Psyllid ID: psy12875


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
ASILLLLTYISTVTSTDTPVIGILAQEYTHIPSYVKAYPNYTSYIAASYVKNIEAAGARVVPILIGQDREYYAEILTQINGVVIPGGGTGFDHPNGYADAGRQILHLVDKINEEGVTFPVLGVCLGFELILQVSNNDTDFRKSCKVQQVNLNLKFLPGAKRSSLFSQINEEGVTFPVLGVCLGFELILQVSNNDTDFRKSCKVQQVNLNLKFLPGAKRSSLFSQVPSKYIKKFYQKPLTHNNHIWCITRQDMIKYGLTETWNILTLSKYKSWEFVSTVEHKEYPIVGIQFHPEKNAYEWTESQHNPHS
cEEEEEEEcccccccccccEEEEEccccccccccccccccccEEEEHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHccEEcccccccccccccccHHHHHHHHHHHHHHcccccccEEEEEccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccEEEEcccccccccccccHHHHHHHcccccEEEEccEEEEccccccccccccEEEEEEEEccccEEEEEEEEccccEEEEEEcccccccccccccccccc
cHHHHHHHHHHHHHcccccEEEEEEEcccccccccccccccccEEEHHHHHHHHHcccEEEEEcccccHHHHHHHHHHccEEEEccccccccccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHcccccccccEEHHHHHHHHHHHHHcccccHHHHcccccccccccccccccccHHHHcccHHHHHHHHccccHHHcccccccHHHcccccHHHHEEEEEEEEccccEEEEEEEEccccEEEEcccccHHHHccccccccccc
ASILLLLTYISTvtstdtpviGILAQEythipsyvkaypnyTSYIAASYVKNIEAAGARVVPILIGQDREYYAEILTQIngvvipgggtgfdhpngyadaGRQILHLVDKineegvtfpVLGVCLGFELILQVsnndtdfrkscKVQQVNlnlkflpgakrsslfsqineegvtfpVLGVCLGFELILQVsnndtdfrkscKVQQVNlnlkflpgakrsslfsqvpsKYIKKfyqkplthnnhiwcITRQDMIKYGLTETWNILTLskykswefvstvehkeypivgiqfhpeknayewtesqhnphs
ASILLLLTYISTvtstdtpvIGILAQEYTHIPSYVKAYPNYTSYIAASYVKNIEAAGARVVPILIGQDREYYAEILTQINGVVIPGGGTGFDHPNGYADAGRQILHLVDKINEEGVTFPVLGVCLGFELILQVSNNDTDFRKSCKVQQVNLNLKFLPGAKRSSLFSQINEEGVTFPVLGVCLGFELILQVSNNDTDFRKSCKVQQVNLNlkflpgakrsslfsqVPSKYIKKFyqkplthnnhIWCITRQDMIKYGLTETWNILTLSKYKSWEFVSTVEHKEYPIVGIQFHPEKNAYEWTESQHNPHS
ASILLLLTYISTVTSTDTPVIGILAQEYTHIPSYVKAYPNYTSYIAASYVKNIEAAGARVVPILIGQDREYYAEILTQINGVVIPGGGTGFDHPNGYADAGRQILHLVDKINEEGVTFPVLGVCLGFELILQVSNNDTDFRKSCKVQQVNLNLKFLPGAKRSSLFSQINEEGVTFPVLGVCLGFELILQVSNNDTDFRKSCKVQQVNLNLKFLPGAKRSSLFSQVPSKYIKKFYQKPLTHNNHIWCITRQDMIKYGLTETWNILTLSKYKSWEFVSTVEHKEYPIVGIQFHPEKNAYEWTESQHNPHS
**ILLLLTYISTVTSTDTPVIGILAQEYTHIPSYVKAYPNYTSYIAASYVKNIEAAGARVVPILIGQDREYYAEILTQINGVVIPGGGTGFDHPNGYADAGRQILHLVDKINEEGVTFPVLGVCLGFELILQVSNNDTDFRKSCKVQQVNLNLKFLPGAKRSSLFSQINEEGVTFPVLGVCLGFELILQVSNNDTDFRKSCKVQQVNLNLKFLPGAKRSSLFSQVPSKYIKKFYQKPLTHNNHIWCITRQDMIKYGLTETWNILTLSKYKSWEFVSTVEHKEYPIVGIQFHPEKNAYEW*********
ASILLLLTYISTVTSTDTPVIGILAQEYTHIPSYVKAYPNYTSYIAASYVKNIEAAGARVVPILIGQDREYYAEILTQINGVVIPGGGTGFDHPNGYADAGRQILHLVDKINEEGVTFPVLGVCLGFELILQVSNNDTDFRKSCKVQQVNLNLKFLPGAKRSSLFSQINEEGVTFPVLGVCLGFELILQVSNNDTDFRKSCKVQQVNLNLKFLPGAKRSSLFSQVPSKYIKKFYQKPLTHNNHIWCITRQDMIKYGLTETWNILTLSKYKSWEFVSTVEHKEYPIVGIQFHPEKNAYEWTE*******
ASILLLLTYISTVTSTDTPVIGILAQEYTHIPSYVKAYPNYTSYIAASYVKNIEAAGARVVPILIGQDREYYAEILTQINGVVIPGGGTGFDHPNGYADAGRQILHLVDKINEEGVTFPVLGVCLGFELILQVSNNDTDFRKSCKVQQVNLNLKFLPGAKRSSLFSQINEEGVTFPVLGVCLGFELILQVSNNDTDFRKSCKVQQVNLNLKFLPGAKRSSLFSQVPSKYIKKFYQKPLTHNNHIWCITRQDMIKYGLTETWNILTLSKYKSWEFVSTVEHKEYPIVGIQFHPEKNAYE**********
ASILLLLTYISTVTSTDTPVIGILAQEYTHIPSYVKAYPNYTSYIAASYVKNIEAAGARVVPILIGQDREYYAEILTQINGVVIPGGGTGFDHPNGYADAGRQILHLVDKINEEGVTFPVLGVCLGFELILQVSNNDTDFRKSCKVQQVNLNLKFLPGAKRSSLFSQINEEGVTFPVLGVCLGFELILQVSNNDTDFRKSCKVQQVNLNLKFLPGAKRSSLFSQVPSKYIKKFYQKPLTHNNHIWCITRQDMIKYGLTETWNILTLSKYKSWEFVSTVEHKEYPIVGIQFHPEKNAYEWTES******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ASILLLLTYISTVTSTDTPVIGILAQEYTHIPSYVKAYPNYTSYIAASYVKNIEAAGARVVPILIGQDREYYAEILTQINGVVIPGGGTGFDHPNGYADAGRQILHLVDKINEEGVTFPVLGVCLGFELILQVSNNDTDFRKSCKVQQVNLNLKFLPGAKRSSLFSQINEEGVTFPVLGVCLGFELILQVSNNDTDFRKSCKVQQVNLNLKFLPGAKRSSLFSQVPSKYIKKFYQKPLTHNNHIWCITRQDMIKYGLTETWNILTLSKYKSWEFVSTVEHKEYPIVGIQFHPEKNAYEWTESQHNPHS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query308 2.2.26 [Sep-21-2011]
Q54HL4347 Gamma-glutamyl hydrolase yes N/A 0.795 0.706 0.299 7e-26
Q92820318 Gamma-glutamyl hydrolase yes N/A 0.701 0.679 0.295 7e-24
Q54LN4317 Gamma-glutamyl hydrolase no N/A 0.730 0.709 0.298 3e-23
Q62867317 Gamma-glutamyl hydrolase yes N/A 0.730 0.709 0.298 5e-23
Q9Z0L8317 Gamma-glutamyl hydrolase yes N/A 0.714 0.694 0.287 8e-23
A7YWG4318 Gamma-glutamyl hydrolase yes N/A 0.733 0.710 0.3 1e-22
O65355347 Gamma-glutamyl hydrolase no N/A 0.740 0.657 0.273 4e-19
P93164342 Gamma-glutamyl hydrolase no N/A 0.746 0.672 0.25 5e-14
Q9UXW5223 Phosphoribosylformylglyci yes N/A 0.331 0.457 0.320 0.0002
Q8PTB0232 Phosphoribosylformylglyci yes N/A 0.233 0.310 0.384 0.0007
>sp|Q54HL4|GGHB_DICDI Gamma-glutamyl hydrolase B OS=Dictyostelium discoideum GN=gghB PE=3 SV=1 Back     alignment and function desciption
 Score =  117 bits (294), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 94/314 (29%), Positives = 130/314 (41%), Gaps = 69/314 (21%)

Query: 2   SILLLLTYISTV----TSTDTPVIGILAQEYTHIPSYVK-AYPNYTSYIAASYVKNIEAA 56
           S+ + L  IS +    T  +TPVIGIL Q +   PS +   Y +  +Y+ ASYVK +E+A
Sbjct: 6   SLFIYLYLISNLKLINTINNTPVIGILTQPF---PSSINIKYGD--NYLMASYVKYVESA 60

Query: 57  GARVVPILIGQDREYYAEILTQINGVVIPGGGTGFDHPNGYADAGRQILHLVDKINEEGV 116
           GARVVPI   QD E    I  QING+++PGG   F     Y      I   V  +N  G 
Sbjct: 61  GARVVPIFYNQDDESLTTIFKQINGILLPGGDVDFKTEIQYVKTLTLIWDYVLDVNINGD 120

Query: 117 TFPVLGVCLGFELILQVSNNDTDFRKSCKVQQVNLNLKFLPGAKRSSLFSQINEEGVTFP 176
            FP+ G CLG E I+ +                         A+   + +  N E  + P
Sbjct: 121 YFPLWGTCLGLEEIVSLQ------------------------AESFDVLTDFNAENYSIP 156

Query: 177 VLGVCLGFELILQVSNNDTDFRKSCKVQQVNLNLKFLPGAKRSSLFSQVPSKYIKKFYQK 236
                                            L F   A  S +    P+  I      
Sbjct: 157 ---------------------------------LNFSNIALESKIMKNCPTNIINSLAND 183

Query: 237 PLTHNNHIWCITRQDMIKYG-LTETWNILTLSKYKSW-EFVSTVEHKEYPIVGIQFHPEK 294
           P+T NNH + I+         L + +N+L  +  KS  EF+S +E K+YPI  I +HPEK
Sbjct: 184 PITMNNHHFGISPNTFDNNSLLNQFFNVLATNNDKSGNEFISLIESKDYPIYAIIWHPEK 243

Query: 295 NAYEWTESQHNPHS 308
           + Y W       HS
Sbjct: 244 SPYSWYSKDATDHS 257





Dictyostelium discoideum (taxid: 44689)
EC: 3EC: .EC: 4EC: .EC: 1EC: 9EC: .EC: 9
>sp|Q92820|GGH_HUMAN Gamma-glutamyl hydrolase OS=Homo sapiens GN=GGH PE=1 SV=2 Back     alignment and function description
>sp|Q54LN4|GGHA_DICDI Gamma-glutamyl hydrolase A OS=Dictyostelium discoideum GN=gghA PE=3 SV=1 Back     alignment and function description
>sp|Q62867|GGH_RAT Gamma-glutamyl hydrolase OS=Rattus norvegicus GN=Ggh PE=1 SV=1 Back     alignment and function description
>sp|Q9Z0L8|GGH_MOUSE Gamma-glutamyl hydrolase OS=Mus musculus GN=Ggh PE=1 SV=2 Back     alignment and function description
>sp|A7YWG4|GGH_BOVIN Gamma-glutamyl hydrolase OS=Bos taurus GN=GGH PE=2 SV=1 Back     alignment and function description
>sp|O65355|GGH_ARATH Gamma-glutamyl hydrolase OS=Arabidopsis thaliana GN=GGH PE=1 SV=2 Back     alignment and function description
>sp|P93164|GGH_SOYBN Gamma-glutamyl hydrolase OS=Glycine max PE=2 SV=1 Back     alignment and function description
>sp|Q9UXW5|PURQ_PYRAB Phosphoribosylformylglycinamidine synthase 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=purQ PE=3 SV=1 Back     alignment and function description
>sp|Q8PTB0|PURQ_METMA Phosphoribosylformylglycinamidine synthase 1 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=purQ PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query308
340720772322 PREDICTED: gamma-glutamyl hydrolase A-li 0.740 0.708 0.369 1e-44
242009081320 gamma-glutamyl hydrolase precursor, puta 0.756 0.728 0.375 3e-44
350398057328 PREDICTED: gamma-glutamyl hydrolase-like 0.759 0.713 0.372 4e-44
157127097375 gamma-glutamyl hydrolase, putative [Aede 0.759 0.624 0.351 4e-44
157127101354 gamma-glutamyl hydrolase, putative [Aede 0.762 0.663 0.350 4e-44
157127099376 gamma-glutamyl hydrolase, putative [Aede 0.762 0.625 0.350 6e-44
322794376342 hypothetical protein SINV_12245 [Solenop 0.834 0.751 0.366 2e-43
307184425349 Gamma-glutamyl hydrolase [Camponotus flo 0.795 0.702 0.359 8e-43
326741704314 gamma-glutamyl hydrolase-like precursor 0.798 0.783 0.343 9e-43
345497598320 PREDICTED: gamma-glutamyl hydrolase A-li 0.769 0.740 0.359 6e-42
>gi|340720772|ref|XP_003398804.1| PREDICTED: gamma-glutamyl hydrolase A-like [Bombus terrestris] Back     alignment and taxonomy information
 Score =  186 bits (472), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 109/295 (36%), Positives = 149/295 (50%), Gaps = 67/295 (22%)

Query: 14  TSTDTPVIGILAQEYTHIPSYVKAYPNYTSYIAASYVKNIEAAGARVVPILIGQDREYYA 73
           T  + P+IGILAQE          + +  SYIAASYVK IE AGARVVP+ IG+D  YY 
Sbjct: 27  TVNNRPIIGILAQE---------KFSSNKSYIAASYVKFIEGAGARVVPLWIGRDECYYE 77

Query: 74  EILTQINGVVIPGGGTGFDHPNGYADAGRQILHLVDKINEEGVTFPVLGVCLGFELILQV 133
           +IL++INGV+ PGG   F    GYADAG +I  +  ++N  G  FP+LG+CLGFEL+  V
Sbjct: 78  DILSKINGVLWPGGSASFTSNKGYADAGYKIYKIAKRMNNNGDYFPILGICLGFELLTYV 137

Query: 134 SNNDTDFRKSCKVQQVNLNLKFLPGAKRSSLFSQINEEGVTFPVLGVCLGFELILQVSNN 193
                  R +C  Q + L L+F PG +RS +FS I                      S+N
Sbjct: 138 VAERVHHRTNCSAQSLPLELEFTPGYRRSRMFSNI----------------------SDN 175

Query: 194 DTDFRKSCKVQQVNLNLKFLPGAKRSSLFSQVPSKYIKKFYQKPLTHNNHIWCITRQDMI 253
             D  ++ KV                                   T N H +C+T++ + 
Sbjct: 176 VEDILRTKKV-----------------------------------TSNQHQYCVTKRGLQ 200

Query: 254 KYGLTETWNILTLS-KYKSWEFVSTVEHKEYPIVGIQFHPEKNAYEWTESQHNPH 307
             G++  + IL+L+      EF+S++EH  YP  G+QFHPEKN YEW   +  PH
Sbjct: 201 CAGVSNKFRILSLNHDLDGVEFISSLEHITYPFYGLQFHPEKNLYEWIIGKKIPH 255




Source: Bombus terrestris

Species: Bombus terrestris

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242009081|ref|XP_002425321.1| gamma-glutamyl hydrolase precursor, putative [Pediculus humanus corporis] gi|212509095|gb|EEB12583.1| gamma-glutamyl hydrolase precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|350398057|ref|XP_003485074.1| PREDICTED: gamma-glutamyl hydrolase-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|157127097|ref|XP_001654802.1| gamma-glutamyl hydrolase, putative [Aedes aegypti] gi|108884507|gb|EAT48732.1| AAEL000271-PB, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|157127101|ref|XP_001654804.1| gamma-glutamyl hydrolase, putative [Aedes aegypti] gi|108884509|gb|EAT48734.1| AAEL000271-PC [Aedes aegypti] Back     alignment and taxonomy information
>gi|157127099|ref|XP_001654803.1| gamma-glutamyl hydrolase, putative [Aedes aegypti] gi|108884508|gb|EAT48733.1| AAEL000271-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|322794376|gb|EFZ17480.1| hypothetical protein SINV_12245 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307184425|gb|EFN70834.1| Gamma-glutamyl hydrolase [Camponotus floridanus] Back     alignment and taxonomy information
>gi|326741704|ref|NP_001192053.1| gamma-glutamyl hydrolase-like precursor [Acyrthosiphon pisum] gi|239790522|dbj|BAH71816.1| ACYPI008145 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|345497598|ref|XP_001601392.2| PREDICTED: gamma-glutamyl hydrolase A-like [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query308
FB|FBgn0263607373 l(3)72Dp "lethal (3) 72Dp" [Dr 0.503 0.415 0.452 1.7e-34
UNIPROTKB|F1NR48321 GGH "Uncharacterized protein" 0.457 0.439 0.398 3.3e-24
ZFIN|ZDB-GENE-040426-2615312 ggh "gamma-glutamyl hydrolase 0.529 0.522 0.356 1.3e-22
ZFIN|ZDB-GENE-050309-193314 zgc:171566 "zgc:171566" [Danio 0.477 0.468 0.379 1.7e-20
DICTYBASE|DDB_G0286535317 gghA "peptidase C26 family pro 0.519 0.504 0.369 1.9e-19
FB|FBgn0263608345 l(3)72Dr "lethal (3) 72Dr" [Dr 0.451 0.402 0.321 4.1e-19
RGD|2682317 Ggh "gamma-glutamyl hydrolase 0.461 0.447 0.375 1.7e-17
UNIPROTKB|A7YWG4318 GGH "Gamma-glutamyl hydrolase" 0.457 0.443 0.387 1.8e-17
DICTYBASE|DDB_G0289365347 gghB "peptidase C26 family pro 0.477 0.423 0.370 3.2e-17
MGI|MGI:1329035317 Ggh "gamma-glutamyl hydrolase" 0.483 0.470 0.371 1e-16
FB|FBgn0263607 l(3)72Dp "lethal (3) 72Dp" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 374 (136.7 bits), Expect = 1.7e-34, P = 1.7e-34
 Identities = 71/157 (45%), Positives = 109/157 (69%)

Query:    18 TPVIGILAQEYTHIPSYV-KAYPNYTSYIAASYVKNIEAAGARVVPILIGQDREYYAEIL 76
             +P+IG+L QE  ++   + + + N TSYIAASYVK +E AGARVVPI IG++R YY +++
Sbjct:    25 SPIIGVLTQE-VYVDGLISRHFDNKTSYIAASYVKYLEGAGARVVPIWIGRNRSYYDDLM 83

Query:    77 TQINGVVIPGGGTGFDHPNGYADAGRQILHLVDKINEEGVTFPVLGVCLGFELILQVSNN 136
              +INGV++PGG T F+  NGYADAG  ++HL  ++N++GV  PV G CLG EL++    N
Sbjct:    84 RKINGVLLPGGATWFNQSNGYADAGEHLIHLAIELNDQGVFMPVWGTCLGMELLVYKLAN 143

Query:   137 DTDFRKSCKVQQVNLNLKFLPGAKRSSLFSQINEEGV 173
             +T+ R +C+   + + ++F    K+S LF+ I ++ V
Sbjct:   144 ETEHRINCEATGMAVPMEFKEDYKKSRLFASITDDVV 180


GO:0008242 "omega peptidase activity" evidence=ISS
GO:0008150 "biological_process" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0006541 "glutamine metabolic process" evidence=IEA
UNIPROTKB|F1NR48 GGH "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2615 ggh "gamma-glutamyl hydrolase (conjugase, folylpolygammaglutamyl hydrolase)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050309-193 zgc:171566 "zgc:171566" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0286535 gghA "peptidase C26 family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0263608 l(3)72Dr "lethal (3) 72Dr" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|2682 Ggh "gamma-glutamyl hydrolase (conjugase, folylpolygammaglutamyl hydrolase)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A7YWG4 GGH "Gamma-glutamyl hydrolase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0289365 gghB "peptidase C26 family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
MGI|MGI:1329035 Ggh "gamma-glutamyl hydrolase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.19.9LOW CONFIDENCE prediction!
3rd Layer3.4.19LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query308
cd01747273 cd01747, GATase1_Glutamyl_Hydrolase, Type 1 glutam 1e-59
pfam07722219 pfam07722, Peptidase_C26, Peptidase C26 5e-26
COG2071243 COG2071, COG2071, Predicted glutamine amidotransfe 1e-09
cd01745189 cd01745, GATase1_2, Subgroup of proteins having th 9e-09
cd0312892 cd03128, GAT_1, Type 1 glutamine amidotransferase 4e-08
cd01653115 cd01653, GATase1, Type 1 glutamine amidotransferas 1e-07
pfam00117186 pfam00117, GATase, Glutamine amidotransferase clas 3e-05
cd01740238 cd01740, GATase1_FGAR_AT, Type 1 glutamine amidotr 1e-04
PRK14607 534 PRK14607, PRK14607, bifunctional glutamine amidotr 2e-04
TIGR01855196 TIGR01855, IMP_synth_hisH, imidazole glycerol phos 5e-04
PRK05670189 PRK05670, PRK05670, anthranilate synthase componen 6e-04
cd01743184 cd01743, GATase1_Anthranilate_Synthase, Type 1 glu 8e-04
COG0512191 COG0512, PabA, Anthranilate/para-aminobenzoate syn 9e-04
pfam00117186 pfam00117, GATase, Glutamine amidotransferase clas 0.001
PLN02335222 PLN02335, PLN02335, anthranilate synthase 0.002
>gnl|CDD|153218 cd01747, GATase1_Glutamyl_Hydrolase, Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase Back     alignment and domain information
 Score =  191 bits (487), Expect = 1e-59
 Identities = 92/290 (31%), Positives = 131/290 (45%), Gaps = 64/290 (22%)

Query: 21  IGILAQEYTHIPSYVKAYPNYTSYIAASYVKNIEAAGARVVPILIGQDREYYAEILTQIN 80
           IGIL Q         K      SYIAASYVK +E+AGARVVPI I +  EYY ++     
Sbjct: 1   IGILTQP-VDGAGSNK---TGHSYIAASYVKFLESAGARVVPIWINESEEYYDKLFKS-- 54

Query: 81  GVVIPGGGTGFDHPNGYADAGRQILHLVDKINEEGVTFPVLGVCLGFELILQVSNNDTDF 140
                                         IN  G+ FP   V +      +        
Sbjct: 55  ------------------------------IN--GILFPGGAVDIDTSGYART------- 75

Query: 141 RKSCKVQQVNLNLKFLPGAKRSSLFSQINEEGVTFPVLGVCLGFELILQVSNNDTDFRKS 200
                                 +L  + N+ G  FPV G CLGFEL+  +++ +T   ++
Sbjct: 76  -----------------AKIIYNLALERNDAGDYFPVWGTCLGFELLTYLTSGETLLLEA 118

Query: 201 CKVQQVNLNLKFLPGAKRSSLFSQVPSKYIKKFYQKPLTHNNHIWCITRQDMIKYGLT-E 259
            +     L L F   A +S LF + P   +K    +PLT NNH + I+ ++  + GL  +
Sbjct: 119 TEATNSALPLNFTEDALQSRLFKRFPPDLLKSLATEPLTMNNHRYGISPENFTENGLLSD 178

Query: 260 TWNILTLSKYKSW-EFVSTVEHKEYPIVGIQFHPEKNAYEWTESQHNPHS 308
            +N+LT +   +  EF+STVE  +YPI G+Q+HPEKNA+EW +S   PHS
Sbjct: 179 FFNVLTTNDDWNGVEFISTVEAYKYPIYGVQWHPEKNAFEWKKSSSIPHS 228


Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase. gamma-Glutamyl Hydrolase catalyzes the cleavage of the gamma-glutamyl chain of folylpoly-gamma-glutamyl substrates and is a central enzyme in folyl and antifolyl poly-gamma-glutamate metabolism. GATase activity involves the removal of the ammonia group from a glutamate molecule and its subsequent transfer to a specific substrate, thus creating a new carbon-nitrogen group on the substrate. gamma-Glutamyl hydrolases belong to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site. Length = 273

>gnl|CDD|219535 pfam07722, Peptidase_C26, Peptidase C26 Back     alignment and domain information
>gnl|CDD|224982 COG2071, COG2071, Predicted glutamine amidotransferases [General function prediction only] Back     alignment and domain information
>gnl|CDD|153216 cd01745, GATase1_2, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>gnl|CDD|153222 cd03128, GAT_1, Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>gnl|CDD|153210 cd01653, GATase1, Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>gnl|CDD|215729 pfam00117, GATase, Glutamine amidotransferase class-I Back     alignment and domain information
>gnl|CDD|153211 cd01740, GATase1_FGAR_AT, Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase Back     alignment and domain information
>gnl|CDD|237764 PRK14607, PRK14607, bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|233601 TIGR01855, IMP_synth_hisH, imidazole glycerol phosphate synthase, glutamine amidotransferase subunit Back     alignment and domain information
>gnl|CDD|235552 PRK05670, PRK05670, anthranilate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|153214 cd01743, GATase1_Anthranilate_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase Back     alignment and domain information
>gnl|CDD|223586 COG0512, PabA, Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|215729 pfam00117, GATase, Glutamine amidotransferase class-I Back     alignment and domain information
>gnl|CDD|177969 PLN02335, PLN02335, anthranilate synthase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 308
cd01747273 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidot 100.0
KOG1559|consensus340 100.0
PF07722217 Peptidase_C26: Peptidase C26; InterPro: IPR011697 100.0
COG2071243 Predicted glutamine amidotransferases [General fun 100.0
PRK11366254 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; 99.97
COG0512191 PabA Anthranilate/para-aminobenzoate synthases com 99.97
PRK06895190 putative anthranilate synthase component II; Provi 99.95
cd01743184 GATase1_Anthranilate_Synthase Type 1 glutamine ami 99.95
PRK08007187 para-aminobenzoate synthase component II; Provisio 99.95
TIGR00566188 trpG_papA glutamine amidotransferase of anthranila 99.95
PRK08857193 para-aminobenzoate synthase component II; Provisio 99.94
PRK07765214 para-aminobenzoate synthase component II; Provisio 99.94
PRK07649195 para-aminobenzoate/anthranilate synthase glutamine 99.94
COG0118204 HisH Glutamine amidotransferase [Amino acid transp 99.94
TIGR00888188 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N 99.94
PRK05670189 anthranilate synthase component II; Provisional 99.94
cd01745189 GATase1_2 Subgroup of proteins having the Type 1 g 99.94
CHL00101190 trpG anthranilate synthase component 2 99.94
cd01742181 GATase1_GMP_Synthase Type 1 glutamine amidotransfe 99.94
PRK06774191 para-aminobenzoate synthase component II; Provisio 99.94
PRK05637208 anthranilate synthase component II; Provisional 99.93
cd01744178 GATase1_CPSase Small chain of the glutamine-depend 99.92
PRK00758184 GMP synthase subunit A; Validated 99.92
PLN02335222 anthranilate synthase 99.92
PF00117192 GATase: Glutamine amidotransferase class-I; InterP 99.92
PRK09065237 glutamine amidotransferase; Provisional 99.92
PLN02347 536 GMP synthetase 99.92
PRK05665240 amidotransferase; Provisional 99.91
COG0518198 GuaA GMP synthase - Glutamine amidotransferase dom 99.91
PRK12564360 carbamoyl phosphate synthase small subunit; Review 99.91
PRK00074 511 guaA GMP synthase; Reviewed 99.9
CHL00188210 hisH imidazole glycerol phosphate synthase subunit 99.9
TIGR01368358 CPSaseIIsmall carbamoyl-phosphate synthase, small 99.9
PRK07567242 glutamine amidotransferase; Provisional 99.9
PRK13566720 anthranilate synthase; Provisional 99.89
PRK06490239 glutamine amidotransferase; Provisional 99.89
cd01741188 GATase1_1 Subgroup of proteins having the Type 1 g 99.89
TIGR01815717 TrpE-clade3 anthranilate synthase, alpha proteobac 99.89
PRK07053234 glutamine amidotransferase; Provisional 99.88
PRK13146209 hisH imidazole glycerol phosphate synthase subunit 99.88
PRK14607 534 bifunctional glutamine amidotransferase/anthranila 99.88
PRK09522 531 bifunctional glutamine amidotransferase/anthranila 99.88
cd01748198 GATase1_IGP_Synthase Type 1 glutamine amidotransfe 99.88
PLN02889 918 oxo-acid-lyase/anthranilate synthase 99.88
cd01746235 GATase1_CTP_Synthase Type 1 glutamine amidotransfe 99.88
PRK12838354 carbamoyl phosphate synthase small subunit; Review 99.88
PRK13525189 glutamine amidotransferase subunit PdxT; Provision 99.88
PRK13170196 hisH imidazole glycerol phosphate synthase subunit 99.87
PRK08250235 glutamine amidotransferase; Provisional 99.87
PLN02771415 carbamoyl-phosphate synthase (glutamine-hydrolyzin 99.87
PRK13181199 hisH imidazole glycerol phosphate synthase subunit 99.86
CHL00197382 carA carbamoyl-phosphate synthase arginine-specifi 99.86
PRK14004210 hisH imidazole glycerol phosphate synthase subunit 99.86
PRK13527200 glutamine amidotransferase subunit PdxT; Provision 99.85
PRK06186229 hypothetical protein; Validated 99.85
KOG0026|consensus223 99.85
PRK13152201 hisH imidazole glycerol phosphate synthase subunit 99.85
COG0505368 CarA Carbamoylphosphate synthase small subunit [Am 99.84
PRK13143200 hisH imidazole glycerol phosphate synthase subunit 99.84
PRK13141205 hisH imidazole glycerol phosphate synthase subunit 99.84
TIGR01855196 IMP_synth_hisH imidazole glycerol phosphate syntha 99.83
TIGR01823 742 PabB-fungal aminodeoxychorismate synthase, fungal 99.83
PRK13142192 hisH imidazole glycerol phosphate synthase subunit 99.83
TIGR00337525 PyrG CTP synthase. CTP synthase is involved in pyr 99.83
cd01749183 GATase1_PB Glutamine Amidotransferase (GATase_I) i 99.81
PRK05380533 pyrG CTP synthetase; Validated 99.8
PLN02327557 CTP synthase 99.77
PLN02617 538 imidazole glycerol phosphate synthase hisHF 99.77
TIGR03800184 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, gl 99.76
COG0504533 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide 99.75
PLN02832248 glutamine amidotransferase subunit of pyridoxal 5' 99.75
KOG3179|consensus245 99.73
TIGR01737227 FGAM_synth_I phosphoribosylformylglycinamidine syn 99.72
KOG1622|consensus 552 99.7
KOG1224|consensus 767 99.69
KOG2387|consensus585 99.62
PRK05368302 homoserine O-succinyltransferase; Provisional 99.62
PRK03619219 phosphoribosylformylglycinamidine synthase I; Prov 99.58
KOG0623|consensus 541 99.53
KOG0370|consensus 1435 99.52
COG0047231 PurL Phosphoribosylformylglycinamidine (FGAM) synt 99.45
PRK13526179 glutamine amidotransferase subunit PdxT; Provision 99.43
PRK01175261 phosphoribosylformylglycinamidine synthase I; Prov 99.41
cd01740238 GATase1_FGAR_AT Type 1 glutamine amidotransferase 99.31
COG0311194 PDX2 Predicted glutamine amidotransferase involved 99.29
PF01174188 SNO: SNO glutamine amidotransferase family; InterP 99.28
COG0512191 PabA Anthranilate/para-aminobenzoate synthases com 99.17
PF13507259 GATase_5: CobB/CobQ-like glutamine amidotransferas 99.11
PRK08007187 para-aminobenzoate synthase component II; Provisio 98.88
cd03130198 GATase1_CobB Type 1 glutamine amidotransferase (GA 98.84
TIGR018571239 FGAM-synthase phosphoribosylformylglycinamidine sy 98.84
TIGR017351310 FGAM_synt phosphoribosylformylglycinamidine syntha 98.82
PRK052971290 phosphoribosylformylglycinamidine synthase; Provis 98.81
PLN032061307 phosphoribosylformylglycinamidine synthase; Provis 98.78
PRK07649195 para-aminobenzoate/anthranilate synthase glutamine 98.78
PRK06774191 para-aminobenzoate synthase component II; Provisio 98.76
COG0505368 CarA Carbamoylphosphate synthase small subunit [Am 98.75
KOG3210|consensus226 98.74
TIGR00566188 trpG_papA glutamine amidotransferase of anthranila 98.73
cd01750194 GATase1_CobQ Type 1 glutamine amidotransferase (GA 98.71
CHL00101190 trpG anthranilate synthase component 2 98.65
PRK08857193 para-aminobenzoate synthase component II; Provisio 98.65
PLN02335222 anthranilate synthase 98.63
PHA033661304 FGAM-synthase; Provisional 98.63
PLN02771415 carbamoyl-phosphate synthase (glutamine-hydrolyzin 98.63
PRK06895190 putative anthranilate synthase component II; Provi 98.62
PRK05670189 anthranilate synthase component II; Provisional 98.6
TIGR017391202 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM 98.51
PRK07765214 para-aminobenzoate synthase component II; Provisio 98.45
PRK09522 531 bifunctional glutamine amidotransferase/anthranila 98.4
PRK05637208 anthranilate synthase component II; Provisional 98.39
TIGR01368358 CPSaseIIsmall carbamoyl-phosphate synthase, small 98.37
PLN02889 918 oxo-acid-lyase/anthranilate synthase 98.37
PRK12838354 carbamoyl phosphate synthase small subunit; Review 98.36
cd01743184 GATase1_Anthranilate_Synthase Type 1 glutamine ami 98.35
PF00117192 GATase: Glutamine amidotransferase class-I; InterP 98.31
CHL00197382 carA carbamoyl-phosphate synthase arginine-specifi 98.28
PRK06278 476 cobyrinic acid a,c-diamide synthase; Validated 98.27
cd03131175 GATase1_HTS Type 1 glutamine amidotransferase (GAT 98.27
PRK12564360 carbamoyl phosphate synthase small subunit; Review 98.24
cd03146212 GAT1_Peptidase_E Type 1 glutamine amidotransferase 98.24
PRK14607 534 bifunctional glutamine amidotransferase/anthranila 98.23
PRK05665240 amidotransferase; Provisional 98.22
PRK01077451 cobyrinic acid a,c-diamide synthase; Validated 98.22
PRK09065237 glutamine amidotransferase; Provisional 98.19
TIGR00379449 cobB cobyrinic acid a,c-diamide synthase. This mod 98.16
cd01744178 GATase1_CPSase Small chain of the glutamine-depend 98.16
TIGR01815717 TrpE-clade3 anthranilate synthase, alpha proteobac 98.08
PF04204298 HTS: Homoserine O-succinyltransferase ; InterPro: 98.08
PRK00784488 cobyric acid synthase; Provisional 98.08
TIGR01823 742 PabB-fungal aminodeoxychorismate synthase, fungal 98.07
TIGR00888188 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N 98.07
KOG1224|consensus 767 98.06
KOG0026|consensus223 98.05
PRK07567242 glutamine amidotransferase; Provisional 98.02
PRK13566720 anthranilate synthase; Provisional 97.99
cd01653115 GATase1 Type 1 glutamine amidotransferase (GATase1 97.97
KOG3179|consensus245 97.91
PRK13896433 cobyrinic acid a,c-diamide synthase; Provisional 97.89
PLN02347 536 GMP synthetase 97.88
PRK11780217 isoprenoid biosynthesis protein with amidotransfer 97.88
TIGR01001300 metA homoserine O-succinyltransferase. The apparen 97.84
PF07685158 GATase_3: CobB/CobQ-like glutamine amidotransferas 97.84
cd01742181 GATase1_GMP_Synthase Type 1 glutamine amidotransfe 97.83
KOG0370|consensus 1435 97.83
cd0312892 GAT_1 Type 1 glutamine amidotransferase (GATase1)- 97.81
PRK11366254 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; 97.78
cd01746235 GATase1_CTP_Synthase Type 1 glutamine amidotransfe 97.7
PRK07053234 glutamine amidotransferase; Provisional 97.67
cd03133213 GATase1_ES1 Type 1 glutamine amidotransferase (GAT 97.65
PRK13170196 hisH imidazole glycerol phosphate synthase subunit 97.58
PRK05282233 (alpha)-aspartyl dipeptidase; Validated 97.49
TIGR00313475 cobQ cobyric acid synthase CobQ. 97.47
cd03147231 GATase1_Ydr533c_like Type 1 glutamine amidotransfe 97.47
PRK06490239 glutamine amidotransferase; Provisional 97.47
CHL00188210 hisH imidazole glycerol phosphate synthase subunit 97.46
cd03148232 GATase1_EcHsp31_like Type 1 glutamine amidotransfe 97.42
PRK04155287 chaperone protein HchA; Provisional 97.4
KOG1907|consensus1320 97.39
PRK00074 511 guaA GMP synthase; Reviewed 97.36
PRK13152201 hisH imidazole glycerol phosphate synthase subunit 97.34
COG2071243 Predicted glutamine amidotransferases [General fun 97.3
TIGR00337525 PyrG CTP synthase. CTP synthase is involved in pyr 97.29
KOG1622|consensus 552 97.27
PRK00758184 GMP synthase subunit A; Validated 97.27
PRK13142192 hisH imidazole glycerol phosphate synthase subunit 97.24
cd01745189 GATase1_2 Subgroup of proteins having the Type 1 g 97.23
PRK14004210 hisH imidazole glycerol phosphate synthase subunit 97.21
cd03144114 GATase1_ScBLP_like Type 1 glutamine amidotransfera 97.21
PF07722217 Peptidase_C26: Peptidase C26; InterPro: IPR011697 97.14
PRK05380533 pyrG CTP synthetase; Validated 97.12
TIGR01382166 PfpI intracellular protease, PfpI family. The memb 97.05
cd03129210 GAT1_Peptidase_E_like Type 1 glutamine amidotransf 97.04
COG0518198 GuaA GMP synthase - Glutamine amidotransferase dom 96.95
cd03134165 GATase1_PfpI_like A type 1 glutamine amidotransfer 96.92
COG0693188 ThiJ Putative intracellular protease/amidase [Gene 96.87
PRK13181199 hisH imidazole glycerol phosphate synthase subunit 96.85
PRK13527200 glutamine amidotransferase subunit PdxT; Provision 96.81
PRK11574196 oxidative-stress-resistance chaperone; Provisional 96.8
PF01965147 DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 T 96.79
cd03169180 GATase1_PfpI_1 Type 1 glutamine amidotransferase ( 96.78
PLN02327557 CTP synthase 96.74
cd03141221 GATase1_Hsp31_like Type 1 glutamine amidotransfera 96.69
PRK13525189 glutamine amidotransferase subunit PdxT; Provision 96.66
cd01747273 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidot 96.65
PRK08250235 glutamine amidotransferase; Provisional 96.64
cd03132142 GATase1_catalase Type 1 glutamine amidotransferase 96.58
cd01749183 GATase1_PB Glutamine Amidotransferase (GATase_I) i 96.56
COG1797451 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme 96.46
cd03137187 GATase1_AraC_1 AraC transcriptional regulators hav 96.44
cd01748198 GATase1_IGP_Synthase Type 1 glutamine amidotransfe 96.4
COG1492486 CobQ Cobyric acid synthase [Coenzyme metabolism] 96.4
PRK06186229 hypothetical protein; Validated 96.38
COG0118204 HisH Glutamine amidotransferase [Amino acid transp 96.33
TIGR01855196 IMP_synth_hisH imidazole glycerol phosphate syntha 96.29
COG1897307 MetA Homoserine trans-succinylase [Amino acid tran 96.25
cd01741188 GATase1_1 Subgroup of proteins having the Type 1 g 96.24
COG3442250 Predicted glutamine amidotransferase [General func 96.23
TIGR02069250 cyanophycinase cyanophycinase. This model describe 95.87
cd03140170 GATase1_PfpI_3 Type 1 glutamine amidotransferase ( 95.86
TIGR03800184 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, gl 95.85
PRK11249752 katE hydroperoxidase II; Provisional 95.72
PRK13141205 hisH imidazole glycerol phosphate synthase subunit 95.69
PF03575154 Peptidase_S51: Peptidase family S51; InterPro: IPR 95.67
cd03135163 GATase1_DJ-1 Type 1 glutamine amidotransferase (GA 95.67
PRK13146209 hisH imidazole glycerol phosphate synthase subunit 95.52
PRK13143200 hisH imidazole glycerol phosphate synthase subunit 95.46
PLN02617 538 imidazole glycerol phosphate synthase hisHF 95.46
cd03145217 GAT1_cyanophycinase Type 1 glutamine amidotransfer 95.42
cd03138195 GATase1_AraC_2 AraC transcriptional regulators hav 95.42
cd03139183 GATase1_PfpI_2 Type 1 glutamine amidotransferase ( 95.41
PRK05368302 homoserine O-succinyltransferase; Provisional 95.29
TIGR01383179 not_thiJ DJ-1 family protein. This model represent 95.13
PLN02832248 glutamine amidotransferase subunit of pyridoxal 5' 94.91
TIGR01737227 FGAM_synth_I phosphoribosylformylglycinamidine syn 94.67
KOG2764|consensus247 94.34
COG0504533 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide 94.04
cd01750194 GATase1_CobQ Type 1 glutamine amidotransferase (GA 93.89
cd03136185 GATase1_AraC_ArgR_like AraC transcriptional regula 93.84
PRK01175261 phosphoribosylformylglycinamidine synthase I; Prov 93.61
PF13278166 DUF4066: Putative amidotransferase; PDB: 3BHN_A 3M 93.11
PRK13526179 glutamine amidotransferase subunit PdxT; Provision 92.86
cd03130198 GATase1_CobB Type 1 glutamine amidotransferase (GA 92.83
PRK09393322 ftrA transcriptional activator FtrA; Provisional 92.58
COG3340224 PepE Peptidase E [Amino acid transport and metabol 92.48
PRK06278 476 cobyrinic acid a,c-diamide synthase; Validated 91.53
cd01740238 GATase1_FGAR_AT Type 1 glutamine amidotransferase 90.82
KOG2387|consensus585 90.34
PF09825367 BPL_N: Biotin-protein ligase, N terminal; InterPro 89.46
COG0047231 PurL Phosphoribosylformylglycinamidine (FGAM) synt 87.97
PF07685158 GATase_3: CobB/CobQ-like glutamine amidotransferas 87.47
COG1492486 CobQ Cobyric acid synthase [Coenzyme metabolism] 86.63
TIGR00313475 cobQ cobyric acid synthase CobQ. 83.97
PRK00784488 cobyric acid synthase; Provisional 83.84
TIGR02667163 moaB_proteo molybdenum cofactor biosynthesis prote 83.62
COG0303404 MoeA Molybdopterin biosynthesis enzyme [Coenzyme m 82.64
PRK03372306 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 82.3
PRK03619219 phosphoribosylformylglycinamidine synthase I; Prov 81.37
>cd01747 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase Back     alignment and domain information
Probab=100.00  E-value=4.6e-39  Score=291.93  Aligned_cols=225  Identities=42%  Similarity=0.725  Sum_probs=177.6

Q ss_pred             EEEeccccCCCCcccccCCCCccchHHHHHHHHHHcCCeEEEEEcCCChhHHHHhcCCCCEEEEcCCCCCCCCCCchhHH
Q psy12875         21 IGILAQEYTHIPSYVKAYPNYTSYIAASYVKNIEAAGARVVPILIGQDREYYAEILTQINGVVIPGGGTGFDHPNGYADA  100 (308)
Q Consensus        21 IGI~~~~~~~~~~~~~~~~~~~~~i~~~~~~~l~~aG~~~~~i~~~~~~~~~~~~l~~~dGlilpGG~~~~~~~~~~~~~  100 (308)
                      |||++++....    .......+|++++|+++++++|+++++++++.+.+.+++.++.+|||++|||+.+++.. .|.+.
T Consensus         1 igil~~~~~~~----~~~~~~~~yi~~~Yv~~l~~aG~~vvpi~~~~~~~~l~~~l~~~dG~l~~Gg~~~~~~~-~~~~~   75 (273)
T cd01747           1 IGILTQPVDGA----GSNKTGHSYIAASYVKFLESAGARVVPIWINESEEYYDKLFKSINGILFPGGAVDIDTS-GYART   75 (273)
T ss_pred             CeEEeeecCcc----ccccchhHHHHHHHHHHHHHCCCeEEEEEeCCcHHHHHHHHhhCCEEEECCCCCcCCcc-ccchH
Confidence            79999998651    11233568999999999999999999999886667788889999999999998777653 67777


Q ss_pred             HHHHHHHHHHHHHcCCCccEEEechhhhHHHHHhcCCcc-ccccccccccccceeeecCCCCcchhhhHhhhcCCCCeee
Q psy12875        101 GRQILHLVDKINEEGVTFPVLGVCLGFELILQVSNNDTD-FRKSCKVQQVNLNLKFLPGAKRSSLFSQINEEGVTFPVLG  179 (308)
Q Consensus       101 ~~~~~e~~~~~~~~g~~~PvlGIC~G~Qll~~~~~gg~~-~~~~~~~~~~~~~l~~~pg~~~~~~~~~i~~~~~~~PilG  179 (308)
                      .+.+++.+.+..++|+.+||||||+|||+|+.+ +||+. .+..++.++...                            
T Consensus        76 ~~~l~~~a~~~~~~g~~~Pv~GiClG~QlL~~~-~gg~~~~~~~~~~~~~~~----------------------------  126 (273)
T cd01747          76 AKIIYNLALERNDAGDYFPVWGTCLGFELLTYL-TSGETLLLEATEATNSAL----------------------------  126 (273)
T ss_pred             HHHHHHHHHHhhhcCCCCcEEEEcHHHHHHHHH-hCCCccccCCCccccceE----------------------------
Confidence            788889988888877789999999999999999 88863 212111111101                            


Q ss_pred             eehhHHHHHHHhCCcccccCCcccceeeecccccCCCCCCcCccCCChhHHHhhccCCceeeccceeeeeccccccC-CC
Q psy12875        180 VCLGFELILQVSNNDTDFRKSCKVQQVNLNLKFLPGAKRSSLFSQVPSKYIKKFYQKPLTHNNHIWCITRQDMIKYG-LT  258 (308)
Q Consensus       180 iClG~Qll~~~~G~~v~~~~~g~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~v~~~H~~~v~~~~~~~~~-l~  258 (308)
                                               .+.+    .+...+++||++++.++...+.+...++++|++++++.++.... |.
T Consensus       127 -------------------------~l~~----t~~~~~s~lF~~~p~~l~~~l~~~~~~~~~Hs~~v~~~~~~~~~~l~  177 (273)
T cd01747         127 -------------------------PLNF----TEDALQSRLFKRFPPDLLKSLATEPLTMNNHRYGISPENFTENGLLS  177 (273)
T ss_pred             -------------------------EEEE----ccccccChhhhcCCHHHHHHHhcccHHHhhcccccCHhhcccccccc
Confidence                                     1111    11124688999999988888888888999999999877764322 66


Q ss_pred             CCeEEEEEecC-CCceEEEEEEecCCCEEEEeecCCccCcccCCCCCCCCC
Q psy12875        259 ETWNILTLSKY-KSWEFVSTVEHKEYPIVGIQFHPEKNAYEWTESQHNPHS  308 (308)
Q Consensus       259 ~~~~via~s~~-~~~~~v~ai~~~~~p~~GvQFHPE~~~~~~~~~~~~~~~  308 (308)
                      +.+++++++.+ ++.+||++++++++|+||+|||||++.+||+....+|||
T Consensus       178 ~~~~vla~~~d~~g~~fis~ie~~~~pi~gvQFHPEks~few~~~~~~~hs  228 (273)
T cd01747         178 DFFNVLTTNDDWNGVEFISTVEAYKYPIYGVQWHPEKNAFEWKKSSSIPHS  228 (273)
T ss_pred             cceEEEEEEecCCCceEEEEEEecCCceEEEecCCCcccccccccCCCCCC
Confidence            78899998754 567899999999999999999999999999998789996



Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase. gamma-Glutamyl Hydrolase catalyzes the cleavage of the gamma-glutamyl chain of folylpoly-gamma-glutamyl substrates and is a central enzyme in folyl and antifolyl poly-gamma-glutamate metabolism. GATase activity involves the removal of the ammonia group from a glutamate molecule and its subsequent transfer to a specific substrate, thus creating a new carbon-nitrogen group on the substrate. gamma-Glutamyl hydrolases belong to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site.

>KOG1559|consensus Back     alignment and domain information
>PF07722 Peptidase_C26: Peptidase C26; InterPro: IPR011697 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG2071 Predicted glutamine amidotransferases [General function prediction only] Back     alignment and domain information
>PRK11366 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; Provisional Back     alignment and domain information
>COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK06895 putative anthranilate synthase component II; Provisional Back     alignment and domain information
>cd01743 GATase1_Anthranilate_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase Back     alignment and domain information
>PRK08007 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>TIGR00566 trpG_papA glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase Back     alignment and domain information
>PRK08857 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK07765 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK07649 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated Back     alignment and domain information
>COG0118 HisH Glutamine amidotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00888 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit Back     alignment and domain information
>PRK05670 anthranilate synthase component II; Provisional Back     alignment and domain information
>cd01745 GATase1_2 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>CHL00101 trpG anthranilate synthase component 2 Back     alignment and domain information
>cd01742 GATase1_GMP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase Back     alignment and domain information
>PRK06774 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK05637 anthranilate synthase component II; Provisional Back     alignment and domain information
>cd01744 GATase1_CPSase Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II Back     alignment and domain information
>PRK00758 GMP synthase subunit A; Validated Back     alignment and domain information
>PLN02335 anthranilate synthase Back     alignment and domain information
>PF00117 GATase: Glutamine amidotransferase class-I; InterPro: IPR017926 Glutamine amidotransferase (GATase) enzymes catalyse the removal of the ammonia group from glutamine and then transfer this group to a substrate to form a new carbon-nitrogen group [] Back     alignment and domain information
>PRK09065 glutamine amidotransferase; Provisional Back     alignment and domain information
>PLN02347 GMP synthetase Back     alignment and domain information
>PRK05665 amidotransferase; Provisional Back     alignment and domain information
>COG0518 GuaA GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12564 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>PRK00074 guaA GMP synthase; Reviewed Back     alignment and domain information
>CHL00188 hisH imidazole glycerol phosphate synthase subunit hisH; Provisional Back     alignment and domain information
>TIGR01368 CPSaseIIsmall carbamoyl-phosphate synthase, small subunit Back     alignment and domain information
>PRK07567 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK13566 anthranilate synthase; Provisional Back     alignment and domain information
>PRK06490 glutamine amidotransferase; Provisional Back     alignment and domain information
>cd01741 GATase1_1 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>TIGR01815 TrpE-clade3 anthranilate synthase, alpha proteobacterial clade Back     alignment and domain information
>PRK07053 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK14607 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK09522 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>cd01748 GATase1_IGP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS) Back     alignment and domain information
>PLN02889 oxo-acid-lyase/anthranilate synthase Back     alignment and domain information
>cd01746 GATase1_CTP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase Back     alignment and domain information
>PRK12838 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>PRK13525 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>PRK13170 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK08250 glutamine amidotransferase; Provisional Back     alignment and domain information
>PLN02771 carbamoyl-phosphate synthase (glutamine-hydrolyzing) Back     alignment and domain information
>PRK13181 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>CHL00197 carA carbamoyl-phosphate synthase arginine-specific small subunit; Provisional Back     alignment and domain information
>PRK14004 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13527 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>PRK06186 hypothetical protein; Validated Back     alignment and domain information
>KOG0026|consensus Back     alignment and domain information
>PRK13152 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>COG0505 CarA Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13143 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13141 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>TIGR01855 IMP_synth_hisH imidazole glycerol phosphate synthase, glutamine amidotransferase subunit Back     alignment and domain information
>TIGR01823 PabB-fungal aminodeoxychorismate synthase, fungal clade Back     alignment and domain information
>PRK13142 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>TIGR00337 PyrG CTP synthase Back     alignment and domain information
>cd01749 GATase1_PB Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis Back     alignment and domain information
>PRK05380 pyrG CTP synthetase; Validated Back     alignment and domain information
>PLN02327 CTP synthase Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>TIGR03800 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2 Back     alignment and domain information
>COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02832 glutamine amidotransferase subunit of pyridoxal 5'-phosphate synthase complex Back     alignment and domain information
>KOG3179|consensus Back     alignment and domain information
>TIGR01737 FGAM_synth_I phosphoribosylformylglycinamidine synthase I Back     alignment and domain information
>KOG1622|consensus Back     alignment and domain information
>KOG1224|consensus Back     alignment and domain information
>KOG2387|consensus Back     alignment and domain information
>PRK05368 homoserine O-succinyltransferase; Provisional Back     alignment and domain information
>PRK03619 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>KOG0623|consensus Back     alignment and domain information
>KOG0370|consensus Back     alignment and domain information
>COG0047 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13526 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>PRK01175 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>cd01740 GATase1_FGAR_AT Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase Back     alignment and domain information
>COG0311 PDX2 Predicted glutamine amidotransferase involved in pyridoxine biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF01174 SNO: SNO glutamine amidotransferase family; InterPro: IPR002161 Members of this family are involved in the pyridoxine biosynthetic pathway [, ] Back     alignment and domain information
>COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PF13507 GATase_5: CobB/CobQ-like glutamine amidotransferase domain; PDB: 3D54_L 3UMM_A 3UJN_A 3UGJ_A 1T3T_A Back     alignment and domain information
>PRK08007 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>cd03130 GATase1_CobB Type 1 glutamine amidotransferase (GATase1) domain found in Cobyrinic Acid a,c-Diamide Synthase Back     alignment and domain information
>TIGR01857 FGAM-synthase phosphoribosylformylglycinamidine synthase, clade II Back     alignment and domain information
>TIGR01735 FGAM_synt phosphoribosylformylglycinamidine synthase, single chain form Back     alignment and domain information
>PRK05297 phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>PLN03206 phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>PRK07649 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated Back     alignment and domain information
>PRK06774 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>COG0505 CarA Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>KOG3210|consensus Back     alignment and domain information
>TIGR00566 trpG_papA glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase Back     alignment and domain information
>cd01750 GATase1_CobQ Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ) Back     alignment and domain information
>CHL00101 trpG anthranilate synthase component 2 Back     alignment and domain information
>PRK08857 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PLN02335 anthranilate synthase Back     alignment and domain information
>PHA03366 FGAM-synthase; Provisional Back     alignment and domain information
>PLN02771 carbamoyl-phosphate synthase (glutamine-hydrolyzing) Back     alignment and domain information
>PRK06895 putative anthranilate synthase component II; Provisional Back     alignment and domain information
>PRK05670 anthranilate synthase component II; Provisional Back     alignment and domain information
>TIGR01739 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM-synthase Back     alignment and domain information
>PRK07765 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK09522 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK05637 anthranilate synthase component II; Provisional Back     alignment and domain information
>TIGR01368 CPSaseIIsmall carbamoyl-phosphate synthase, small subunit Back     alignment and domain information
>PLN02889 oxo-acid-lyase/anthranilate synthase Back     alignment and domain information
>PRK12838 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>cd01743 GATase1_Anthranilate_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase Back     alignment and domain information
>PF00117 GATase: Glutamine amidotransferase class-I; InterPro: IPR017926 Glutamine amidotransferase (GATase) enzymes catalyse the removal of the ammonia group from glutamine and then transfer this group to a substrate to form a new carbon-nitrogen group [] Back     alignment and domain information
>CHL00197 carA carbamoyl-phosphate synthase arginine-specific small subunit; Provisional Back     alignment and domain information
>PRK06278 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>cd03131 GATase1_HTS Type 1 glutamine amidotransferase (GATase1)-like domain found in homoserine trans-succinylase (HTS) Back     alignment and domain information
>PRK12564 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>cd03146 GAT1_Peptidase_E Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E Back     alignment and domain information
>PRK14607 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK05665 amidotransferase; Provisional Back     alignment and domain information
>PRK01077 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>PRK09065 glutamine amidotransferase; Provisional Back     alignment and domain information
>TIGR00379 cobB cobyrinic acid a,c-diamide synthase Back     alignment and domain information
>cd01744 GATase1_CPSase Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II Back     alignment and domain information
>TIGR01815 TrpE-clade3 anthranilate synthase, alpha proteobacterial clade Back     alignment and domain information
>PF04204 HTS: Homoserine O-succinyltransferase ; InterPro: IPR005697 This family of enzymes, homoserine O-succinyltransferase, catalyses the first step in the biosynthesis of methionine: Succinyl-CoA + L-homoserine = CoA + O-succinyl-L-homoserine This enzyme is consequently essential for the survival of bacteria, plants and fungi Back     alignment and domain information
>PRK00784 cobyric acid synthase; Provisional Back     alignment and domain information
>TIGR01823 PabB-fungal aminodeoxychorismate synthase, fungal clade Back     alignment and domain information
>TIGR00888 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit Back     alignment and domain information
>KOG1224|consensus Back     alignment and domain information
>KOG0026|consensus Back     alignment and domain information
>PRK07567 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK13566 anthranilate synthase; Provisional Back     alignment and domain information
>cd01653 GATase1 Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>KOG3179|consensus Back     alignment and domain information
>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional Back     alignment and domain information
>PLN02347 GMP synthetase Back     alignment and domain information
>PRK11780 isoprenoid biosynthesis protein with amidotransferase-like domain; Provisional Back     alignment and domain information
>TIGR01001 metA homoserine O-succinyltransferase Back     alignment and domain information
>PF07685 GATase_3: CobB/CobQ-like glutamine amidotransferase domain; InterPro: IPR011698 This group of enzymes was suggested to be related to the MinD family of ATPases involved in regulation of cell division in bacteria and archaea [] Back     alignment and domain information
>cd01742 GATase1_GMP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase Back     alignment and domain information
>KOG0370|consensus Back     alignment and domain information
>cd03128 GAT_1 Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>PRK11366 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; Provisional Back     alignment and domain information
>cd01746 GATase1_CTP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase Back     alignment and domain information
>PRK07053 glutamine amidotransferase; Provisional Back     alignment and domain information
>cd03133 GATase1_ES1 Type 1 glutamine amidotransferase (GATase1)-like domain found in zebrafish ES1 Back     alignment and domain information
>PRK13170 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK05282 (alpha)-aspartyl dipeptidase; Validated Back     alignment and domain information
>TIGR00313 cobQ cobyric acid synthase CobQ Back     alignment and domain information
>cd03147 GATase1_Ydr533c_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Saccharomyces cerevisiae Ydr533c protein Back     alignment and domain information
>PRK06490 glutamine amidotransferase; Provisional Back     alignment and domain information
>CHL00188 hisH imidazole glycerol phosphate synthase subunit hisH; Provisional Back     alignment and domain information
>cd03148 GATase1_EcHsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Escherichia coli Hsp31 protein (EcHsp31) Back     alignment and domain information
>PRK04155 chaperone protein HchA; Provisional Back     alignment and domain information
>KOG1907|consensus Back     alignment and domain information
>PRK00074 guaA GMP synthase; Reviewed Back     alignment and domain information
>PRK13152 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>COG2071 Predicted glutamine amidotransferases [General function prediction only] Back     alignment and domain information
>TIGR00337 PyrG CTP synthase Back     alignment and domain information
>KOG1622|consensus Back     alignment and domain information
>PRK00758 GMP synthase subunit A; Validated Back     alignment and domain information
>PRK13142 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>cd01745 GATase1_2 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>PRK14004 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>cd03144 GATase1_ScBLP_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Saccharomyces cerevisiae biotin-apoprotein ligase (ScBLP) Back     alignment and domain information
>PF07722 Peptidase_C26: Peptidase C26; InterPro: IPR011697 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK05380 pyrG CTP synthetase; Validated Back     alignment and domain information
>TIGR01382 PfpI intracellular protease, PfpI family Back     alignment and domain information
>cd03129 GAT1_Peptidase_E_like Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E_like proteins Back     alignment and domain information
>COG0518 GuaA GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03134 GATase1_PfpI_like A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus Back     alignment and domain information
>COG0693 ThiJ Putative intracellular protease/amidase [General function prediction only] Back     alignment and domain information
>PRK13181 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13527 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>PRK11574 oxidative-stress-resistance chaperone; Provisional Back     alignment and domain information
>PF01965 DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 This signature defines a diverse group of protein families which include proteins involved in RNA-protein interaction regulation, thiamine biosynthesis, Ras-related signal transduction, and those with protease activity Back     alignment and domain information
>cd03169 GATase1_PfpI_1 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>PLN02327 CTP synthase Back     alignment and domain information
>cd03141 GATase1_Hsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein Back     alignment and domain information
>PRK13525 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>cd01747 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase Back     alignment and domain information
>PRK08250 glutamine amidotransferase; Provisional Back     alignment and domain information
>cd03132 GATase1_catalase Type 1 glutamine amidotransferase (GATase1)-like domain found in at the C-terminal of several large catalases Back     alignment and domain information
>cd01749 GATase1_PB Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis Back     alignment and domain information
>COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] Back     alignment and domain information
>cd03137 GATase1_AraC_1 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>cd01748 GATase1_IGP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS) Back     alignment and domain information
>COG1492 CobQ Cobyric acid synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK06186 hypothetical protein; Validated Back     alignment and domain information
>COG0118 HisH Glutamine amidotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01855 IMP_synth_hisH imidazole glycerol phosphate synthase, glutamine amidotransferase subunit Back     alignment and domain information
>COG1897 MetA Homoserine trans-succinylase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01741 GATase1_1 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>COG3442 Predicted glutamine amidotransferase [General function prediction only] Back     alignment and domain information
>TIGR02069 cyanophycinase cyanophycinase Back     alignment and domain information
>cd03140 GATase1_PfpI_3 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>TIGR03800 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2 Back     alignment and domain information
>PRK11249 katE hydroperoxidase II; Provisional Back     alignment and domain information
>PRK13141 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PF03575 Peptidase_S51: Peptidase family S51; InterPro: IPR005320 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd03135 GATase1_DJ-1 Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1 Back     alignment and domain information
>PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13143 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>cd03145 GAT1_cyanophycinase Type 1 glutamine amidotransferase (GATase1)-like domain found in cyanophycinase Back     alignment and domain information
>cd03138 GATase1_AraC_2 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>cd03139 GATase1_PfpI_2 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>PRK05368 homoserine O-succinyltransferase; Provisional Back     alignment and domain information
>TIGR01383 not_thiJ DJ-1 family protein Back     alignment and domain information
>PLN02832 glutamine amidotransferase subunit of pyridoxal 5'-phosphate synthase complex Back     alignment and domain information
>TIGR01737 FGAM_synth_I phosphoribosylformylglycinamidine synthase I Back     alignment and domain information
>KOG2764|consensus Back     alignment and domain information
>COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01750 GATase1_CobQ Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ) Back     alignment and domain information
>cd03136 GATase1_AraC_ArgR_like AraC transcriptional regulators having an N-terminal Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>PRK01175 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>PF13278 DUF4066: Putative amidotransferase; PDB: 3BHN_A 3MGK_B 3NOV_A 3NON_B 3NOO_B 3NOQ_A 3NOR_A 3GRA_A 3EWN_A 3ER6_C Back     alignment and domain information
>PRK13526 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>cd03130 GATase1_CobB Type 1 glutamine amidotransferase (GATase1) domain found in Cobyrinic Acid a,c-Diamide Synthase Back     alignment and domain information
>PRK09393 ftrA transcriptional activator FtrA; Provisional Back     alignment and domain information
>COG3340 PepE Peptidase E [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06278 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>cd01740 GATase1_FGAR_AT Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase Back     alignment and domain information
>KOG2387|consensus Back     alignment and domain information
>PF09825 BPL_N: Biotin-protein ligase, N terminal; InterPro: IPR019197 The function of this structural domain is unknown Back     alignment and domain information
>COG0047 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>PF07685 GATase_3: CobB/CobQ-like glutamine amidotransferase domain; InterPro: IPR011698 This group of enzymes was suggested to be related to the MinD family of ATPases involved in regulation of cell division in bacteria and archaea [] Back     alignment and domain information
>COG1492 CobQ Cobyric acid synthase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00313 cobQ cobyric acid synthase CobQ Back     alignment and domain information
>PRK00784 cobyric acid synthase; Provisional Back     alignment and domain information
>TIGR02667 moaB_proteo molybdenum cofactor biosynthesis protein B, proteobacterial Back     alignment and domain information
>COG0303 MoeA Molybdopterin biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>PRK03372 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK03619 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query308
1l9x_A315 Structure Of Gamma-Glutamyl Hydrolase Length = 315 5e-25
>pdb|1L9X|A Chain A, Structure Of Gamma-Glutamyl Hydrolase Length = 315 Back     alignment and structure

Iteration: 1

Score = 111 bits (277), Expect = 5e-25, Method: Compositional matrix adjust. Identities = 84/288 (29%), Positives = 128/288 (44%), Gaps = 68/288 (23%) Query: 15 STDTPVIGILAQEYTHIPSYVKAYPNYTSYIAASYVKNIEAAGARVVPILIGQDREYYAE 74 + P+IGIL Q+ + +K Y Y YIAASYVK +E+AGARVVP+ + + Y Sbjct: 27 TAKKPIIGILMQKCRN--KVMKNYGRY--YIAASYVKYLESAGARVVPVRLDLTEKDYEI 82 Query: 75 ILTQINGVVIPGGGTGFDHPNGYADAGRQILHLVDKINEEGVTFPVLGVCLGFELILQVS 134 + ING++ PGG Sbjct: 83 LFKSINGILFPGG----------------------------------------------- 95 Query: 135 NNDTDFRKS--CKVQQVNLNLKFLPGAKRSSLFSQINEEGVTFPVLGVCLGFELILQVSN 192 D R+S KV ++ NL Q ++G FPV G CLGFE + + + Sbjct: 96 --SVDLRRSDYAKVAKIFYNLSI-----------QSFDDGDYFPVWGTCLGFEELSLLIS 142 Query: 193 NDTDFRKSCKVQQVNLNLKFLPGAKRSSLFSQVPSKYIKKFYQKPLTHNNHIWCITRQDM 252 + + V V + L F G S +F P++ + +PLT N H W ++ ++ Sbjct: 143 GECLLTATDTVD-VAMPLNFTGGQLHSRMFQNFPTELLLSLAVEPLTANFHKWSLSVKNF 201 Query: 253 -IKYGLTETWNILTLSKYKSWEFVSTVEHKEYPIVGIQFHPEKNAYEW 299 + L + +N+LT + EF+ST+E +YP+ G+Q+HPEK YEW Sbjct: 202 TMNEKLKKFFNVLTTNTDGKIEFISTMEGYKYPVYGVQWHPEKAPYEW 249

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query308
1l9x_A315 Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCO 2e-39
3fij_A254 LIN1909 protein; 11172J, uncharacterized protein, 4e-10
1qdl_B195 Protein (anthranilate synthase (TRPG-SUBUNIT)); tr 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
2ywj_A186 Glutamine amidotransferase subunit PDXT; uncharact 2e-04
1i1q_B192 Anthranilate synthase component II; tryptophan bio 2e-04
>1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1 Length = 315 Back     alignment and structure
 Score =  139 bits (351), Expect = 2e-39
 Identities = 75/291 (25%), Positives = 113/291 (38%), Gaps = 64/291 (21%)

Query: 19  PVIGILAQEYTHIPSYVKAYPNY-TSYIAASYVKNIEAAGARVVPILIGQDREYYAEILT 77
           P+IGIL Q         K   NY   YIAASYVK +E+AGARVVP+ +    + Y  +  
Sbjct: 31  PIIGILMQ-----KCRNKVMKNYGRYYIAASYVKYLESAGARVVPVRLDLTEKDYEILFK 85

Query: 78  QINGVVIPGGGTGFDHPNGYADAGRQILHLVDKINEEGVTFPVLGVCLGFELILQVSNND 137
            ING++ PGG       + YA   +   +L  +  ++G  FPV G CLGFE +  + +  
Sbjct: 86  SINGILFPGGSVDLR-RSDYAKVAKIFYNLSIQSFDDGDYFPVWGTCLGFEELSLLISG- 143

Query: 138 TDFRKSCKVQQVNLNLKFLPGAKRSSLFSQINEEGVTFPVLGVCLGFELILQVSNNDTDF 197
                +     V + L F  G   S +F                                
Sbjct: 144 ECLLTATDTVDVAMPLNFTGGQLHSRMFQNFP---------------------------- 175

Query: 198 RKSCKVQQVNLNLKFLPGAKRSSLFSQVPSKYIKKFYQKPLTHNNHIWCITRQDMIKYGL 257
                                + L   +  + +   +     H   +         K  L
Sbjct: 176 ---------------------TELLLSLAVEPLTANF-----HKWSLSVKNFTMNEK--L 207

Query: 258 TETWNILTLSKYKSWEFVSTVEHKEYPIVGIQFHPEKNAYEWTESQHNPHS 308
            + +N+LT +     EF+ST+E  +YP+ G+Q+HPEK  YEW       H+
Sbjct: 208 KKFFNVLTTNTDGKIEFISTMEGYKYPVYGVQWHPEKAPYEWKNLDGISHA 258


>3fij_A LIN1909 protein; 11172J, uncharacterized protein, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.30A {Listeria innocua} Length = 254 Back     alignment and structure
>1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1 Length = 195 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ywj_A Glutamine amidotransferase subunit PDXT; uncharacterized conserved protein, structural genomics; 1.90A {Methanocaldococcus jannaschii} Length = 186 Back     alignment and structure
>1i1q_B Anthranilate synthase component II; tryptophan biosynthesis, lyase; HET: TRP; 1.90A {Salmonella typhimurium} SCOP: c.23.16.1 PDB: 1i7q_B 1i7s_B* Length = 192 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query308
1l9x_A315 Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCO 100.0
3fij_A254 LIN1909 protein; 11172J, uncharacterized protein, 99.98
1qdl_B195 Protein (anthranilate synthase (TRPG-SUBUNIT)); tr 99.94
2a9v_A212 GMP synthase; structural genomics, joint center fo 99.93
1wl8_A189 GMP synthase [glutamine-hydrolyzing] subunit A; tr 99.93
1i1q_B192 Anthranilate synthase component II; tryptophan bio 99.92
1o1y_A239 Conserved hypothetical protein TM1158; flavodoxin- 99.92
2vpi_A218 GMP synthase; guanine monophosphate synthetase, ph 99.92
1gpm_A 525 GMP synthetase, XMP aminase; class I glutamine ami 99.91
3m3p_A250 Glutamine amido transferase; structural genomics, 99.91
4gud_A211 Imidazole glycerol phosphate synthase subunit His; 99.91
3uow_A 556 GMP synthetase; structural genomics consortium, SG 99.91
3tqi_A 527 GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 99.9
2ywb_A 503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 99.9
1a9x_B379 Carbamoyl phosphate synthetase (small chain); amid 99.9
3l7n_A236 Putative uncharacterized protein; glutamine amidot 99.9
2ywd_A191 Glutamine amidotransferase subunit PDXT; pyridoxin 99.89
2w7t_A273 CTP synthetase, putative cytidine triphosphate syn 99.88
2vxo_A 697 GMP synthase [glutamine-hydrolyzing]; proto-oncoge 99.87
3r75_A645 Anthranilate/para-aminobenzoate synthases compone; 99.87
2ywj_A186 Glutamine amidotransferase subunit PDXT; uncharact 99.86
2v4u_A289 CTP synthase 2; pyrimidine biosynthesis, glutamine 99.84
3d54_D213 Phosphoribosylformylglycinamidine synthase 1; alph 99.84
1gpw_B201 Amidotransferase HISH; lyase/transferase, complex 99.84
1q7r_A219 Predicted amidotransferase; structural genomics, Y 99.84
1ka9_H200 Imidazole glycerol phosphtate synthase; riken stru 99.83
2nv0_A196 Glutamine amidotransferase subunit PDXT; 3-layer(A 99.82
2iss_D208 Glutamine amidotransferase subunit PDXT; (beta/alp 99.81
3nva_A535 CTP synthase; rossman fold, nucleotide binding, LI 99.81
1vco_A550 CTP synthetase; tetramer, riken structural genomic 99.81
2abw_A227 PDX2 protein, glutaminase; PLP-synthase, vitamin B 99.8
1jvn_A 555 Glutamine, bifunctional histidine biosynthesis pro 99.8
1s1m_A545 CTP synthase; CTP synthetase, UTP:ammonia ligase ( 99.78
2vdj_A301 Homoserine O-succinyltransferase; methionine biosy 99.66
2h2w_A312 Homoserine O-succinyltransferase; TM0881, (EC 2.3. 99.64
3ugj_A1303 Phosphoribosylformylglycinamidine synthase; amidot 99.25
3l4e_A206 Uncharacterized peptidase LMO0363; hypothetical pr 98.65
1i1q_B192 Anthranilate synthase component II; tryptophan bio 98.48
1fy2_A229 Aspartyl dipeptidase; serine protease, catalytic t 98.41
1a9x_B379 Carbamoyl phosphate synthetase (small chain); amid 98.33
1qdl_B195 Protein (anthranilate synthase (TRPG-SUBUNIT)); tr 98.31
3l7n_A236 Putative uncharacterized protein; glutamine amidot 98.21
1o1y_A239 Conserved hypothetical protein TM1158; flavodoxin- 98.05
3r75_A645 Anthranilate/para-aminobenzoate synthases compone; 98.04
3m3p_A250 Glutamine amido transferase; structural genomics, 97.96
1wl8_A189 GMP synthase [glutamine-hydrolyzing] subunit A; tr 97.96
1oi4_A193 Hypothetical protein YHBO; PFPI/THIJ family, compl 97.92
2w7t_A273 CTP synthetase, putative cytidine triphosphate syn 97.9
2a9v_A212 GMP synthase; structural genomics, joint center fo 97.9
3fij_A254 LIN1909 protein; 11172J, uncharacterized protein, 97.89
4gud_A211 Imidazole glycerol phosphate synthase subunit His; 97.81
1s1m_A545 CTP synthase; CTP synthetase, UTP:ammonia ligase ( 97.8
1vco_A550 CTP synthetase; tetramer, riken structural genomic 97.78
2v4u_A289 CTP synthase 2; pyrimidine biosynthesis, glutamine 97.78
3tqi_A 527 GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 97.76
2ywj_A186 Glutamine amidotransferase subunit PDXT; uncharact 97.7
4hcj_A177 THIJ/PFPI domain protein; structural genomics, PSI 97.7
3l3b_A242 ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, 97.7
3uow_A 556 GMP synthetase; structural genomics consortium, SG 97.68
1gpm_A 525 GMP synthetase, XMP aminase; class I glutamine ami 97.68
2vpi_A218 GMP synthase; guanine monophosphate synthetase, ph 97.62
2ywb_A 503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 97.62
1vhq_A232 Enhancing lycopene biosynthesis protein 2; structu 97.59
2rk3_A197 Protein DJ-1; parkinson'S disease, THIJ, PFPI, cha 97.57
1l9x_A315 Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCO 97.56
2vxo_A 697 GMP synthase [glutamine-hydrolyzing]; proto-oncoge 97.55
3l18_A168 Intracellular protease I; gatase1_PFPI_LIKE, hydro 97.47
2ab0_A205 YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase 97.43
3ej6_A688 Catalase-3; heme, hydrogen iron, metal-binding, ox 97.39
4e08_A190 DJ-1 beta; flavodoxin-like fold, stress response, 97.39
3ttv_A753 Catalase HPII; heme orientation, oxidoreductase; H 97.39
1gpw_B201 Amidotransferase HISH; lyase/transferase, complex 97.38
3nva_A535 CTP synthase; rossman fold, nucleotide binding, LI 97.37
2vrn_A190 Protease I, DR1199; cysteine sulfenic acid, DJ-1/T 97.3
3ot1_A208 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate 97.14
1ka9_H200 Imidazole glycerol phosphtate synthase; riken stru 96.99
2ywd_A191 Glutamine amidotransferase subunit PDXT; pyridoxin 96.98
3efe_A212 THIJ/PFPI family protein; structural GEN csgid, ce 96.97
1q7r_A219 Predicted amidotransferase; structural genomics, Y 96.95
3uk7_A396 Class I glutamine amidotransferase-like domain-CO 96.91
3n7t_A247 Macrophage binding protein; seattle structural gen 96.91
3f5d_A206 Protein YDEA; unknow protein, PSI-II, nysgrc, stru 96.88
3cne_A175 Putative protease I; structural genomics, PSI-2, M 96.86
2nv0_A196 Glutamine amidotransferase subunit PDXT; 3-layer(A 96.85
3kkl_A244 Probable chaperone protein HSP33; peptidase, heat 96.82
2iss_D208 Glutamine amidotransferase subunit PDXT; (beta/alp 96.81
2abw_A227 PDX2 protein, glutaminase; PLP-synthase, vitamin B 96.78
3uk7_A396 Class I glutamine amidotransferase-like domain-CO 96.62
3en0_A291 Cyanophycinase; serine protease, beta peptide spec 96.6
2iuf_A688 Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Pen 96.54
1n57_A291 Chaperone HSP31, protein YEDU; alpha-beta sandwich 96.34
1sy7_A715 Catalase 1; heme oxidation, singlet oxygen, oxidor 96.21
1u9c_A224 APC35852; structural genomics, protein structure i 96.17
2fex_A188 Conserved hypothetical protein; structural genomic 96.15
3er6_A209 Putative transcriptional regulator protein; struct 96.07
3ewn_A253 THIJ/PFPI family protein; monomer, PSI nysgrc, str 96.07
1jvn_A 555 Glutamine, bifunctional histidine biosynthesis pro 96.01
4gdh_A194 DJ-1, uncharacterized protein C22E12.03C; unknown 95.94
3gra_A202 Transcriptional regulator, ARAC family; transcript 95.82
1rw7_A243 YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI supe 95.79
3d54_D213 Phosphoribosylformylglycinamidine synthase 1; alph 95.53
2vdj_A301 Homoserine O-succinyltransferase; methionine biosy 95.22
3noq_A231 THIJ/PFPI family protein; DJ-1 superfamily, isocya 95.16
2h2w_A312 Homoserine O-succinyltransferase; TM0881, (EC 2.3. 95.13
3mgk_A211 Intracellular protease/amidase related enzyme (THI 95.08
3fse_A365 Two-domain protein containing DJ-1/THIJ/PFPI-like 94.49
3bhn_A236 THIJ/PFPI domain protein; structural genomics, joi 88.53
3pzy_A164 MOG; ssgcid, seattle structural genomics center fo 86.7
2pjk_A178 178AA long hypothetical molybdenum cofactor biosyn 86.39
1fy2_A229 Aspartyl dipeptidase; serine protease, catalytic t 84.93
3l4e_A206 Uncharacterized peptidase LMO0363; hypothetical pr 83.63
3ugj_A1303 Phosphoribosylformylglycinamidine synthase; amidot 83.34
>1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1 Back     alignment and structure
Probab=100.00  E-value=1.4e-35  Score=274.05  Aligned_cols=229  Identities=32%  Similarity=0.581  Sum_probs=169.5

Q ss_pred             CCCCEEEEeccccCCCCcccccCCCCccchHHHHHHHHHHcCCeEEEEEcCCChhHHHHhcCCCCEEEEcCCCCCCCCCC
Q psy12875         16 TDTPVIGILAQEYTHIPSYVKAYPNYTSYIAASYVKNIEAAGARVVPILIGQDREYYAEILTQINGVVIPGGGTGFDHPN   95 (308)
Q Consensus        16 ~~~P~IGI~~~~~~~~~~~~~~~~~~~~~i~~~~~~~l~~aG~~~~~i~~~~~~~~~~~~l~~~dGlilpGG~~~~~~~~   95 (308)
                      +.||+|||++......    .......+|+.++|+++|+++|+.+++++.+.+.+.++..++++||||||||+.++++. 
T Consensus        28 ~~~P~IGI~~~~~~~~----~~~~~~~~~~~~~~~~~l~~~G~~~~vv~~~~~~~~i~~~l~~~dglil~GG~~~v~p~-  102 (315)
T 1l9x_A           28 AKKPIIGILMQKCRNK----VMKNYGRYYIAASYVKYLESAGARVVPVRLDLTEKDYEILFKSINGILFPGGSVDLRRS-  102 (315)
T ss_dssp             CCCCEEEEECEECCSH----HHHTTCSEEEEHHHHHHHHHTTCEEEEECSSCCHHHHHHHHHHSSEEEECCCCCCTTTC-
T ss_pred             CCCCEEEEECCccccc----ccccCcceehHHHHHHHHHHCCCEEEEEecCCCHHHHHHHHhcCCEEEEeCCCcccChh-
Confidence            4589999999865420    01111356888999999999999999999877666666667889999999998777763 


Q ss_pred             chhHHHHHHHHHHHHHHHcCCCccEEEechhhhHHHHHhcCCccccccccccccccceeeecCCCCcchhhhHhhhcCCC
Q psy12875         96 GYADAGRQILHLVDKINEEGVTFPVLGVCLGFELILQVSNNDTDFRKSCKVQQVNLNLKFLPGAKRSSLFSQINEEGVTF  175 (308)
Q Consensus        96 ~~~~~~~~~~e~~~~~~~~g~~~PvlGIC~G~Qll~~~~~gg~~~~~~~~~~~~~~~l~~~pg~~~~~~~~~i~~~~~~~  175 (308)
                      .|.+..+.+++.++++.++++++||||||+|||+|+.+ +||+........      .+.                  ..
T Consensus       103 ~~~~~~~~l~~~~~~~~~~g~~~PiLGIC~G~Qll~~a-~GG~~~~~~~~~------~g~------------------~~  157 (315)
T 1l9x_A          103 DYAKVAKIFYNLSIQSFDDGDYFPVWGTCLGFEELSLL-ISGECLLTATDT------VDV------------------AM  157 (315)
T ss_dssp             HHHHHHHHHHHHHHHHHHTTCCCCEEEETHHHHHHHHH-HHSSCCCEEEEE------EEE------------------EE
T ss_pred             hhhHHHHHHHHHHHHHHhcCCCceEEEEChHHHHHHHH-hCCccccccccc------cCC------------------CC
Confidence            57666667788888877654359999999999999999 899753211100      000                  00


Q ss_pred             CeeeeehhHHHHHHHhCCcccccCCcccceeeecccccCCCCCCcCccCCChhHHHhhccCCceeeccceeeeecccccc
Q psy12875        176 PVLGVCLGFELILQVSNNDTDFRKSCKVQQVNLNLKFLPGAKRSSLFSQVPSKYIKKFYQKPLTHNNHIWCITRQDMIKY  255 (308)
Q Consensus       176 PilGiClG~Qll~~~~G~~v~~~~~g~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~v~~~H~~~v~~~~~~~~  255 (308)
                                        .+             +.  ....++++||+.++..+...+++...++++|+++|+++++...
T Consensus       158 ------------------p~-------------~~--~~~~~~s~L~~~~~~~~~~~l~~~~~~~~~H~~~V~~~~~~~~  204 (315)
T 1l9x_A          158 ------------------PL-------------NF--TGGQLHSRMFQNFPTELLLSLAVEPLTANFHKWSLSVKNFTMN  204 (315)
T ss_dssp             ------------------CC-------------EE--CSTTTTCSTTTTSCHHHHHHHHHSCCEEEEEEEECBHHHHHTC
T ss_pred             ------------------Ce-------------ee--ccCCCCChHHHhcChhhhhhccccceEEEhhhhhcCccccccc
Confidence                              00             00  0112477899999988776666666777899999986554432


Q ss_pred             -CCCCCeEEEEEecCCCceEEEEEEecCCCEEEEeecCCccCcccCCCCCCCC
Q psy12875        256 -GLTETWNILTLSKYKSWEFVSTVEHKEYPIVGIQFHPEKNAYEWTESQHNPH  307 (308)
Q Consensus       256 -~l~~~~~via~s~~~~~~~v~ai~~~~~p~~GvQFHPE~~~~~~~~~~~~~~  307 (308)
                       .+|++++++|+++|+..|++++++++++++||||||||+..++|+....+||
T Consensus       205 ~~l~~g~~v~A~s~dg~ve~i~~i~~~~~~i~GVQfHPE~~~~e~~~~~~~p~  257 (315)
T 1l9x_A          205 EKLKKFFNVLTTNTDGKIEFISTMEGYKYPVYGVQWHPEKAPYEWKNLDGISH  257 (315)
T ss_dssp             HHHHHHEEEEEEEESSSCEEEEEEEESSSCEEEESSCTTHHHHCCSSCTTCCC
T ss_pred             cccCCCCEEEEEcCCCCEEEEEEeccCCCCEEEEEeCCCCCcccccccccCCc
Confidence             2788999999999988888899999888999999999999999997444566



>3fij_A LIN1909 protein; 11172J, uncharacterized protein, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.30A {Listeria innocua} Back     alignment and structure
>1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1 Back     alignment and structure
>2a9v_A GMP synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, ligase; 2.24A {Thermoplasma acidophilum} SCOP: c.23.16.1 Back     alignment and structure
>1wl8_A GMP synthase [glutamine-hydrolyzing] subunit A; transferase, gatases, riken structural genomics/proteomics initiative, RSGI; 1.45A {Pyrococcus horikoshii} SCOP: c.23.16.1 PDB: 2d7j_A Back     alignment and structure
>1i1q_B Anthranilate synthase component II; tryptophan biosynthesis, lyase; HET: TRP; 1.90A {Salmonella typhimurium} SCOP: c.23.16.1 PDB: 1i7q_B 1i7s_B* Back     alignment and structure
>1o1y_A Conserved hypothetical protein TM1158; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG; 1.70A {Thermotoga maritima} SCOP: c.23.16.1 Back     alignment and structure
>2vpi_A GMP synthase; guanine monophosphate synthetase, phosphoprotein, GMP synthetase, GMP biosynthesis, glutamine amidotransferase, ligase, cytoplasm; 2.40A {Homo sapiens} Back     alignment and structure
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Back     alignment and structure
>3m3p_A Glutamine amido transferase; structural genomics, nysgrc, PSI-2; HET: MSE; 1.30A {Methylobacillus flagellatus} PDB: 3l83_A* Back     alignment and structure
>4gud_A Imidazole glycerol phosphate synthase subunit His; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE 1PE; 1.91A {Vibrio cholerae} Back     alignment and structure
>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} Back     alignment and structure
>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Back     alignment and structure
>1a9x_B Carbamoyl phosphate synthetase (small chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: c.8.3.1 c.23.16.1 PDB: 1bxr_B* 1ce8_B* 1jdb_C* 1cs0_B* 1m6v_B* 1c30_B* 1c3o_B* 1kee_B* 1t36_B* Back     alignment and structure
>3l7n_A Putative uncharacterized protein; glutamine amidotransferase, transferas; 2.70A {Streptococcus mutans} Back     alignment and structure
>2ywd_A Glutamine amidotransferase subunit PDXT; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2w7t_A CTP synthetase, putative cytidine triphosphate synthase; glutaminase domain, trypsanosoma brucei, ligase, acivicin; HET: 5CS; 2.10A {Trypanosoma brucei} Back     alignment and structure
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Back     alignment and structure
>3r75_A Anthranilate/para-aminobenzoate synthases compone; ammonia channel, chorismate, type 1 glutamine amidotransfera phenazine biosynthesis, lyase; HET: CYG; 2.10A {Burkholderia SP} PDB: 3r74_A* 3r76_A* Back     alignment and structure
>2ywj_A Glutamine amidotransferase subunit PDXT; uncharacterized conserved protein, structural genomics; 1.90A {Methanocaldococcus jannaschii} Back     alignment and structure
>2v4u_A CTP synthase 2; pyrimidine biosynthesis, glutamine amidotransferase, glutaminase domain, 5-OXO-L-norleucine, DON, ligase, phosphoprotein; HET: CYD; 2.3A {Homo sapiens} PDB: 2vkt_A Back     alignment and structure
>3d54_D Phosphoribosylformylglycinamidine synthase 1; alpha-beta structure, ATP-binding, cytoplasm, ligase, nucleotide-binding, purine biosynthesis; HET: CYG ADP; 3.50A {Thermotoga maritima} Back     alignment and structure
>1gpw_B Amidotransferase HISH; lyase/transferase, complex (lyase/transferase), histidine biosynthesis, glutaminase, glutamine amidotransferase; 2.4A {Thermotoga maritima} SCOP: c.23.16.1 PDB: 1k9v_F 1kxj_A 2wjz_B Back     alignment and structure
>1q7r_A Predicted amidotransferase; structural genomics, YAAE, PDX2, predicted glutamine amidotransferase, PSI; HET: MSE; 1.90A {Geobacillus stearothermophilus} SCOP: c.23.16.1 Back     alignment and structure
>1ka9_H Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.23.16.1 Back     alignment and structure
>2nv0_A Glutamine amidotransferase subunit PDXT; 3-layer(ABA) sandwich, rossmann fold, glutaminase; 1.73A {Bacillus subtilis} SCOP: c.23.16.1 PDB: 1r9g_A 2nv2_B* Back     alignment and structure
>2iss_D Glutamine amidotransferase subunit PDXT; (beta/alpha)8-barrel, alpha/beta three layer sandwich, lyase transferase; HET: 5RP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3nva_A CTP synthase; rossman fold, nucleotide binding, LIG; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1vco_A CTP synthetase; tetramer, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLN; 2.15A {Thermus thermophilus} SCOP: c.23.16.1 c.37.1.10 PDB: 1vcn_A 1vcm_A Back     alignment and structure
>2abw_A PDX2 protein, glutaminase; PLP-synthase, vitamin B6, malaria, transferase; HET: PG4; 1.62A {Plasmodium falciparum} SCOP: c.23.16.1 PDB: 4ads_G Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>1s1m_A CTP synthase; CTP synthetase, UTP:ammonia ligase (ADP-forming), cytidine 5 triphosphate synthase, ammonia lyase; 2.30A {Escherichia coli} SCOP: c.23.16.1 c.37.1.10 PDB: 2ad5_A* Back     alignment and structure
>2vdj_A Homoserine O-succinyltransferase; methionine biosynthesis, amino-acid biosynthesis, homoserine transacetylase, homoserine transsuccinylase; 2.00A {Bacillus cereus} PDB: 2ghr_A Back     alignment and structure
>2h2w_A Homoserine O-succinyltransferase; TM0881, (EC 2.3.1.46), HOM O-transsuccinylase, HTS, (TM0881), structural genomics; 2.52A {Thermotoga maritima} Back     alignment and structure
>3ugj_A Phosphoribosylformylglycinamidine synthase; amidotransferase, glutaminase, thioester intermediate, ligas; HET: ADP; 1.78A {Salmonella enterica subsp} PDB: 1t3t_A* 3ujn_A* 3umm_A* Back     alignment and structure
>3l4e_A Uncharacterized peptidase LMO0363; hypothetical protein LMO0363, csgid, similar to peptidase E, hydrolase, protease, serine protease; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1i1q_B Anthranilate synthase component II; tryptophan biosynthesis, lyase; HET: TRP; 1.90A {Salmonella typhimurium} SCOP: c.23.16.1 PDB: 1i7q_B 1i7s_B* Back     alignment and structure
>1fy2_A Aspartyl dipeptidase; serine protease, catalytic triad, strand-helix MO hydrolase; 1.20A {Salmonella typhimurium} SCOP: c.23.16.4 PDB: 1fye_A Back     alignment and structure
>1a9x_B Carbamoyl phosphate synthetase (small chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: c.8.3.1 c.23.16.1 PDB: 1bxr_B* 1ce8_B* 1jdb_C* 1cs0_B* 1m6v_B* 1c30_B* 1c3o_B* 1kee_B* 1t36_B* Back     alignment and structure
>1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1 Back     alignment and structure
>3l7n_A Putative uncharacterized protein; glutamine amidotransferase, transferas; 2.70A {Streptococcus mutans} Back     alignment and structure
>1o1y_A Conserved hypothetical protein TM1158; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG; 1.70A {Thermotoga maritima} SCOP: c.23.16.1 Back     alignment and structure
>3r75_A Anthranilate/para-aminobenzoate synthases compone; ammonia channel, chorismate, type 1 glutamine amidotransfera phenazine biosynthesis, lyase; HET: CYG; 2.10A {Burkholderia SP} PDB: 3r74_A* 3r76_A* Back     alignment and structure
>3m3p_A Glutamine amido transferase; structural genomics, nysgrc, PSI-2; HET: MSE; 1.30A {Methylobacillus flagellatus} PDB: 3l83_A* Back     alignment and structure
>1wl8_A GMP synthase [glutamine-hydrolyzing] subunit A; transferase, gatases, riken structural genomics/proteomics initiative, RSGI; 1.45A {Pyrococcus horikoshii} SCOP: c.23.16.1 PDB: 2d7j_A Back     alignment and structure
>1oi4_A Hypothetical protein YHBO; PFPI/THIJ family, complete proteome, PFPI, THIJ, bacterial targets at IGS-CNRS, france, BIGS, structural genomics; 2.03A {Escherichia coli} SCOP: c.23.16.2 Back     alignment and structure
>2w7t_A CTP synthetase, putative cytidine triphosphate synthase; glutaminase domain, trypsanosoma brucei, ligase, acivicin; HET: 5CS; 2.10A {Trypanosoma brucei} Back     alignment and structure
>2a9v_A GMP synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, ligase; 2.24A {Thermoplasma acidophilum} SCOP: c.23.16.1 Back     alignment and structure
>3fij_A LIN1909 protein; 11172J, uncharacterized protein, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.30A {Listeria innocua} Back     alignment and structure
>4gud_A Imidazole glycerol phosphate synthase subunit His; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE 1PE; 1.91A {Vibrio cholerae} Back     alignment and structure
>1s1m_A CTP synthase; CTP synthetase, UTP:ammonia ligase (ADP-forming), cytidine 5 triphosphate synthase, ammonia lyase; 2.30A {Escherichia coli} SCOP: c.23.16.1 c.37.1.10 PDB: 2ad5_A* Back     alignment and structure
>1vco_A CTP synthetase; tetramer, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLN; 2.15A {Thermus thermophilus} SCOP: c.23.16.1 c.37.1.10 PDB: 1vcn_A 1vcm_A Back     alignment and structure
>2v4u_A CTP synthase 2; pyrimidine biosynthesis, glutamine amidotransferase, glutaminase domain, 5-OXO-L-norleucine, DON, ligase, phosphoprotein; HET: CYD; 2.3A {Homo sapiens} PDB: 2vkt_A Back     alignment and structure
>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Back     alignment and structure
>2ywj_A Glutamine amidotransferase subunit PDXT; uncharacterized conserved protein, structural genomics; 1.90A {Methanocaldococcus jannaschii} Back     alignment and structure
>4hcj_A THIJ/PFPI domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta-alpha sandwich; HET: MSE; 1.12A {Brachyspira murdochii} Back     alignment and structure
>3l3b_A ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography, isopr biosynthesis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} Back     alignment and structure
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Back     alignment and structure
>2vpi_A GMP synthase; guanine monophosphate synthetase, phosphoprotein, GMP synthetase, GMP biosynthesis, glutamine amidotransferase, ligase, cytoplasm; 2.40A {Homo sapiens} Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Back     alignment and structure
>1vhq_A Enhancing lycopene biosynthesis protein 2; structural genomics, unknown function; 1.65A {Escherichia coli} SCOP: c.23.16.2 PDB: 1oy1_A Back     alignment and structure
>2rk3_A Protein DJ-1; parkinson'S disease, THIJ, PFPI, chaperone, cytoplasm, disease mutation, nucleus, oncogene, oxidation, parkinson disease; 1.05A {Homo sapiens} PDB: 1pdv_A 1pdw_A 3cy6_A 1pe0_A 3cza_A 3cyf_A 2rk4_A 3cz9_A* 3ezg_A 3f71_A 3sf8_A 1p5f_A 1ps4_A 1q2u_A 1soa_A 1ucf_A 2or3_A 3bwe_A 3b38_A 3b36_A ... Back     alignment and structure
>1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1 Back     alignment and structure
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Back     alignment and structure
>3l18_A Intracellular protease I; gatase1_PFPI_LIKE, hydrolase; 1.78A {Thermococcus onnurineus} SCOP: c.23.16.2 PDB: 1g2i_A Back     alignment and structure
>2ab0_A YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase fold, unknown function; 1.10A {Escherichia coli} SCOP: c.23.16.2 Back     alignment and structure
>3ej6_A Catalase-3; heme, hydrogen iron, metal-binding, oxidoreductase, peroxidase; HET: NAG HEM; 2.30A {Neurospora crassa} Back     alignment and structure
>4e08_A DJ-1 beta; flavodoxin-like fold, stress response, motor protein; 2.00A {Drosophila melanogaster} Back     alignment and structure
>3ttv_A Catalase HPII; heme orientation, oxidoreductase; HET: HEM; 1.45A {Escherichia coli} PDB: 3ttt_A* 1gge_A* 1iph_A* 4ens_A* 3ttu_A* 3p9p_A* 4enq_A* 1p81_A* 3ttx_A* 4enw_A* 3ttw_A* 4ent_A* 1qws_A* 1cf9_A* 1p80_A* 1qf7_A* 4enu_A* 4enp_A* 1gg9_A* 1ggf_A* ... Back     alignment and structure
>1gpw_B Amidotransferase HISH; lyase/transferase, complex (lyase/transferase), histidine biosynthesis, glutaminase, glutamine amidotransferase; 2.4A {Thermotoga maritima} SCOP: c.23.16.1 PDB: 1k9v_F 1kxj_A 2wjz_B Back     alignment and structure
>3nva_A CTP synthase; rossman fold, nucleotide binding, LIG; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2vrn_A Protease I, DR1199; cysteine sulfenic acid, DJ-1/THIJ/PFPI superfamily, protease hydrolase, stress response; 2.15A {Deinococcus radiodurans} Back     alignment and structure
>3ot1_A 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme; csgid, structural genomics; HET: MSE CSX; 1.16A {Vibrio cholerae o1 biovar el tor} SCOP: c.23.16.0 Back     alignment and structure
>1ka9_H Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.23.16.1 Back     alignment and structure
>2ywd_A Glutamine amidotransferase subunit PDXT; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3efe_A THIJ/PFPI family protein; structural GEN csgid, center for structural genomics of infectious disease chaperone; 2.30A {Bacillus anthracis} Back     alignment and structure
>1q7r_A Predicted amidotransferase; structural genomics, YAAE, PDX2, predicted glutamine amidotransferase, PSI; HET: MSE; 1.90A {Geobacillus stearothermophilus} SCOP: c.23.16.1 Back     alignment and structure
>3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} Back     alignment and structure
>3n7t_A Macrophage binding protein; seattle structural genomics center for infectious disease, S macrophage, pathogenic fungus, coccidioidomycosis; 2.10A {Coccidioides immitis} SCOP: c.23.16.0 Back     alignment and structure
>3f5d_A Protein YDEA; unknow protein, PSI-II, nysgrc, structural genomics, protein structure initiative; 2.06A {Bacillus subtilis} Back     alignment and structure
>3cne_A Putative protease I; structural genomics, PSI-2, MCSG, protein struct initiative, midwest center for structural genomics; HET: FMN; 1.99A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2nv0_A Glutamine amidotransferase subunit PDXT; 3-layer(ABA) sandwich, rossmann fold, glutaminase; 1.73A {Bacillus subtilis} SCOP: c.23.16.1 PDB: 1r9g_A 2nv2_B* Back     alignment and structure
>3kkl_A Probable chaperone protein HSP33; peptidase, heat shock protein, hydrolase, protease, stress response; 2.03A {Saccharomyces cerevisiae} PDB: 3mii_A* Back     alignment and structure
>2iss_D Glutamine amidotransferase subunit PDXT; (beta/alpha)8-barrel, alpha/beta three layer sandwich, lyase transferase; HET: 5RP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2abw_A PDX2 protein, glutaminase; PLP-synthase, vitamin B6, malaria, transferase; HET: PG4; 1.62A {Plasmodium falciparum} SCOP: c.23.16.1 PDB: 4ads_G Back     alignment and structure
>3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} Back     alignment and structure
>3en0_A Cyanophycinase; serine protease, beta peptide specific, hydrolase, protease; 1.50A {Synechocystis SP} Back     alignment and structure
>2iuf_A Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Penicillium janthinellum} PDB: 2xf2_A* Back     alignment and structure
>1n57_A Chaperone HSP31, protein YEDU; alpha-beta sandwich; 1.60A {Escherichia coli} SCOP: c.23.16.2 PDB: 1pv2_A 1izy_A 1ons_A 1izz_A Back     alignment and structure
>1sy7_A Catalase 1; heme oxidation, singlet oxygen, oxidoreductase; HET: HDD HEM; 1.75A {Neurospora crassa} SCOP: c.23.16.3 Back     alignment and structure
>1u9c_A APC35852; structural genomics, protein structure initiative, MCSG, PAR disease, chaperone, cysteine protease, PSI; 1.35A {Geobacillus stearothermophilus} SCOP: c.23.16.2 Back     alignment and structure
>2fex_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, MIDW center for structural genomics, MCSG; 1.70A {Agrobacterium tumefaciens} SCOP: c.23.16.2 Back     alignment and structure
>3er6_A Putative transcriptional regulator protein; structural genomics, unknown function, DNA-binding, transcription regulation, PSI-2; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3ewn_A THIJ/PFPI family protein; monomer, PSI nysgrc, structural genomics, protein structure initiative; 1.65A {Pseudomonas syringae PV} Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>4gdh_A DJ-1, uncharacterized protein C22E12.03C; unknown function, cysteine oxidation; 1.05A {Schizosaccharomyces pombe} PDB: 4ge3_A 4ge0_A Back     alignment and structure
>3gra_A Transcriptional regulator, ARAC family; transcription regulator, PSI-II, structural genomics structure initiative; 2.30A {Pseudomonas putida} Back     alignment and structure
>1rw7_A YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI superfamily, unknown function; 1.80A {Saccharomyces cerevisiae} SCOP: c.23.16.2 PDB: 1qvv_A* 1qvz_A 1qvw_A Back     alignment and structure
>3d54_D Phosphoribosylformylglycinamidine synthase 1; alpha-beta structure, ATP-binding, cytoplasm, ligase, nucleotide-binding, purine biosynthesis; HET: CYG ADP; 3.50A {Thermotoga maritima} Back     alignment and structure
>2vdj_A Homoserine O-succinyltransferase; methionine biosynthesis, amino-acid biosynthesis, homoserine transacetylase, homoserine transsuccinylase; 2.00A {Bacillus cereus} PDB: 2ghr_A Back     alignment and structure
>3noq_A THIJ/PFPI family protein; DJ-1 superfamily, isocyanide hydratase, isonitrIle hydratase; HET: NHE; 1.00A {Pseudomonas fluorescens} PDB: 3noo_A 3non_A 3nor_A* 3nov_A Back     alignment and structure
>2h2w_A Homoserine O-succinyltransferase; TM0881, (EC 2.3.1.46), HOM O-transsuccinylase, HTS, (TM0881), structural genomics; 2.52A {Thermotoga maritima} Back     alignment and structure
>3mgk_A Intracellular protease/amidase related enzyme (THIJ family); amidotranferase-like, structural genomics, PSI; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3fse_A Two-domain protein containing DJ-1/THIJ/PFPI-like ferritin-like domains; structural genomics; HET: MSE CSX; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3bhn_A THIJ/PFPI domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.76A {Shewanella loihica pv-4} Back     alignment and structure
>3pzy_A MOG; ssgcid, seattle structural genomics center for infectious DI biosynthetic protein; 1.80A {Mycobacterium avium subsp} PDB: 3oi9_A 2g4r_A Back     alignment and structure
>1fy2_A Aspartyl dipeptidase; serine protease, catalytic triad, strand-helix MO hydrolase; 1.20A {Salmonella typhimurium} SCOP: c.23.16.4 PDB: 1fye_A Back     alignment and structure
>3l4e_A Uncharacterized peptidase LMO0363; hypothetical protein LMO0363, csgid, similar to peptidase E, hydrolase, protease, serine protease; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3ugj_A Phosphoribosylformylglycinamidine synthase; amidotransferase, glutaminase, thioester intermediate, ligas; HET: ADP; 1.78A {Salmonella enterica subsp} PDB: 1t3t_A* 3ujn_A* 3umm_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 308
d1l9xa_288 c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Ho 9e-25
d1jvna2232 c.23.16.1 (A:-3-229) GAT subunit, HisH, (or domain 2e-05
d1a9xb2228 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthe 2e-04
d1k9vf_200 c.23.16.1 (F:) GAT subunit, HisH, (or domain) of i 3e-04
d1qdlb_195 c.23.16.1 (B:) Anthranilate synthase GAT subunit, 5e-04
d1ka9h_195 c.23.16.1 (H:) GAT subunit, HisH, (or domain) of i 0.003
>d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Class I glutamine amidotransferase-like
family: Class I glutamine amidotransferases (GAT)
domain: gamma-glutamyl hydrolase
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 98.8 bits (245), Expect = 9e-25
 Identities = 79/292 (27%), Positives = 116/292 (39%), Gaps = 66/292 (22%)

Query: 19  PVIGILAQEYTHIPSYVKAYPNYT-SYIAASYVKNIEAAGARVVPILIGQDREYYAEILT 77
           P+IGIL Q         K   NY   YIAASYVK +E+AGARVVP+ +    +       
Sbjct: 4   PIIGILMQ-----KCRNKVMKNYGRYYIAASYVKYLESAGARVVPVRLDLTEKD------ 52

Query: 78  QINGVVIPGGGTGFDHPNGYADAGRQILHLVDKINEEGVTFPVLGVCLGFELILQVSNND 137
                                        L   IN  G+ FP   V L      +V+   
Sbjct: 53  --------------------------YEILFKSIN--GILFPGGSVDLRRSDYAKVAKIF 84

Query: 138 TDFRKSCKVQQVNLNLKFLPGAKRSSLFSQINEEGVTFPVLGVCLGFELILQVSNNDTDF 197
            +                           Q  ++G  FPV G CLGFE +  + + +   
Sbjct: 85  YNLSI------------------------QSFDDGDYFPVWGTCLGFEELSLLISGECLL 120

Query: 198 RKSCKVQQVNLNLKFLPGAKRSSLFSQVPSKYIKKFYQKPLTHNNHIWCITRQDMIKY-G 256
                   V + L F  G   S +F   P++ +     +PLT N H W ++ ++      
Sbjct: 121 TA-TDTVDVAMPLNFTGGQLHSRMFQNFPTELLLSLAVEPLTANFHKWSLSVKNFTMNEK 179

Query: 257 LTETWNILTLSKYKSWEFVSTVEHKEYPIVGIQFHPEKNAYEWTESQHNPHS 308
           L + +N+LT +     EF+ST+E  +YP+ G+Q+HPEK  YEW       H+
Sbjct: 180 LKKFFNVLTTNTDGKIEFISTMEGYKYPVYGVQWHPEKAPYEWKNLDGISHA 231


>d1jvna2 c.23.16.1 (A:-3-229) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Length = 232 Back     information, alignment and structure
>d1a9xb2 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]} Length = 228 Back     information, alignment and structure
>d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Length = 200 Back     information, alignment and structure
>d1qdlb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 195 Back     information, alignment and structure
>d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Length = 195 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query308
d1l9xa_288 gamma-glutamyl hydrolase {Human (Homo sapiens) [Ta 100.0
d2a9va1196 GMP synthase subunit A, GuaAA {Archaeon Thermoplas 99.95
d1wl8a1188 GMP synthase subunit A, GuaAA {Archaeon Pyrococcus 99.94
d1qdlb_195 Anthranilate synthase GAT subunit, TrpG {Archaeon 99.93
d1i7qb_192 Anthranilate synthase GAT subunit, TrpG {Serratia 99.93
d1o1ya_230 Hypothetical protein TM1158 {Thermotoga maritima [ 99.92
d1a9xb2228 Carbamoyl phosphate synthetase, small subunit C-te 99.91
d1gpma2205 GMP synthetase {Escherichia coli [TaxId: 562]} 99.89
d1jvna2232 GAT subunit, HisH, (or domain) of imidazoleglycero 99.87
d2nv0a1195 Hypothetical protein YaaE {Bacillus subtilis [TaxI 99.86
d1q7ra_202 Hypothetical protein YaaE {Bacillus stearothermoph 99.85
d1s1ma1258 CTP synthase PyrG, C-terminal domain {Escherichia 99.84
d1vcoa1250 CTP synthase PyrG, C-terminal domain {Thermus ther 99.83
d2abwa1218 Pyridoxine biosynthesis protein 2, Pdx2 {Malaria p 99.81
d1k9vf_200 GAT subunit, HisH, (or domain) of imidazoleglycero 99.8
d1ka9h_195 GAT subunit, HisH, (or domain) of imidazoleglycero 99.72
d2ghra1281 Homoserine O-succinyltransferase HTS (MetA) {Bacil 99.55
d1t3ta2262 FGAM synthase PurL, amidotransferase domain {Salmo 99.37
d1a9xb2228 Carbamoyl phosphate synthetase, small subunit C-te 98.96
d1i7qb_192 Anthranilate synthase GAT subunit, TrpG {Serratia 98.68
d1qdlb_195 Anthranilate synthase GAT subunit, TrpG {Archaeon 98.63
d1gpma2205 GMP synthetase {Escherichia coli [TaxId: 562]} 98.62
d1wl8a1188 GMP synthase subunit A, GuaAA {Archaeon Pyrococcus 98.36
d1o1ya_230 Hypothetical protein TM1158 {Thermotoga maritima [ 98.35
d2a9va1196 GMP synthase subunit A, GuaAA {Archaeon Thermoplas 98.12
d1p80a1156 Catalase, C-terminal domain {Escherichia coli, HPI 97.88
d1vhqa_217 Putative sigma cross-reacting protein 27A (SCRP-27 97.74
d1k9vf_200 GAT subunit, HisH, (or domain) of imidazoleglycero 97.62
d1oi4a1170 Hypothetical protein YhbO {Escherichia coli [TaxId 97.53
d1l9xa_288 gamma-glutamyl hydrolase {Human (Homo sapiens) [Ta 97.49
d1u9ca_221 GK2698 ortholog {Bacillus stearothermophilus [TaxI 97.44
d1p5fa_186 DJ-1 {Human (Homo sapiens) [TaxId: 9606]} 97.34
d1g2ia_166 Intracellular protease {Archaeon Pyrococcus horiko 97.3
d1sy7a1184 Catalase, C-terminal domain {Neurospora crassa [Ta 97.28
d2nv0a1195 Hypothetical protein YaaE {Bacillus subtilis [TaxI 97.2
d2ab0a1195 Protein ThiJ (YajL) {Escherichia coli [TaxId: 562] 97.05
d1jvna2232 GAT subunit, HisH, (or domain) of imidazoleglycero 96.95
d1qvwa_236 Hypothetical protein Ydr533Cp {Baker's yeast (Sacc 96.86
d1q7ra_202 Hypothetical protein YaaE {Bacillus stearothermoph 96.76
d2fexa1188 Hypothetical protein Atu0886 {Agrobacterium tumefa 96.54
d1s1ma1258 CTP synthase PyrG, C-terminal domain {Escherichia 96.53
d2abwa1218 Pyridoxine biosynthesis protein 2, Pdx2 {Malaria p 96.52
d1vcoa1250 CTP synthase PyrG, C-terminal domain {Thermus ther 96.51
d2ghra1281 Homoserine O-succinyltransferase HTS (MetA) {Bacil 95.99
d1n57a_279 HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]} 95.62
d1ka9h_195 GAT subunit, HisH, (or domain) of imidazoleglycero 95.3
d1fyea_229 Aspartyl dipeptidase PepE {Salmonella typhimurium 88.62
>d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Class I glutamine amidotransferase-like
family: Class I glutamine amidotransferases (GAT)
domain: gamma-glutamyl hydrolase
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.1e-43  Score=322.41  Aligned_cols=229  Identities=33%  Similarity=0.593  Sum_probs=186.6

Q ss_pred             CCCEEEEeccccCCCCcccccCCCCccchHHHHHHHHHHcCCeEEEEEcCCChhHHHHhcCCCCEEEEcCCCCCCCCCCc
Q psy12875         17 DTPVIGILAQEYTHIPSYVKAYPNYTSYIAASYVKNIEAAGARVVPILIGQDREYYAEILTQINGVVIPGGGTGFDHPNG   96 (308)
Q Consensus        17 ~~P~IGI~~~~~~~~~~~~~~~~~~~~~i~~~~~~~l~~aG~~~~~i~~~~~~~~~~~~l~~~dGlilpGG~~~~~~~~~   96 (308)
                      .||+|||+++++...    .......+||+++|+++++++|++|+++|++.+.++++..++.+||||+|||+.++++. .
T Consensus         2 ~kPiIGI~~~~~~~~----~~~~~~~~yi~~sYvk~ie~aGa~vvpi~~~~~~~~~~~~l~~idGillpGG~~~~~~~-~   76 (288)
T d1l9xa_           2 KKPIIGILMQKCRNK----VMKNYGRYYIAASYVKYLESAGARVVPVRLDLTEKDYEILFKSINGILFPGGSVDLRRS-D   76 (288)
T ss_dssp             CCCEEEEECEECCSH----HHHTTCSEEEEHHHHHHHHHTTCEEEEECSSCCHHHHHHHHHHSSEEEECCCCCCTTTC-H
T ss_pred             CCCEEEEeCCcccCc----ccccchHHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHhhcCCeEecCCCCCcccc-c
Confidence            689999999987641    11222468999999999999999999999999988888889999999999999888885 7


Q ss_pred             hhHHHHHHHHHHHHHHHcCCCccEEEechhhhHHHHHhcCCccccccccccccccceeeecCCCCcchhhhHhhhcCCCC
Q psy12875         97 YADAGRQILHLVDKINEEGVTFPVLGVCLGFELILQVSNNDTDFRKSCKVQQVNLNLKFLPGAKRSSLFSQINEEGVTFP  176 (308)
Q Consensus        97 ~~~~~~~~~e~~~~~~~~g~~~PvlGIC~G~Qll~~~~~gg~~~~~~~~~~~~~~~l~~~pg~~~~~~~~~i~~~~~~~P  176 (308)
                      |.+..+++++++....+.++++||||||+|||+|+.+ +||++.++..+..+....+.+                     
T Consensus        77 ~~~~~r~~~~~~l~~~~~~~~~PilGIC~G~Qll~~~-~gG~~~~~~~~~~~~~~~~~~---------------------  134 (288)
T d1l9xa_          77 YAKVAKIFYNLSIQSFDDGDYFPVWGTCLGFEELSLL-ISGECLLTATDTVDVAMPLNF---------------------  134 (288)
T ss_dssp             HHHHHHHHHHHHHHHHHTTCCCCEEEETHHHHHHHHH-HHSSCCCEEEEEEEEEECCEE---------------------
T ss_pred             ccccchHHHHHHHHHHHhhCCCCeEEEcHHHHHHHHH-hCCEeeccccCcCCcceeEEe---------------------
Confidence            8888889999988877777789999999999999999 999876544321111000000                     


Q ss_pred             eeeeehhHHHHHHHhCCcccccCCcccceeeecccccCCCCCCcCccCCChhHHHhhccCCceeeccceeeeeccccccC
Q psy12875        177 VLGVCLGFELILQVSNNDTDFRKSCKVQQVNLNLKFLPGAKRSSLFSQVPSKYIKKFYQKPLTHNNHIWCITRQDMIKYG  256 (308)
Q Consensus       177 ilGiClG~Qll~~~~G~~v~~~~~g~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~v~~~H~~~v~~~~~~~~~  256 (308)
                                                          ......+.++...+..+...+.+...++++|+++|.+..+....
T Consensus       135 ------------------------------------~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~H~~~v~~~~~~~~~  178 (288)
T d1l9xa_         135 ------------------------------------TGGQLHSRMFQNFPTELLLSLAVEPLTANFHKWSLSVKNFTMNE  178 (288)
T ss_dssp             ------------------------------------CSTTTTCSTTTTSCHHHHHHHHHSCCEEEEEEEECBHHHHHTCH
T ss_pred             ------------------------------------cCCCccceeEeecccchhhhccCCceEEEecccEEEecccchhh
Confidence                                                01123566888888887777888888999999999876654333


Q ss_pred             -CCCCeEEEEEecCCCceEEEEEEecCCCEEEEeecCCccCcccCCCCCCCCC
Q psy12875        257 -LTETWNILTLSKYKSWEFVSTVEHKEYPIVGIQFHPEKNAYEWTESQHNPHS  308 (308)
Q Consensus       257 -l~~~~~via~s~~~~~~~v~ai~~~~~p~~GvQFHPE~~~~~~~~~~~~~~~  308 (308)
                       ++++++++|++.|+..|+|++++++++|+||+|||||++.+||.+...+||+
T Consensus       179 ~l~~~~~v~a~s~d~~~e~I~~ie~~~~pi~GvQfHPEk~~fE~~~~~~~~H~  231 (288)
T d1l9xa_         179 KLKKFFNVLTTNTDGKIEFISTMEGYKYPVYGVQWHPEKAPYEWKNLDGISHA  231 (288)
T ss_dssp             HHHHHEEEEEEEESSSCEEEEEEEESSSCEEEESSCTTHHHHCCSSCTTCCCC
T ss_pred             hcCCceEEEEEECCCCeEEEEEEEcCCCcEEEEEcCCCCCCcccccCCCCCCC
Confidence             7899999999988888999999999999999999999999999998889996



>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qdlb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1i7qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a9xb2 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpma2 c.23.16.1 (A:3-207) GMP synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s1ma1 c.23.16.1 (A:287-544) CTP synthase PyrG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vcoa1 c.23.16.1 (A:298-547) CTP synthase PyrG, C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2abwa1 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protein 2, Pdx2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ghra1 c.23.16.8 (A:17-297) Homoserine O-succinyltransferase HTS (MetA) {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1t3ta2 c.23.16.1 (A:1034-1295) FGAM synthase PurL, amidotransferase domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1a9xb2 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i7qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1qdlb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gpma2 c.23.16.1 (A:3-207) GMP synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wl8a1 c.23.16.1 (A:1-188) GMP synthase subunit A, GuaAA {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1p80a1 c.23.16.3 (A:598-753) Catalase, C-terminal domain {Escherichia coli, HPII [TaxId: 562]} Back     information, alignment and structure
>d1vhqa_ c.23.16.2 (A:) Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1oi4a1 c.23.16.2 (A:23-192) Hypothetical protein YhbO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u9ca_ c.23.16.2 (A:) GK2698 ortholog {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p5fa_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g2ia_ c.23.16.2 (A:) Intracellular protease {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1sy7a1 c.23.16.3 (A:553-736) Catalase, C-terminal domain {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ab0a1 c.23.16.2 (A:2-196) Protein ThiJ (YajL) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvwa_ c.23.16.2 (A:) Hypothetical protein Ydr533Cp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2fexa1 c.23.16.2 (A:1-188) Hypothetical protein Atu0886 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1s1ma1 c.23.16.1 (A:287-544) CTP synthase PyrG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2abwa1 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protein 2, Pdx2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1vcoa1 c.23.16.1 (A:298-547) CTP synthase PyrG, C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ghra1 c.23.16.8 (A:17-297) Homoserine O-succinyltransferase HTS (MetA) {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1n57a_ c.23.16.2 (A:) HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fyea_ c.23.16.4 (A:) Aspartyl dipeptidase PepE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure