.44
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 99.44
4glm_A72 Dynamin-binding protein; SH3 domain, DNMBP, struct 99.44
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 99.44
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 99.43
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 99.43
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 99.43
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 99.43
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 99.43
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 99.43
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 99.43
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 99.43
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 99.43
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 99.43
3u23_A65 CD2-associated protein; structural genomics, struc 99.42
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 99.42
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 99.42
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 99.42
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 99.42
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 99.41
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 99.41
2m0y_A74 Dedicator of cytokinesis protein 1; apoptosis; NMR 99.41
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 99.41
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 99.4
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.4
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 99.4
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 99.39
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 99.39
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 99.39
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 99.38
2gtj_A96 FYN-binding protein; SH3, redox, signaling protein 99.38
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 99.38
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 99.38
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 99.38
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 99.37
1awj_A77 ITK; transferase, regulatory intramolecular comple 99.37
3i5r_A83 Phosphatidylinositol 3-kinase regulatory subunit a 99.37
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 99.36
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 99.36
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 99.35
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 99.34
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 99.34
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 99.33
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 99.33
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 99.3
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 99.29
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 99.29
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 99.28
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 99.28
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 99.24
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 99.23
1ri9_A102 FYN-binding protein; SH3-like, helically extended, 99.2
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 99.19
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 99.17
3jv3_A 283 Intersectin-1; SH3 domain, DH domain, guanine nucl 99.17
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.16
1gri_A 217 Growth factor bound protein 2; SH2, SH3, signal tr 99.14
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.13
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.1
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.1
3a98_A184 DOCK2, dedicator of cytokinesis protein 2; protein 99.1
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.09
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.09
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 99.08
2pz1_A 466 RHO guanine nucleotide exchange factor 4; helical 99.08
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 99.07
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 99.07
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 99.05
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 98.55
2de0_X526 Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran 98.91
1ug1_A92 KIAA1010 protein; structural genomics, SH3 domain, 98.87
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 98.84
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 98.84
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 98.83
1kjw_A 295 Postsynaptic density protein 95; protein-protein i 98.81
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 98.7
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 98.6
4dey_A 337 Voltage-dependent L-type calcium channel subunit; 98.43
1u3o_A82 Huntingtin-associated protein-interacting protein; 98.43
3kfv_A 308 Tight junction protein ZO-3; structural genomics c 98.42
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.34
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 98.22
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 98.21
3pvl_A655 Myosin VIIA isoform 1; protein complex, novel fold 98.14
3r6n_A450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 98.09
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 98.06
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 97.96
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 97.69
3tvt_A 292 Disks large 1 tumor suppressor protein; DLG, SRC-h 97.68
1wfw_A74 Kalirin-9A; SH3 domain, neuron-specific GDP/GTP ex 97.38
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 97.37
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 97.34
1v1c_A71 Obscurin; muscle, sarcomere, adapter, myogenesis, 97.33
2krs_A74 Probable enterotoxin; all beta, SH3, ENTD, CPF_058 97.31
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 97.21
2lj0_A65 Sorbin and SH3 domain-containing protein 1; R85FL, 97.21
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 97.2
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 97.2
2da9_A70 SH3-domain kinase binding protein 1; structural ge 97.19
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 97.17
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 97.14
1i07_A60 Epidermal growth factor receptor kinase substrate 97.14
2kt8_A76 Probable surface protein; SH3 family, structural g 97.13
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 97.11
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 97.11
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 97.11
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 97.11
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 97.09
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 97.09
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 97.08
1uti_A58 GRB2-related adaptor protein 2; signaling protein 97.08
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 97.08
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 97.07
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 97.06
2lx7_A60 GAS-7, growth arrest-specific protein 7; structura 97.05
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 97.04
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 97.04
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 97.03
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 97.03
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 97.03
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 97.02
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 97.01
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 97.01
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 97.01
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} 97.01
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 97.0
2j6f_A62 CD2-associated protein; metal-binding, immune resp 97.0
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 96.99
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 96.99
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 96.98
2dil_A69 Proline-serine-threonine phosphatase-interacting p 96.98
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 96.97
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 96.97
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 96.96
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 96.96
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 96.96
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 96.95
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 96.94
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 96.93
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 96.93
1wxb_A68 Epidermal growth factor receptor pathway substrate 96.93
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 96.93
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 96.93
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 96.92
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 96.91
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 96.91
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 96.91
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 96.91
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 96.9
2m0y_A74 Dedicator of cytokinesis protein 1; apoptosis; NMR 96.9
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 96.89
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 96.89
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 96.88
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 96.88
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 96.88
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 96.88
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 96.88
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 96.88
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 96.87
1ug1_A92 KIAA1010 protein; structural genomics, SH3 domain, 96.86
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 96.85
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 96.84
2kq8_A70 Cell WALL hydrolase; GFT protein structure, NESG, 96.84
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 96.83
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 96.83
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 96.82
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 96.81
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 96.81
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 96.81
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 96.81
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 96.81
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 96.8
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 96.79
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 96.79
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 96.79
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 96.79
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 96.78
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 96.77
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 96.77
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 96.76
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 96.75
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 96.75
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 96.75
2cuc_A70 SH3 domain containing ring finger 2; structural ge 96.75
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 96.74
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 96.74
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 96.73
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 96.73
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 96.73
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 96.73
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 96.73
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 96.73
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 96.71
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 96.71
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 96.69
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 96.69
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 96.69
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 96.68
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 96.68
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 96.68
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 96.68
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 96.67
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 96.66
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 96.65
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 96.65
4glm_A72 Dynamin-binding protein; SH3 domain, DNMBP, struct 96.65
1awj_A77 ITK; transferase, regulatory intramolecular comple 96.64
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 96.64
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 96.64
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 96.63
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 96.63
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 96.6
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 96.59
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 96.58
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 96.58
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 96.57
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 96.57
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 96.56
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 96.55
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 96.55
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 96.54
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 96.53
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 96.53
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 96.53
3u23_A65 CD2-associated protein; structural genomics, struc 96.52
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 96.52
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 96.52
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 96.5
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 96.49
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 96.48
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 96.47
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 96.46
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 96.45
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 96.44
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 96.41
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 96.41
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 96.39
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 96.37
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 96.36
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 96.35
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 96.34
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 96.34
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 96.3
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 96.24
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 96.19
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 96.19
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 96.19
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 96.18
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 96.18
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 96.17
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 96.16
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 96.16
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 96.14
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 96.14
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 96.1
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 95.99
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 95.96
3i5r_A83 Phosphatidylinositol 3-kinase regulatory subunit a 95.96
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 95.86
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 95.82
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 95.8
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 95.76
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 95.46
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 95.33
3jv3_A 283 Intersectin-1; SH3 domain, DH domain, guanine nucl 95.29
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 95.17
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 95.11
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 94.08
3npf_A 306 Putative dipeptidyl-peptidase VI; structural genom 93.97
3npf_A 306 Putative dipeptidyl-peptidase VI; structural genom 93.87
3a98_A184 DOCK2, dedicator of cytokinesis protein 2; protein 93.81
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 93.77
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 93.75
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 93.66
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 93.66
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 93.2
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 92.69
2pz1_A 466 RHO guanine nucleotide exchange factor 4; helical 92.55
2de0_X526 Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran 92.4
3cxl_A 463 N-chimerin; SH2, RHO-GAP, structural genomics cons 90.69
3h41_A 311 NLP/P60 family protein; NLPC/P60 family protein, s 90.28
2gtj_A96 FYN-binding protein; SH3, redox, signaling protein 89.87
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 88.74
1ri9_A102 FYN-binding protein; SH3-like, helically extended, 88.39
1kjw_A 295 Postsynaptic density protein 95; protein-protein i 84.71
>1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Back     alignment and structure
Probab=99.90  E-value=2e-24  Score=153.56  Aligned_cols=67  Identities=39%  Similarity=0.630  Sum_probs=61.9

Q ss_pred             CCcceEEEEEeeeccCCCceeeeecCCEEEEEeCCCCCCCcEEEEecCCCCCeecccccceeecCCC
Q psy12864         39 GSGIEMTWVLADYTATNTTELSVHKGQQVEVVHNSSAPPDWALVRLSLGEECSEGLVPTCVLKQPPP  105 (147)
Q Consensus        39 ~g~~e~~~Vi~dF~Ar~~~ELSv~kGq~VEIlE~~~~~p~WwLvR~~~~~~gqeGlVP~n~L~~~~~  105 (147)
                      .|++|+++|||||.|++++||||+|||+|||||++.++|+|||||+..+.++||||||+|||+..++
T Consensus        14 ~g~~e~~valydF~Ar~~~ELS~~kGd~vevle~~~~~peW~lvr~~~~~~~qeGlVPsnyl~~~~~   80 (82)
T 1u3o_A           14 SGGCELTVVLQDFSAAHSSELSIQVGQTVELLERPSERPGWCLVRTTERSPPQEGLVPSSTLCISHS   80 (82)
T ss_dssp             CCCCEEEECSSCBCCCSTTCCCBCTTCEEEESSCTTSSTTEEEEEESSSSSCEEEEEEGGGSCCCCC
T ss_pred             cCCceEEEEEeeecCCCCCeeeEcCCCEEEEEecCCCCCCEEEEEECCCCCCcEeeccccEEecccc
Confidence            4789999999999999999999999999999999988999999999877778999999999966655



>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Back     alignment and structure
>2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Back     alignment and structure
>3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1ri9_A FYN-binding protein; SH3-like, helically extended, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Back     alignment and structure
>1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Back     alignment and structure
>1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
>1wfw_A Kalirin-9A; SH3 domain, neuron-specific GDP/GTP exchange factor, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Back     alignment and structure
>2krs_A Probable enterotoxin; all beta, SH3, ENTD, CPF_0587, CPE0606, structural genomics, PSI-2, protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Back     alignment and structure
>2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Back     alignment and structure
>2kt8_A Probable surface protein; SH3 family, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; NMR {Clostridium perfringens} PDB: 2kyb_A Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Back     alignment and structure
>2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Back     alignment and structure
>1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Back     alignment and structure
>2kq8_A Cell WALL hydrolase; GFT protein structure, NESG, PSI, SH3 domain, structural genomics, protein structure initiative; NMR {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Back     alignment and structure
>4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>3npf_A Putative dipeptidyl-peptidase VI; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: CSA GOL; 1.72A {Bacteroides ovatus} PDB: 3pvq_A Back     alignment and structure
>3npf_A Putative dipeptidyl-peptidase VI; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: CSA GOL; 1.72A {Bacteroides ovatus} PDB: 3pvq_A Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Back     alignment and structure
>3h41_A NLP/P60 family protein; NLPC/P60 family protein, structural genomics, joint center F structural genomics, JCSG; HET: DGL PG4; 1.79A {Bacillus cereus atcc 10987} Back     alignment and structure
>2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Back     alignment and structure
>1ri9_A FYN-binding protein; SH3-like, helically extended, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 147
d1u5sa171 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [Tax 2e-07
d1u5sa171 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [Tax 2e-04
d1gl5a_67 b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musc 3e-06
d1ckaa_57 b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse 6e-06
d1ckaa_57 b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse 0.001
d1awwa_67 b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Hom 7e-06
d1ue9a_80 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 1e-05
d1uffa_93 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 3e-05
d1uhca_79 b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA 3e-05
d1uhca_79 b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA 0.003
d1oota_58 b.34.2.1 (A:) Hypothetical protein YFR024c {Baker' 3e-05
d1oota_58 b.34.2.1 (A:) Hypothetical protein YFR024c {Baker' 6e-04
d1zuua156 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyc 4e-05
d1zuua156 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyc 1e-04
d1jo8a_58 b.34.2.1 (A:) Actin binding protein ABP1 {Baker's 4e-05
d1jo8a_58 b.34.2.1 (A:) Actin binding protein ABP1 {Baker's 0.004
d1i07a_59 b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus 5e-05
d1i07a_59 b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus 0.004
d1efna_57 b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, 6e-05
d1efna_57 b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, 0.003
d1gria156 b.34.2.1 (A:1-56) Growth factor receptor-bound pro 6e-05
d1gria156 b.34.2.1 (A:1-56) Growth factor receptor-bound pro 0.001
d1arka_60 b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo 6e-05
d1opka157 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domai 6e-05
d1opka157 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domai 5e-04
d1fmka164 b.34.2.1 (A:82-145) c-src protein tyrosine kinase 9e-05
d1u06a155 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chic 1e-04
d1k9aa171 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (cs 1e-04
d1sema_58 b.34.2.1 (A:) Growth factor receptor-bound protein 1e-04
d1sema_58 b.34.2.1 (A:) Growth factor receptor-bound protein 0.003
d2iima162 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 d 2e-04
d1gcqa_56 b.34.2.1 (A:) Growth factor receptor-bound protein 2e-04
d1gcqa_56 b.34.2.1 (A:) Growth factor receptor-bound protein 0.002
d2rn8a153 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus 2e-04
d1utia_57 b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona 3e-04
d1uhfa_69 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 4e-04
d2hspa_71 b.34.2.1 (A:) Phospholipase C, SH3 domain {Human ( 4e-04
d1wlpb153 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic 5e-04
d1wlpb153 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic 0.002
d1ycsb263 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [ 5e-04
d1ng2a2118 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic 6e-04
d1ng2a158 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic 6e-04
d1qcfa165 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Hu 8e-04
d1k4us_62 b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId 8e-04
d1ugva_72 b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA062 0.001
d1uj0a_58 b.34.2.1 (A:) Signal transducing adaptor molecule 0.001
d1i1ja_106 b.34.2.1 (A:) Melanoma inhibitory activity protein 0.002
d1ug1a_92 b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA 0.003
d1wfwa_74 b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [Ta 0.003
d1ujya_76 b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens 0.004
d1j3ta_74 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 0.004
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure

class: All beta proteins
fold: SH3-like barrel
superfamily: SH3-domain
family: SH3-domain
domain: Nck-2
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 43.7 bits (103), Expect = 2e-07
 Identities = 15/63 (23%), Positives = 29/63 (46%), Gaps = 5/63 (7%)

Query: 47  VLADYTATNTTELSVHKGQQVEVVHNSSAPPDWALVRLSLGEECSEGLVPTCVLK--QPP 104
            L  +++    EL+  KG+ +EV+      P+W   + + G+    GLVP   +      
Sbjct: 11  TLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNARGQ---VGLVPKNYVVVLSDG 67

Query: 105 PSV 107
           P++
Sbjct: 68  PAL 70


>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 55 Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Length = 58 Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Length = 58 Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 69 Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Length = 74 Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query147
d1uffa_93 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.67
d1ug1a_92 Hypothetical protein Baa76854.1 (KIAA1010) {Human 99.67
d1u5sa171 Nck-2 {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1gl5a_67 tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 99.64
d1wlpb153 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.64
d2rn8a153 Bruton's tyrosine kinase {Mus musculus [TaxId: 100 99.64
d1efna_57 Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu 99.64
d1wfwa_74 Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} 99.64
d1ng2a2118 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.63
d1fmka164 c-src protein tyrosine kinase {Human (Homo sapiens 99.63
d1opka157 Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul 99.63
d1u06a155 alpha-Spectrin, SH3 domain {Chicken (Gallus gallus 99.63
d1ue9a_80 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.62
d1ng2a158 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.62
d1uhca_79 Hypothetical protein Baa76854.1 (KIAA1010) {Human 99.61
d1ycsb263 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1k9aa171 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.6
d1qcfa165 Hemapoetic cell kinase Hck {Human (Homo sapiens) [ 99.6
d1ckaa_57 C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) 99.6
d1uhfa_69 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.59
d1sema_58 Growth factor receptor-bound protein 2 (GRB2), N- 99.58
d1gcqa_56 Growth factor receptor-bound protein 2 (GRB2), N- 99.58
d1utia_57 Grb2-related adaptor protein 2 (Mona/Gads) {Mouse 99.58
d1i07a_59 EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 99.58
d1k4us_62 p67phox {Human (Homo sapiens) [TaxId: 9606]} 99.56
d2iima162 p56-lck tyrosine kinase, SH3 domain {Human (Homo s 99.56
d1oota_58 Hypothetical protein YFR024c {Baker's yeast (Sacch 99.56
d1jo8a_58 Actin binding protein ABP1 {Baker's yeast (Sacchar 99.54
d1gria156 Growth factor receptor-bound protein 2 (GRB2), N- 99.54
d1awwa_67 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 99.53
d2v1ra167 Peroxisomal membrane protein Pex13p {Baker's yeast 99.53
d1uj0a_58 Signal transducing adaptor molecule Stam2 {Mouse ( 99.52
d1j3ta_74 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.51
d1arka_60 SH3 domain from nebulin {Human (Homo sapiens) [Tax 99.5
d1ujya_76 Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 99.49
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.49
d1zuua156 BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.47
d1ugva_72 Olygophrenin-1 like protein (KIAA0621) {Human (Hom 99.46
d1spka_72 BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 99.44
d1wiea_96 RIM binding protein 2, RIMBP2 {Human (Homo sapiens 99.44
d1gcqc_69 Vav N-terminal SH3 domain {Mouse (Mus musculus) [T 99.39
d2hspa_71 Phospholipase C, SH3 domain {Human (Homo sapiens) 99.38
d1kjwa196 Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.35
d1i1ja_106 Melanoma inhibitory activity protein {Human (Homo 99.31
d1phta_83 Phosphatidylinositol 3-kinase (p85-alpha subunit, 99.28
d1bb9a_83 Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 99.26
d1t0ha_96 SH3-like domain of the L-type calcium channel {Rab 99.18
d1vyva1145 SH3-like domain of the L-type calcium channel {Rat 99.08
d1vyua1136 SH3-like domain of the L-type calcium channel {Rat 98.8
d1wlpb153 p47pox (neutrophil cytosolic factor 1) {Human (Hom 97.75
d1ug1a_92 Hypothetical protein Baa76854.1 (KIAA1010) {Human 97.59
d1u5sa171 Nck-2 {Human (Homo sapiens) [TaxId: 9606]} 97.44
d1u06a155 alpha-Spectrin, SH3 domain {Chicken (Gallus gallus 97.43
d1opka157 Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul 97.4
d1efna_57 Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu 97.37
d1ng2a2118 p47pox (neutrophil cytosolic factor 1) {Human (Hom 97.36
d2rn8a153 Bruton's tyrosine kinase {Mus musculus [TaxId: 100 97.36
d1oota_58 Hypothetical protein YFR024c {Baker's yeast (Sacch 97.31
d1gl5a_67 tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 97.3
d1ng2a158 p47pox (neutrophil cytosolic factor 1) {Human (Hom 97.3
d1ycsb263 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 97.25
d1uhca_79 Hypothetical protein Baa76854.1 (KIAA1010) {Human 97.24
d1uffa_93 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 97.22
d1sema_58 Growth factor receptor-bound protein 2 (GRB2), N- 97.15
d1ue9a_80 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 97.14
d1k4us_62 p67phox {Human (Homo sapiens) [TaxId: 9606]} 97.13
d1wfwa_74 Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} 97.11
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 97.1
d1utia_57 Grb2-related adaptor protein 2 (Mona/Gads) {Mouse 97.09
d1fmka164 c-src protein tyrosine kinase {Human (Homo sapiens 97.09
d1gcqa_56 Growth factor receptor-bound protein 2 (GRB2), N- 97.05
d1uj0a_58 Signal transducing adaptor molecule Stam2 {Mouse ( 97.05
d1ckaa_57 C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) 97.03
d1qcfa165 Hemapoetic cell kinase Hck {Human (Homo sapiens) [ 97.01
d1uhfa_69 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 96.96
d1gria156 Growth factor receptor-bound protein 2 (GRB2), N- 96.95
d1jo8a_58 Actin binding protein ABP1 {Baker's yeast (Sacchar 96.89
d1i07a_59 EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 96.85
d1awwa_67 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 96.84
d1k9aa171 Carboxyl-terminal src kinase (csk) {Human (Homo sa 96.83
d2iima162 p56-lck tyrosine kinase, SH3 domain {Human (Homo s 96.81
d1zuua156 BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 96.77
d1ujya_76 Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 96.76
d1ri9a_77 Fyn-binding protein (T-cell adapter protein adap) 96.73
d1j3ta_74 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 96.72
d2hspa_71 Phospholipase C, SH3 domain {Human (Homo sapiens) 96.69
d1ugva_72 Olygophrenin-1 like protein (KIAA0621) {Human (Hom 96.64
d1i1ja_106 Melanoma inhibitory activity protein {Human (Homo 96.56
d1bb9a_83 Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 96.53
d1arka_60 SH3 domain from nebulin {Human (Homo sapiens) [Tax 96.5
d2v1ra167 Peroxisomal membrane protein Pex13p {Baker's yeast 96.21
d1gcqc_69 Vav N-terminal SH3 domain {Mouse (Mus musculus) [T 95.88
d1kjwa196 Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} 95.0
d1spka_72 BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 94.92
d1wiea_96 RIM binding protein 2, RIMBP2 {Human (Homo sapiens 94.61
d1phta_83 Phosphatidylinositol 3-kinase (p85-alpha subunit, 94.55
d1t0ha_96 SH3-like domain of the L-type calcium channel {Rab 94.3
d1vyva1145 SH3-like domain of the L-type calcium channel {Rat 89.49
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: SH3-like barrel
superfamily: SH3-domain
family: SH3-domain
domain: Intersectin 2 (KIAA1256)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.67  E-value=5.7e-17  Score=111.93  Aligned_cols=76  Identities=24%  Similarity=0.353  Sum_probs=61.1

Q ss_pred             ceEEEEEeeeccCCCceeeeecCCEEEEEeCCCCCCCcEEEEecCCCCCeecccccceeecCCCCCCccCCCCCcccccc
Q psy12864         42 IEMTWVLADYTATNTTELSVHKGQQVEVVHNSSAPPDWALVRLSLGEECSEGLVPTCVLKQPPPSVLRTATSPSKRITLP  121 (147)
Q Consensus        42 ~e~~~Vi~dF~Ar~~~ELSv~kGq~VEIlE~~~~~p~WwLvR~~~~~~gqeGlVP~n~L~~~~~~~~~~~~~p~~~~~~~  121 (147)
                      ...+.|||||.+++.+||+|++||.|+|+++...+.+||.++..    |++||||+||+++.+........+|.+...-|
T Consensus         5 ~~~~rAlydy~~~~~~ELs~~~Gd~v~Vl~~~~~~~~w~~~~~~----g~~G~~P~~Yve~~~~~~~~~~~~~~~~~~~p   80 (93)
T d1uffa_           5 SSGYRALYPFEARNHDEMSFNSGDIIQVDEKTVGEPGWLYGSFQ----GNFGWFPCNYVEKMPSSENEKAVSPKKALLPP   80 (93)
T ss_dssp             CCCEEESSCBCCCSSSCCCBCTTCEEEECSSCCCSSSEEEEEET----TEEEEEETTTEEECCSSSSCCCCCCCCCCCCC
T ss_pred             CeEEEECccCCCCCCCCccCcCCCEEEEEEeccCCCCEEEEEeC----CcEEEEchHHEEECCCCCCCcCcCCcccCCCC
Confidence            35789999999999999999999999999998666789999874    99999999999987665544444444443333



>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri9a_ b.34.2.1 (A:) Fyn-binding protein (T-cell adapter protein adap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure