Psyllid ID: psy1288

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010--
CISISRSIKKGEDANLVHANTAQTLSQSKFKAMTKFEYPKARKNESLVDEYHGVKIPDPYGWMEDPDSEETKKFVDEENAISRPYLEDHPDRDKVKAELTKMWDYPKYSSPQRQGDHYFFFHNTGLQNHSVMYIQDSLDGEARVFLDPNNLSDDGTVSLGSYSFSEDGKTLAYCLSSSGSDWTSMHFKDVATGKEYPEVLHRLKFVSIAWTHDHKGVFYSNQEPKSKSKKHSKKNRSSAYHLTVNVAPITSQYITNEGPQFVFKTNKDAPNYRLITIDFDNFAESNWKTLIEENKDDVLDWATCVANDKLILSYIHHVKNVMHLHDLASGKHLYTFPLDVGTIVGFSGKKKYSEIFYSFMSFLQPTIIFHCNIPARVDPNSKLETSIFREIKVPDFDPSLFETKQVFYPSKDGTKIPMFILSRKGAQLDGNNPCILYGYGGFAVSLQPGFSVTKIVFLRDFNGIYAIPNIRGGGEYGERWHDGGRLLNKQNVFDDFQCAAEYLIASGYTQSSRLAIQGGSNGGLLTAACINQRPDLFGAAIVQVGNPEISDCGRWLIVHTMKDCKNNMFHFCDLDTIPDRKIEGKLPLTQVVHKVLDMLKFNKFTIGYFWESDYGSPANSSQFEYLLGYSPLHNIQGPDELKGKQYPATLLMTADHDDRVSPVHSLKFAATLQEKLRDYPHQTNPLLIRIETKAGHGGGKPTTKQFPLTIPVIYFYLTSGPVLQRYPETPNKADGSENVRNQDQKLYYHYLGTDQKDDILIAEVLDMLKFNKFTIGYFWESDYGSPANSSQFEYLLGYSPLHNIQGPNELKGKQYPATLLMTADHDDRVSPVHSLKFAATLQEKLRDYPHQTNPLLIRIETKAGHGGGKPTTKQLCVRYMMGGHFTVEFIRSVTTIRTFMSFLQPTIIFHCNIPARVDPNSKLETSIFREIKVPDFDPSLFETKQVFYPSKDGTKIPMFILSRKGAQLDGNNPCILYGYGGFAVSLQPGFSVTKIVFLRDFNGKEKSSLSYK
cccccHHHccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccEEccccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccEEEccEEEEEEEcccccEEEEEEEcccccccEEEEccccccccccEEEEEEEEcccccEEEEEEEcccEEEEEEEEEEcccccccccccccEEEEcEEEEccccEEEEEEEccccccEEEEEEcccccEEEEEEccccEEEEEEccccEEEEEEcccccccEEEEEEcccccccccEEEEccccccEEEEEEEEEccEEEEEEEccccEEEEEEEcccccEEEEcccccEEEEcccccccccEEEEEEEccccccEEEEEEcccccccccccccEEEEEcccccccccccEEEEEEEEcccccEEcEEEEEEccccccccccEEEEEccccccccccccccccHHccccccEEEEEEEccccccccHHHHHcccccccccccHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHcccccccEEEEEcccccccccccEEEEEEEccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccHHHHHHHHcccccccccccccccccccccEEEEcccccccccccHHHHHHHHHHHHHcccccccccEEEEEEcccccccccccccHHcHHHHHHEEEcccccccccccccccccccccccccccccEEEEEccccccccEEEEEEcccccEEEEEEEEEEEEEcccccccccEEEcccccccccccccccccccccccEEEEEccccccccccccccEEEcHHcHHcccccccccEEEEEEEcccccccccccccHHEEHHcccccEEEEEcccEEEEEEcccccccEEEEEEccccccccccccccEEEEcccccccccccEEEEEEEEcccccEEcEEEEEEccccccccccEEEEEcccccccccccccHHHHHHHHccccccccccccc
ccHHHHHHHHHHHHHHHccccccccccccccHcccccccccccccccEEEEccEEEEcccHHHHccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccEEcccEEEccEEEEEEEcccccccEEEEEcccccccEEEEcHHHHcccccEEEEEEEEcccccEEEEEEEEcccccEEEEEEEccccEEEEEEEEEEccccEEEcccccEEEEEEEcccccccEEEEEEccccEEEEEEcccccEEEEEEEccEEEEEEcccccccEEEEEEccEccHHHcEEEEccccccEEEEEEEEcccEEEEEEEEccEEEEEEEEcccccEEEEEcccccEEEEEEccccccEEEEEEEccccccEEEEEEcccccccccccccEEEEEcccccccHHHEEEEEEEEEcccccEEEEEEEEEccccccccccEEEEccccccccccccccHHHHHHHHHHccEEEEEccccccccHHHHHHcccHHHcHHHHHHHHHHHHHHHHcccccHHHEEEEEEcHHHHHHHHHHHHcHHHccEEEEEccccccccHHHcccHHcEcccccccccHcccccccccccccccccccccccccccccHHHcccHHHHHHHHcccccHHHHHHHHHHcHHHccccccccccccccEEEEEEEccccccccHHHHHHHHHHHHHccccccccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHHEEEEEEcccccccccccccccccccEEEEEEccccHHHcEEEEcccccccHHHcccHHHHHHHHcccccHHHHHHHccccHHHccccccccccccccEEEEEEEccccccccHHHHHHHHHHHHHccccccccccEEEEEEccccccccccHHHHHHHHHHHccccccccccccEEEEEEEccccccEEEEEEcccccEEEEccccEEEEEcccccccHHHEEEEEEEEEcccccEEEEEEEEEccccccccccEEEEccccccccccccccHHHHHHHHHHcccccccEEEc
cisisrsikkgedanlvhantaQTLSQSKFKAmtkfeypkarkneslvdeyhgvkipdpygwmedpdseetkkfvdeenaisrpyledhpdrdKVKAELTKmwdypkysspqrqgdhyfffhntglqnhsvMYIQdsldgearvfldpnnlsddgtvslgsysfsedgKTLAYCLSssgsdwtsmhfkdvatgkeypeVLHRLKFVSIAWthdhkgvfysnqepkskskkhskknrssayhltvnvapitsqyitnegpqfvfktnkdapnyrlitidfdnfaeSNWKTLIEENKDDVLDWATCVANDKLILSYIHHVKNvmhlhdlasgkhlytfpldvgtivgfsgkKKYSEIFYSFMSflqptiifhcniparvdpnskletsifreikvpdfdpslfetkqvfypskdgtkipmfilsrkgaqldgnnpcilygyggfavslqpgfsvtkIVFLrdfngiyaipnirgggeygerwhdggrllnkqnvFDDFQCAAEYLIAsgytqssrlaiqggsnggllTAACINQRPDLFGAAIVqvgnpeisdcGRWLIVHTMkdcknnmfhfcdldtipdrkiegklplTQVVHKVLDMLKfnkftigyfwesdygspanssqfeyllgysplhniqgpdelkgkqypatllmtadhddrvspvhSLKFAATLQEKLrdyphqtnpLLIRIetkaghgggkpttkqfpltiPVIYFYltsgpvlqrypetpnkadgsenvrnqDQKLYYHYlgtdqkddILIAEVLDMLKFNKFtigyfwesdygspanssqfeyllgysplhniqgpnelkgkqypatllmtadhddrvspvhSLKFAATLQEKLrdyphqtnpLLIRIetkaghgggkpttkQLCVRYMMGGHFTVEFIRSVTTIRTFMSflqptiifhcniparvdpnskletsifreikvpdfdpslfetkqvfypskdgtkipmfilsrkgaqldgnnpcilygyggfavslqpgfsvtKIVFLRdfngkeksslsyk
cisisrsikkgedanlvhantaqtlsqskfKAMTKFEypkarkneslvdeyhgvkipdpygwmEDPDSEETKKFVdeenaisrpyledhpdrdKVKAELTKMWDYPKYSSPQRQGDHYFFFHNTGLQNHSVMYIQDSLDGEARVFLDPNNLSDDGTVSLGSYSFSEDGKTLAYCLSSSGSDWTSMHFKDVATGKEYPEVLHRLKFVSIAWTHDHKgvfysnqepkskskkhskknrssayHLTVNVAPITSQYITNEGPQFVFKTNKDAPNYRLITIDFDNFAESNWKTLIEENKDDVLDWATCVANDKLILSYIHHVKNVMHLHDLASGKHLYTFPLDVGTIVGFSGKKKYSEIFYSFMSFLQPTIIFHCNIPARVDPNSKLETSIFREikvpdfdpslfETKQVfypskdgtkIPMFILSRKGAQLDGNNPCILYGYGGFAVSLQPGFSVTKIVFLRDFNGIYAIPNIRGGGEYGERWHDGGRLLNKQNVFDDFQCAAEYLIASGYTQSSRLAIQGGSNGGLLTAACINQRPDLFGAAIVQVGNPEISDCGRWLIVHTMKDCKNNMFHFCDLDTIPDRKIEGKLPLTQVVHKVLDMLKFNKFTIGYFWESDYGSPANSSQFEYLLGYSPLHNIQGPDELKGKQYPATLLMTADHDDRVSPVHSLKFAATLQEKLRDYPHQTNPLLIRIetkaghgggkpttkqfplTIPVIYFYLTSGPVLQRYPETpnkadgsenvrnQDQKLYYHYLGTDQKDDILIAEVLDMLKFNKFTIGYFWESDYGSPANSSQFEYLLGYSPLHNIQGPNELKGKQYPATLLMTADHDDRVSPVHSLKFAATLQEKLRDYPHQTNPLLIrietkaghgggkPTTKQLCVRYMMGGHFTVEFIRSVTTIRTFMSFLQPTIIFHCNIPARVDPNSKLETSIFREikvpdfdpslfETKQVfypskdgtkIPMFILSRKGAQLDGNNPCILYGYGGFAVSLQPGFSVTKIVFLRdfngkeksslsyk
CISISRSIKKGEDANLVHANTAQTLSQSKFKAMTKFEYPKARKNESLVDEYHGVKIPDPYGWMEDPDSEETKKFVDEENAISRPYLEDHPDRDKVKAELTKMWDYPKYSSPQRQGDHYFFFHNTGLQNHSVMYIQDSLDGEARVFLDPNNLSDDGTVSLGSYSFSEDGKTLAYCLSSSGSDWTSMHFKDVATGKEYPEVLHRLKFVSIAWTHDHKGVFYSNQEPkskskkhskknrssAYHLTVNVAPITSQYITNEGPQFVFKTNKDAPNYRLITIDFDNFAESNWKTLIEENKDDVLDWATCVANDKLILSYIHHVKNVMHLHDLASGKHLYTFPLDVGTIVGFSGKKKYSEIFYSFMSFLQPTIIFHCNIPARVDPNSKLETSIFREIKVPDFDPSLFETKQVFYPSKDGTKIPMFILSRKGAQLDGNNPCILYGYGGFAVSLQPGFSVTKIVFLRDFNGIYAIPNIRGGGEYGERWHDGGRLLNKQNVFDDFQCAAEYLIASGYTQSSRLAIQGGSNGGLLTAACINQRPDLFGAAIVQVGNPEISDCGRWLIVHTMKDCKNNMFHFCDLDTIPDRKIEGKLPLTQVVHKVLDMLKFNKFTIGYFWESDYGSPANSSQFEYLLGYSPLHNIQGPDELKGKQYPATLLMTADHDDRVSPVHSLKFAATLQEKLRDYPHQTNPLLIRIETKAGHGGGKPTTKQFPLTIPVIYFYLTSGPVLQRYPETPNKADGSENVRNQDQKLYYHYLGTDQKDDILIAEVLDMLKFNKFTIGYFWESDYGSPANSSQFEYLLGYSPLHNIQGPNELKGKQYPATLLMTADHDDRVSPVHSLKFAATLQEKLRDYPHQTNPLLIRIETKAGHGGGKPTTKQLCVRYMMGGHFTVEFIRSVTTIRTFMSFLQPTIIFHCNIPARVDPNSKLETSIFREIKVPDFDPSLFETKQVFYPSKDGTKIPMFILSRKGAQLDGNNPCILYGYGGFAVSLQPGFSVTKIVFLRDFNGKEKSSLSYK
***********************************************VDEYHGVKIPDPYGW**************************************KMWDYPKY*****QGDHYFFFHNTGLQNHSVMYIQDSLDGEARVFLDPNNLSDDGTVSLGSYSFSEDGKTLAYCLSSSGSDWTSMHFKDVATGKEYPEVLHRLKFVSIAWTHDHKGVFY********************YHLTVNVAPITSQYITNEGPQFVFKTNKDAPNYRLITIDFDNFAESNWKTLIEENKDDVLDWATCVANDKLILSYIHHVKNVMHLHDLASGKHLYTFPLDVGTIVGFSGKKKYSEIFYSFMSFLQPTIIFHCNIPARVDPNSKLETSIFREIKVPDFDPSLFETKQVFYPSKDGTKIPMFILSRKGAQLDGNNPCILYGYGGFAVSLQPGFSVTKIVFLRDFNGIYAIPNIRGGGEYGERWHDGGRLLNKQNVFDDFQCAAEYLIASGYTQSSRLAIQGGSNGGLLTAACINQRPDLFGAAIVQVGNPEISDCGRWLIVHTMKDCKNNMFHFCDLDTIPDRKIEGKLPLTQVVHKVLDMLKFNKFTIGYFWESDYGSPANSSQFEYLLGYSPLHNIQGP**LKGKQYPATLLMTADHDDRVSPVHSLKFAATLQEKLRDYPHQTNPLLIRIETKAGHGGGKPTTKQFPLTIPVIYFYLTSGPVLQR*******************KLYYHYLGTDQKDDILIAEVLDMLKFNKFTIGYFWESDYGSPANSSQFEYLLGYSPLHNIQGPNELKGKQYPATLLMTADHDDRVSPVHSLKFAATLQEKLRDYPHQTNPLLIRIETKAGHGGGKPTTKQLCVRYMMGGHFTVEFIRSVTTIRTFMSFLQPTIIFHCNIPARVDPNSKLETSIFREIKVPDFDPSLFETKQVFYPSKDGTKIPMFILSRKGAQLDGNNPCILYGYGGFAVSLQPGFSVTKIVFLRDF***********
****S**IKKGEDANLVHA*********************ARKNESLVDEYHGVKIPDPYGWMEDPDSEETKKFVDEENAISRPYLEDHPDRDKVKAELTKMWDYPKYSSPQRQGDHYFFFHNTGLQNHSVMYIQDSLDGEARVFLDPNNLSDDGTVSLGSYSFSEDGKTLAYCLSSSGSDWTSMHFKDVATGKEYPEVLHRLKFVSIAWTHDHKGVFYSNQEPKSKSKKHSKKNRSSAYHLTVNVAPITSQYITNEGPQFVFKTNKDAPNYRLITIDFDNFAESNWKTLIEENKDDVLDWATCVANDKLILSYIHHVKNVMHLHDLASGKHLYTFPLDVGTIVGFSGKKKYSEIFYSFMSFLQPTIIFHCNIPARVDPNSKLETSIFREIKVPDFDPSLFETKQVFYPSKDGTKIPMFILSRKGAQLDGNNPCILYGYGGFAVSLQPGFSVTKIVFLRDFNGIYAIPNIRGGGEYGERWHDGGRLLNKQNVFDDFQCAAEYLIASGYTQSSRLAIQGGSNGGLLTAACINQRPDLFGAAIVQVGNPEISDCGRWLIVHTMKDCKNNMFHFCDLDTIPDRKIEGKLPLTQVVHKVLDMLKFNKFTIGYFWESDYGSPANSSQFEYLLGYSPLHNIQGPDELKGKQYPATLLMTADHDDRVSPVHSLKFAATLQEKLRD*PHQTNPLLIRIETKAGHGGGKPTTKQFPLTIPVIYFYLTSGPVLQRYPETPNKADGSENVRNQDQKLYYHYLGTDQKDDILIAEVLDMLKFNKFTIGYFWESDYGSPANSSQFEYLLGYSPLHNIQGPNELKGKQYPATLLMTADHDDRVSPVHSLKFAATLQEKLRDYPHQTNPLLIRIETKAGHGGGKPTTKQLCVRYMMGGHFTVEFIRSVTTIRTFMSFLQPTIIFHCNIPARVDPNSKLETSIFREIKVPDFDPSLFETKQVFYPSKDGTKIPMFILSRKGAQLDGNNPCILYGYGGFAVSLQPGFSVTKIVFLRDFNGKEKS**SYK
CISISRSIKKGEDANLVHANTAQTLSQSKFKAMTKFEYPKARKNESLVDEYHGVKIPDPYGWMEDPDSEETKKFVDEENAISRPYLEDHPDRDKVKAELTKMWDYPKYSSPQRQGDHYFFFHNTGLQNHSVMYIQDSLDGEARVFLDPNNLSDDGTVSLGSYSFSEDGKTLAYCLSSSGSDWTSMHFKDVATGKEYPEVLHRLKFVSIAWTHDHKGVFYS******************AYHLTVNVAPITSQYITNEGPQFVFKTNKDAPNYRLITIDFDNFAESNWKTLIEENKDDVLDWATCVANDKLILSYIHHVKNVMHLHDLASGKHLYTFPLDVGTIVGFSGKKKYSEIFYSFMSFLQPTIIFHCNIPARVDPNSKLETSIFREIKVPDFDPSLFETKQVFYPSKDGTKIPMFILSRKGAQLDGNNPCILYGYGGFAVSLQPGFSVTKIVFLRDFNGIYAIPNIRGGGEYGERWHDGGRLLNKQNVFDDFQCAAEYLIASGYTQSSRLAIQGGSNGGLLTAACINQRPDLFGAAIVQVGNPEISDCGRWLIVHTMKDCKNNMFHFCDLDTIPDRKIEGKLPLTQVVHKVLDMLKFNKFTIGYFWESDYGSPANSSQFEYLLGYSPLHNIQGPDELKGKQYPATLLMTADHDDRVSPVHSLKFAATLQEKLRDYPHQTNPLLIRIETKAGHGGGKPTTKQFPLTIPVIYFYLTSGPVLQRYPETPNKADGSENVRNQDQKLYYHYLGTDQKDDILIAEVLDMLKFNKFTIGYFWESDYGSPANSSQFEYLLGYSPLHNIQGPNELKGKQYPATLLMTADHDDRVSPVHSLKFAATLQEKLRDYPHQTNPLLIRIETKAGHGGGKPTTKQLCVRYMMGGHFTVEFIRSVTTIRTFMSFLQPTIIFHCNIPARVDPNSKLETSIFREIKVPDFDPSLFETKQVFYPSKDGTKIPMFILSRKGAQLDGNNPCILYGYGGFAVSLQPGFSVTKIVFLRDFNG*********
CISISRSIKKGEDANLVHA***************KFEYPKARKNESLVDEYHGVKIPDPYGWMEDPDSEETKKFVDEENAISRPYLEDHPDRDKVKAELTKMWDYPKYSSPQRQGDHYFFFHNTGLQNHSVMYIQDSLDGEARVFLDPNNLSDDGTVSLGSYSFSEDGKTLAYCLSSSGSDWTSMHFKDVATGKEYPEVLHRLKFVSIAWTHDHKGVFYSNQEPKSKSKKHSKKNRSSAYHLTVNVAPITSQYITNEGPQFVFKTNKDAPNYRLITIDFDNFAESNWKTLIEENKDDVLDWATCVANDKLILSYIHHVKNVMHLHDLASGKHLYTFPLDVGTIVGFSGKKKYSEIFYSFMSFLQPTIIFHCNIPARVDPNSKLETSIFREIKVPDFDPSLFETKQVFYPSKDGTKIPMFILSRKGAQLDGNNPCILYGYGGFAVSLQPGFSVTKIVFLRDFNGIYAIPNIRGGGEYGERWHDGGRLLNKQNVFDDFQCAAEYLIASGYTQSSRLAIQGGSNGGLLTAACINQRPDLFGAAIVQVGNPEISDCGRWLIVHTMKDCKNNMFH*C*LDTIPDRKIEGKLPLTQVVHKVLDMLKFNKFTIGYFWESDYGSPANSSQFEYLLGYSPLHNIQGPDELKGKQYPATLLMTADHDDRVSPVHSLKFAATLQEKLRDYPHQTNPLLIRIETKAGHGGGKPTTKQFPLTIPVIYFYLTSGPVLQRYPETPNKADGSENVRNQDQKLYYHYLGTDQKDDILIAEVLDMLKFNKFTIGYFWESDYGSPANSSQFEYLLGYSPLHNIQGPNELKGKQYPATLLMTADHDDRVSPVHSLKFAATLQEKLRDYPHQTNPLLIRIETKAGHGGGKPTTKQLCVRYMMGGHFTVEFIRSVTTIRTFMSFLQPTIIFHCNIPARVDPNSKLETSIFREIKVPDFDPSLFETKQVFYPSKDGTKIPMFILSRKGAQLDGNNPCILYGYGGFAVSLQPGFSVTKIVFLRDFNGKEKSSLSYK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CISISRSIKKGEDANLVHANTAQTLSQSKFKAMTKFEYPKARKNESLVDEYHGVKIPDPYGWMEDPDSEETKKFVDEENAISRPYLEDHPDRDKVKAELTKMWDYPKYSSPQRQGDHYFFFHNTGLQNHSVMYIQDSLDGEARVFLDPNNLSDDGTVSLGSYSFSEDGKTLAYCLSSSGSDWTSMHFKDVATGKEYPEVLHRLKFVSIAWTHDHKGVFYSNQEPKSKSKKHSKKNRSSAYHLTVNVAPITSQYITNEGPQFVFKTNKDAPNYRLITIDFDNFAESNWKTLIEENKDDVLDWATCVANDKLILSYIHHVKNVMHLHDLASGKHLYTFPLDVGTIVGFSGKKKYSEIFYSFMSFLQPTIIFHCNIPARVDPNSKLETSIFREIKVPDFDPSLFETKQVFYPSKDGTKIPMFILSRKGAQLDGNNPCILYGYGGFAVSLQPGFSVTKIVFLRDFNGIYAIPNIRGGGEYGERWHDGGRLLNKQNVFDDFQCAAEYLIASGYTQSSRLAIQGGSNGGLLTAACINQRPDLFGAAIVQVGNPEISDCGRWLIVHTMKDCKNNMFHFCDLDTIPDRKIEGKLPLTQVVHKVLDMLKFNKFTIGYFWESDYGSPANSSQFEYLLGYSPLHNIQGPDELKGKQYPATLLMTADHDDRVSPVHSLKFAATLQEKLRDYPHQTNPLLIRIETKAGHGGGKPTTKQFPLTIPVIYFYLTSGPVLQRYPETPNKADGSENVRNQDQKLYYHYLGTDQKDDILIAEVLDMLKFNKFTIGYFWESDYGSPANSSQFEYLLGYSPLHNIQGPNELKGKQYPATLLMTADHDDRVSPVHSLKFAATLQEKLRDYPHQTNPLLIRIETKAGHGGGKPTTKQLCVRYMMGGHFTVEFIRSVTTIRTFMSFLQPTIIFHCNIPARVDPNSKLETSIFREIKVPDFDPSLFETKQVFYPSKDGTKIPMFILSRKGAQLDGNNPCILYGYGGFAVSLQPGFSVTKIVFLRDFNGKEKSSLSYK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1012 2.2.26 [Sep-21-2011]
O70196710 Prolyl endopeptidase OS=R yes N/A 0.392 0.559 0.539 1e-138
Q9QUR6710 Prolyl endopeptidase OS=M yes N/A 0.392 0.559 0.533 1e-138
P48147710 Prolyl endopeptidase OS=H yes N/A 0.392 0.559 0.526 1e-134
P23687710 Prolyl endopeptidase OS=S yes N/A 0.392 0.559 0.519 1e-132
Q9XTA2710 Prolyl endopeptidase OS=B yes N/A 0.389 0.554 0.503 1e-126
Q06903690 Prolyl endopeptidase OS=A no N/A 0.601 0.882 0.380 1e-125
P27028705 Prolyl endopeptidase OS=F N/A N/A 0.600 0.862 0.350 1e-116
P27195705 Prolyl endopeptidase OS=E N/A N/A 0.585 0.841 0.353 1e-111
Q86AS5760 Prolyl endopeptidase OS=D yes N/A 0.384 0.511 0.383 9e-75
P55577726 Uncharacterized peptidase yes N/A 0.307 0.428 0.322 1e-50
>sp|O70196|PPCE_RAT Prolyl endopeptidase OS=Rattus norvegicus GN=Prep PE=1 SV=1 Back     alignment and function desciption
 Score =  494 bits (1273), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 244/452 (53%), Positives = 303/452 (67%), Gaps = 55/452 (12%)

Query: 253 YITNEGPQFVFKTNKDAPNYRLITIDFDNFAESNWKTLIEENKDDVLDWATCVANDKLIL 312
           YITNEG  F FKTN+++PNYRLI IDF +  ES WK L+ E++ DVL+W  CV ++ L+L
Sbjct: 292 YITNEGTVFTFKTNRNSPNYRLINIDFTDPDESKWKVLVPEHEKDVLEWVACVRSNFLVL 351

Query: 313 SYIHHVKNVMHLHDLASGKHLYTFPLDVGTIVGFSGKKKYSEIFYSFMSFLQPTIIFHCN 372
            Y+ +VKN++ LHDL +G  L TFPLDVG++VG+SG+KK SEIFY F SFL P +I+HC+
Sbjct: 352 CYLRNVKNILQLHDLTTGALLKTFPLDVGSVVGYSGRKKDSEIFYQFTSFLSPGVIYHCD 411

Query: 373 IPARVDPNSKLETSIFREIKVPDFDPSLFETKQVFYPSKDGTKIPMFILSRKGAQLDGNN 432
           +        +LE  +FRE+ V   D S ++T QVFYPSKDGTKIPMFI+ +KG +LDG++
Sbjct: 412 LT-----REELEPRVFREVTVKGIDASDYQTIQVFYPSKDGTKIPMFIVHKKGIKLDGSH 466

Query: 433 PCILYGYGGFAVSLQPGFSVTKIVFLRDFNGIYAIPNIRGGGEYGERWHDGGRLLNKQNV 492
           P  LYGYGGF +S+ P +SV++++F+R   G+ A+ NIRGGGEYGE WH GG L NKQN 
Sbjct: 467 PAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANIRGGGEYGETWHKGGILANKQNC 526

Query: 493 FDDFQCAAEYLIASGYTQSSRLAIQGGSNGGLLTAACINQRPDLFGAAIVQVGNPEISDC 552
           FDDFQCAAEYLI  GYT S RL I GGSNGGLL AAC NQRPDLFG  I QVG       
Sbjct: 527 FDDFQCAAEYLIKEGYTTSKRLTINGGSNGGLLVAACANQRPDLFGCVIAQVG------- 579

Query: 553 GRWLIVHTMKDCKNNMFHFCDLDTIPDRKIEGKLPLTQVVHKVLDMLKFNKFTIGYFWES 612
                                                     V+DMLKF+KFTIG+ W +
Sbjct: 580 ------------------------------------------VMDMLKFHKFTIGHAWTT 597

Query: 613 DYGSPANSSQFEYLLGYSPLHNIQGPDELKGKQYPATLLMTADHDDRVSPVHSLKFAATL 672
           DYG   +   FE+LL YSPLHN++ P E    QYP+ LL+TADHDDRV P+HSLKF ATL
Sbjct: 598 DYGCSDSKQHFEWLLKYSPLHNVKLP-EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL 656

Query: 673 QEKLRDYPHQTNPLLIRIETKAGHGGGKPTTK 704
           Q  +     Q+NPLLI ++TKAGHG GKPT K
Sbjct: 657 QYIVGRSRKQSNPLLIHVDTKAGHGPGKPTAK 688
Cleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately 30 amino acids long. Has high activity on the succinyl- (suc-) peptide-4-methylcoumaryl-7-amide (MCA) substrates suc-Gly-Pro-Leu-Gly-Pro-MCA, suc-Gly-Pro-MCA and suc-Ala-Ala-Ala-MCA.
Rattus norvegicus (taxid: 10116)
EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: 2EC: 6
>sp|Q9QUR6|PPCE_MOUSE Prolyl endopeptidase OS=Mus musculus GN=Prep PE=2 SV=1 Back     alignment and function description
>sp|P48147|PPCE_HUMAN Prolyl endopeptidase OS=Homo sapiens GN=PREP PE=1 SV=2 Back     alignment and function description
>sp|P23687|PPCE_PIG Prolyl endopeptidase OS=Sus scrofa GN=PREP PE=1 SV=1 Back     alignment and function description
>sp|Q9XTA2|PPCE_BOVIN Prolyl endopeptidase OS=Bos taurus GN=PREP PE=2 SV=1 Back     alignment and function description
>sp|Q06903|PPCE_AERHY Prolyl endopeptidase OS=Aeromonas hydrophila PE=1 SV=2 Back     alignment and function description
>sp|P27028|PPCE_FLAME Prolyl endopeptidase OS=Flavobacterium meningosepticum GN=f1pep1 PE=1 SV=1 Back     alignment and function description
>sp|P27195|PPCF_ELIMR Prolyl endopeptidase OS=Elizabethkingia miricola PE=1 SV=1 Back     alignment and function description
>sp|Q86AS5|PPCE_DICDI Prolyl endopeptidase OS=Dictyostelium discoideum GN=prep PE=1 SV=1 Back     alignment and function description
>sp|P55577|Y4NA_RHISN Uncharacterized peptidase y4nA OS=Rhizobium sp. (strain NGR234) GN=NGR_a02410 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1012
332024972647 Prolyl endopeptidase [Acromyrmex echinat 0.619 0.969 0.499 0.0
380014010765 PREDICTED: prolyl endopeptidase-like [Ap 0.621 0.822 0.472 0.0
350417638763 PREDICTED: prolyl endopeptidase-like [Bo 0.621 0.824 0.472 0.0
66505780765 PREDICTED: prolyl endopeptidase-like iso 0.621 0.822 0.471 0.0
340712277763 PREDICTED: prolyl endopeptidase-like [Bo 0.621 0.824 0.467 0.0
321468258708 hypothetical protein DAPPUDRAFT_304946 [ 0.607 0.868 0.464 0.0
307177097706 Prolyl endopeptidase [Camponotus florida 0.617 0.885 0.452 0.0
405972967706 Prolyl endopeptidase [Crassostrea gigas] 0.617 0.885 0.453 0.0
194766113734 GF23775 [Drosophila ananassae] gi|190617 0.615 0.848 0.442 1e-176
291227779716 PREDICTED: prolyl endopeptidase-like [Sa 0.605 0.856 0.460 1e-175
>gi|332024972|gb|EGI65159.1| Prolyl endopeptidase [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/697 (49%), Positives = 460/697 (65%), Gaps = 70/697 (10%)

Query: 34  TKFEYPKARKNESLVDEYHGVKIPDPYGWMEDPDSEETKKFVDEENAISRPYLEDHPDRD 93
           T+ +YP+AR++ES+VD+YHGVKI DPY W+EDPDS ETK FVD +NAI++PYL     RD
Sbjct: 3   TRIQYPEARRDESVVDDYHGVKISDPYRWLEDPDSPETKAFVDAQNAITKPYLTACKARD 62

Query: 94  KVKAELTKMWDYPKYSSPQRQGDHYFFFHNTGLQNHSVMYIQDSLDGEARVFLDPNNLSD 153
            +   L ++WD+PKYS P + G+ Y+F+ N+GLQN SV+Y+QD+L+ E +VFLDPN  S+
Sbjct: 63  DIHDRLKQLWDFPKYSCPAKHGEKYYFYKNSGLQNQSVLYVQDTLESEPKVFLDPNTFSE 122

Query: 154 DGTVSLGSYSFSEDGKTLAYCLSSSGSDWTSMHFKDVATGKEYPEVLHRLKFVSIAWTHD 213
           DGTV++ S SF+EDG   AY LS SGSDW ++HF +  TG++Y E+L ++KF SI WTHD
Sbjct: 123 DGTVAITSSSFTEDGSIFAYGLSKSGSDWRTIHFLNAHTGEKYSEILEKVKFSSITWTHD 182

Query: 214 HKGVFYS---NQEPKSK-SKKHSKKNRSSAYHLTVNVAPITSQYITNEGPQ-------FV 262
           ++G+FY    +Q+ K+  S+    +N+   YH+       +   +  E P+        V
Sbjct: 183 NRGIFYGQYRDQQGKTDGSETLGNENQKLCYHVVGTSQ--SDDVVAVEFPEEPLWRIKAV 240

Query: 263 FKTNKDAPNYRLITIDFDNFAESNWKTLIEENKDDVLDWATCVANDKLILSYIHHVKNVM 322
           F+TNK+APNY+LI ID  ++ +  W  L+ E+ ++VLDWA  V  DK +  YI  VKN++
Sbjct: 241 FRTNKNAPNYKLIAIDLLDYEQHKWVDLLPEHPENVLDWAEAVDGDKFVACYIQDVKNIL 300

Query: 323 HLHDLASGKHLYTFPLDVGTIVGFSGKKKYSEIFYSFMSFLQPTIIFHCNIPARVDPNSK 382
            LH L +GK L +FPLD+GT+VGFSG+KKYSEIFY F SFL P II+  ++    +P   
Sbjct: 301 QLHCLNTGKVLRSFPLDLGTVVGFSGEKKYSEIFYQFTSFLTPGIIYTIDLKKEEEPR-- 358

Query: 383 LETSIFREIKVPDFDPSLFETKQVFYPSKDGTKIPMFILSRKGAQLDGNNPCILYGYGGF 442
               I REIKV DFD SL++T Q+FY SKD TK+PMFI++R  A LDG  P +LYGYGGF
Sbjct: 359 ----ILREIKVKDFDASLYKTSQIFYKSKDSTKVPMFIVTRNDATLDGTMPGLLYGYGGF 414

Query: 443 AVSLQPGFSVTKIVFLRDFNGIYAIPNIRGGGEYGERWHDGGRLLNKQNVFDDFQCAAEY 502
             S+QP FSVT++VF++ FNG+ A+ N+RGGGEYGERWH+ GR  N+QN FDDFQ AA+Y
Sbjct: 415 NASIQPTFSVTRLVFIQHFNGVLAVANVRGGGEYGERWHNAGRFFNRQNAFDDFQYAAKY 474

Query: 503 LIASGYTQSSRLAIQGGSNGGLLTAACINQRPDLFGAAIVQVGNPEISDCGRWLIVHTMK 562
           L+ +GYT S++L IQGGSNGGL    C+NQRPDLFGAAI QVG                 
Sbjct: 475 LVENGYTTSAKLTIQGGSNGGLAVGVCVNQRPDLFGAAIAQVG----------------- 517

Query: 563 DCKNNMFHFCDLDTIPDRKIEGKLPLTQVVHKVLDMLKFNKFTIGYFWESDYGSPANSSQ 622
                                           V+DML+F+KFTIG  W SDYG+P +   
Sbjct: 518 --------------------------------VMDMLRFHKFTIGSAWVSDYGNPDDPKH 545

Query: 623 FEYLLGYSPLHNIQGPDELKGKQYPATLLMTADHDDRVSPVHSLKFAATLQEKLRDYPHQ 682
           FE LL YSPLHN++ P +    QYPA LL+TADHDDRV P+H+LK  ATLQ  L +   Q
Sbjct: 546 FENLLKYSPLHNVRIPQD--DIQYPAMLLLTADHDDRVVPLHTLKLTATLQYTLGNVSKQ 603

Query: 683 TNPLLIRIETKAGHGGGKPTTKQFPLTIPVIYFYLTS 719
            NPL  +I+TKAGHG GKPT K    +  ++ F   S
Sbjct: 604 KNPLFAKIDTKAGHGSGKPTMKMIEESTDILSFIAQS 640

Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|380014010|ref|XP_003691037.1| PREDICTED: prolyl endopeptidase-like [Apis florea] Back     alignment and taxonomy information
>gi|350417638|ref|XP_003491520.1| PREDICTED: prolyl endopeptidase-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|66505780|ref|XP_395364.2| PREDICTED: prolyl endopeptidase-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|340712277|ref|XP_003394688.1| PREDICTED: prolyl endopeptidase-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|321468258|gb|EFX79244.1| hypothetical protein DAPPUDRAFT_304946 [Daphnia pulex] Back     alignment and taxonomy information
>gi|307177097|gb|EFN66352.1| Prolyl endopeptidase [Camponotus floridanus] Back     alignment and taxonomy information
>gi|405972967|gb|EKC37709.1| Prolyl endopeptidase [Crassostrea gigas] Back     alignment and taxonomy information
>gi|194766113|ref|XP_001965169.1| GF23775 [Drosophila ananassae] gi|190617779|gb|EDV33303.1| GF23775 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|291227779|ref|XP_002733861.1| PREDICTED: prolyl endopeptidase-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1012
UNIPROTKB|F1NUS2710 PREP "Uncharacterized protein" 0.299 0.426 0.587 4e-196
RGD|620841710 Prep "prolyl endopeptidase" [R 0.310 0.442 0.568 1.3e-195
UNIPROTKB|O70196710 Prep "Prolyl endopeptidase" [R 0.310 0.442 0.568 1.3e-195
MGI|MGI:1270863710 Prep "prolyl endopeptidase" [M 0.310 0.442 0.559 1.3e-195
UNIPROTKB|P48147710 PREP "Prolyl endopeptidase" [H 0.310 0.442 0.565 1.1e-193
UNIPROTKB|F6QHN4702 PREP "Prolyl endopeptidase" [B 0.310 0.447 0.562 5.8e-193
UNIPROTKB|P23687710 PREP "Prolyl endopeptidase" [S 0.310 0.442 0.555 7.4e-193
UNIPROTKB|Q9XTA2710 PREP "Prolyl endopeptidase" [B 0.310 0.442 0.559 1.2e-192
UNIPROTKB|F1PHX2710 PREP "Uncharacterized protein" 0.310 0.442 0.559 5.2e-192
UNIPROTKB|F1PHW5699 PREP "Uncharacterized protein" 0.310 0.449 0.559 1.6e-190
UNIPROTKB|F1NUS2 PREP "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 997 (356.0 bits), Expect = 4.0e-196, Sum P(3) = 4.0e-196
 Identities = 181/308 (58%), Positives = 230/308 (74%)

Query:   252 QYITNEGPQFVFKTNKDAPNYRLITIDFDNFAESNWKTLIEENKDDVLDWATCVANDKLI 311
             +Y+TNEG  F FKTN+ +PNYRLI IDF +  ES WK LI E++ DVL+W  CV ++ L+
Sbjct:   291 EYVTNEGTVFTFKTNRHSPNYRLINIDFSDPEESKWKVLIPEHERDVLEWVACVRSNFLV 350

Query:   312 LSYIHHVKNVMHLHDLASGKHLYTFPLDVGTIVGFSGKKKYSEIFYSFMSFLQPTIIFHC 371
             L Y+H VKN++ LHDLA+G HL TFPLDVG+IVG+SG+KK +EIFY F SFL P II+HC
Sbjct:   351 LCYLHDVKNILQLHDLATGAHLKTFPLDVGSIVGYSGQKKDNEIFYQFTSFLSPGIIYHC 410

Query:   372 NIPARVDPNSKLETSIFREIKVPDFDPSLFETKQVFYPSKDGTKIPMFILSRKGAQLDGN 431
             ++        +LE  +FRE+ V  FDPS+++T QVFYPSKDGTKIPMFI+ +KG +LDG+
Sbjct:   411 DLT-----KEELEPRVFREVTVKGFDPSVYQTIQVFYPSKDGTKIPMFIIHKKGIKLDGS 465

Query:   432 NPCILYGYGGFAVSLQPGFSVTKIVFLRDFNGIYAIPNIRGGGEYGERWHDGGRLLNKQN 491
             +P  LYGYGGF +S+ P +SV++++F+R   G+ A+ NIRGGGEYGE WH GG L NKQN
Sbjct:   466 HPAFLYGYGGFNISITPSYSVSRLIFVRHLGGVLAVANIRGGGEYGETWHKGGILANKQN 525

Query:   492 VFDDFQCAAEYLIASGYTQSSRLAIQGGSNGGLLTAACINQRPDLFGAAIVQVGNPEISD 551
              FDDFQ AA+YLI  GYT   +L I GGSNGGLL AAC NQRPDLFG  I QVG  ++  
Sbjct:   526 CFDDFQYAAKYLIREGYTSPKKLTINGGSNGGLLVAACANQRPDLFGCVIAQVGVMDMLK 585

Query:   552 CGRWLIVH 559
               ++ I H
Sbjct:   586 FHKYTIGH 593
GO:0004252 "serine-type endopeptidase activity" evidence=IEA
GO:0006508 "proteolysis" evidence=IEA
GO:0070008 "serine-type exopeptidase activity" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
RGD|620841 Prep "prolyl endopeptidase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O70196 Prep "Prolyl endopeptidase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1270863 Prep "prolyl endopeptidase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P48147 PREP "Prolyl endopeptidase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F6QHN4 PREP "Prolyl endopeptidase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P23687 PREP "Prolyl endopeptidase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9XTA2 PREP "Prolyl endopeptidase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PHX2 PREP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PHW5 PREP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9XTA2PPCE_BOVIN3, ., 4, ., 2, 1, ., 2, 60.50320.38930.5549yesN/A
Q9QUR6PPCE_MOUSE3, ., 4, ., 2, 1, ., 2, 60.53310.39220.5591yesN/A
O70196PPCE_RAT3, ., 4, ., 2, 1, ., 2, 60.53980.39220.5591yesN/A
P48147PPCE_HUMAN3, ., 4, ., 2, 1, ., 2, 60.52650.39220.5591yesN/A
P23687PPCE_PIG3, ., 4, ., 2, 1, ., 2, 60.51990.39220.5591yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.210.766
3rd Layer3.4.21.260.824

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1012
COG1505648 COG1505, COG1505, Serine proteases of the peptidas 1e-138
pfam02897412 pfam02897, Peptidase_S9_N, Prolyl oligopeptidase, 1e-93
COG1770682 COG1770, PtrB, Protease II [Amino acid transport a 5e-88
pfam00326212 pfam00326, Peptidase_S9, Prolyl oligopeptidase fam 4e-56
PRK10115686 PRK10115, PRK10115, protease 2; Provisional 9e-39
COG1505648 COG1505, COG1505, Serine proteases of the peptidas 3e-29
COG1505 648 COG1505, COG1505, Serine proteases of the peptidas 4e-19
pfam00326212 pfam00326, Peptidase_S9, Prolyl oligopeptidase fam 4e-19
COG1506620 COG1506, DAP2, Dipeptidyl aminopeptidases/acylamin 1e-15
COG1770 682 COG1770, PtrB, Protease II [Amino acid transport a 4e-12
COG1770682 COG1770, PtrB, Protease II [Amino acid transport a 7e-09
PRK10115 686 PRK10115, PRK10115, protease 2; Provisional 1e-05
PRK10115686 PRK10115, PRK10115, protease 2; Provisional 1e-04
>gnl|CDD|224422 COG1505, COG1505, Serine proteases of the peptidase family S9A [Amino acid transport and metabolism] Back     alignment and domain information 
 Score =  428 bits (1103), Expect = e-138
 Identities = 216/706 (30%), Positives = 313/706 (44%), Gaps = 133/706 (18%)

Query: 57  PDPYGWMEDPDSEETKKFVDEENAISRPYLEDHPDRDKVKAELTKMWDYPKYSSPQRQGD 116
           PDPY W+ED DS E  K+V+ +NA +R +L +   R      L ++WDY     P  +G 
Sbjct: 3   PDPYRWLEDLDSAEALKWVEAQNAKTREFLGEDSARAASDKRLLELWDYEDIPIPFERGG 62

Query: 117 HYFFFHN-----TGLQNHSVMYIQDSLDGEARVFLDPNNLSDDG--TVSLGSYSFSEDGK 169
            Y+ F        GL   + +    S   E  V +D + LS D    V+LG  S   DG 
Sbjct: 63  RYYNFWQDALYPRGLYRRTTLETYRSAKPEWEVLIDVDALSADLGDKVALGGASVLPDGT 122

Query: 170 TLAYCLSSSGSDWTSMHFKDVATGK-------EYPEVLHRLK---FVSIAWTHDHK---G 216
            L Y LS  GSD       D+ TG+       ++P +        FVS  W    K   G
Sbjct: 123 RLLYSLSIGGSDAGITREFDLETGEFVEEEGFKFPGISWLDDDGVFVSRYWRPKEKTPSG 182

Query: 217 VFYSNQ--------EPKSKSKKHSKKNRSSAYHLTVNVAP------ITSQYITNEGP--- 259
                +        E +      + +     +   + ++       ++    T+      
Sbjct: 183 YPRVVKRLKRGKLFEGQEGDVMVNARGDQDPWGFRLVLSEDGDFFMLSLWLGTSGKGLIK 242

Query: 260 ------------QFVFKTNKDAP----NYRLITIDFDNFAE-SNWKTLIEENKDDVLDWA 302
                       + V     D      +Y L+ +  D   E           ++  L+  
Sbjct: 243 LGLPDKVGYEWGKLVNTLRADWTFADVDYGLLYLLTDEDLELGKVIAEFIPEEEQSLEQV 302

Query: 303 TCVANDKLILSYIHHVKNVMHLHDLASGKHLYTFPLDV---GTIVGFSGKKKYSEIFYSF 359
                DKL+   + +V   + ++DL   +      +++   G +   S  K   E+F +F
Sbjct: 303 VTT-KDKLVAGTLDNVSGRLEVYDLKGERIE---EVELPPPGALGMGSADKDGDEVFLAF 358

Query: 360 MSFLQPTIIFHCNIPARVDPNSKLETSIFREIKVPDFDPSLFETKQVFYPSKDGTKIPMF 419
            SF  P+ ++  +         +LE  + RE  V  FD   +E +Q F  SKDGT+IP F
Sbjct: 359 TSFTTPSTLYRLD-----LFGGELE--VIREQPV-QFDADNYEVEQFFATSKDGTRIPYF 410

Query: 420 ILSRKGAQLDGNNPCILYGYGGFAVSLQPGFSVTKIVFLRDFNGIYAIPNIRGGGEYGER 479
           I+ RKGA+ D  NP +LY YGGF +SL P FS ++ ++L    G++ + NIRGGGE+G  
Sbjct: 411 IV-RKGAKKD-ENPTLLYAYGGFNISLTPRFSGSRKLWLER-GGVFVLANIRGGGEFGPE 467

Query: 480 WHDGGRLLNKQNVFDDFQCAAEYLIASGYTQSSRLAIQGGSNGGLLTAACINQRPDLFGA 539
           WH  G   NKQNVFDDF   AE LI  G T   +L IQGGSNGGLL  A + QRP+LFGA
Sbjct: 468 WHQAGMKENKQNVFDDFIAVAEDLIKRGITSPEKLGIQGGSNGGLLVGAALTQRPELFGA 527

Query: 540 AIVQVGNPEISDCGRWLIVHTMKDCKNNMFHFCDLDTIPDRKIEGKLPLTQVVHKVLDML 599
           A+ +V                                                  +LDML
Sbjct: 528 AVCEVP-------------------------------------------------LLDML 538

Query: 600 KFNKFTIGYFWESDYGSPANSSQFEYLLGYSPLHNIQGPDELKGKQYPATLLMTADHDDR 659
           +++  T G  W ++YG+P +     +LL YSP HN++      G++YP TL+ T+ HDDR
Sbjct: 539 RYHLLTAGSSWIAEYGNPDDPEDRAFLLAYSPYHNLKP-----GQKYPPTLITTSLHDDR 593

Query: 660 VSPVHSLKFAATLQEKLRDYPHQTNPLLIRIETKAGHGGGKPTTKQ 705
           V P H+ KFAA LQE          P+L+R ETK GHGG  PT + 
Sbjct: 594 VHPAHARKFAAKLQE-------VGAPVLLREETKGGHGGAAPTAEI 632

Length = 648
>gnl|CDD|217275 pfam02897, Peptidase_S9_N, Prolyl oligopeptidase, N-terminal beta-propeller domain Back     alignment and domain information
>gnl|CDD|224684 COG1770, PtrB, Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|215859 pfam00326, Peptidase_S9, Prolyl oligopeptidase family Back     alignment and domain information
>gnl|CDD|182247 PRK10115, PRK10115, protease 2; Provisional Back     alignment and domain information
>gnl|CDD|224422 COG1505, COG1505, Serine proteases of the peptidase family S9A [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224422 COG1505, COG1505, Serine proteases of the peptidase family S9A [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|215859 pfam00326, Peptidase_S9, Prolyl oligopeptidase family Back     alignment and domain information
>gnl|CDD|224423 COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224684 COG1770, PtrB, Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224684 COG1770, PtrB, Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|182247 PRK10115, PRK10115, protease 2; Provisional Back     alignment and domain information
>gnl|CDD|182247 PRK10115, PRK10115, protease 2; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1012
COG1770682 PtrB Protease II [Amino acid transport and metabol 100.0
PRK10115686 protease 2; Provisional 100.0
KOG2237|consensus712 100.0
COG1505648 Serine proteases of the peptidase family S9A [Amin 100.0
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 100.0
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 100.0
COG1770 682 PtrB Protease II [Amino acid transport and metabol 99.97
PRK10115686 protease 2; Provisional 99.96
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 99.95
KOG2100|consensus755 99.93
KOG2281|consensus867 99.93
KOG2237|consensus 712 99.93
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 99.92
COG1505648 Serine proteases of the peptidase family S9A [Amin 99.87
PRK01029428 tolB translocation protein TolB; Provisional 99.74
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 99.71
KOG2100|consensus755 99.69
PRK05137435 tolB translocation protein TolB; Provisional 99.69
PRK04043419 tolB translocation protein TolB; Provisional 99.67
PRK04043419 tolB translocation protein TolB; Provisional 99.67
PRK03629429 tolB translocation protein TolB; Provisional 99.66
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.66
PRK04792448 tolB translocation protein TolB; Provisional 99.62
PRK04792448 tolB translocation protein TolB; Provisional 99.62
PRK13604307 luxD acyl transferase; Provisional 99.62
PRK02889427 tolB translocation protein TolB; Provisional 99.62
PRK03629429 tolB translocation protein TolB; Provisional 99.62
PRK01029428 tolB translocation protein TolB; Provisional 99.61
PRK10566249 esterase; Provisional 99.6
PRK04922433 tolB translocation protein TolB; Provisional 99.6
PRK02889427 tolB translocation protein TolB; Provisional 99.6
PRK00178430 tolB translocation protein TolB; Provisional 99.59
PRK00178430 tolB translocation protein TolB; Provisional 99.59
PLN02442283 S-formylglutathione hydrolase 99.58
PRK04922433 tolB translocation protein TolB; Provisional 99.57
PRK05137435 tolB translocation protein TolB; Provisional 99.56
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 99.55
PLN02298330 hydrolase, alpha/beta fold family protein 99.52
PRK10162318 acetyl esterase; Provisional 99.51
COG0412236 Dienelactone hydrolase and related enzymes [Second 99.5
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 99.5
COG3458321 Acetyl esterase (deacetylase) [Secondary metabolit 99.49
PF05448320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 99.48
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 99.47
PRK05077414 frsA fermentation/respiration switch protein; Revi 99.47
KOG1455|consensus313 99.45
PRK01742429 tolB translocation protein TolB; Provisional 99.44
COG0823425 TolB Periplasmic component of the Tol biopolymer t 99.43
PRK01742429 tolB translocation protein TolB; Provisional 99.43
PLN02385349 hydrolase; alpha/beta fold family protein 99.43
PHA02857276 monoglyceride lipase; Provisional 99.4
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.39
PRK05371767 x-prolyl-dipeptidyl aminopeptidase; Provisional 99.37
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 99.36
PRK11460232 putative hydrolase; Provisional 99.35
COG0657312 Aes Esterase/lipase [Lipid metabolism] 99.33
PRK10749330 lysophospholipase L2; Provisional 99.27
COG2267298 PldB Lysophospholipase [Lipid metabolism] 99.25
COG1647243 Esterase/lipase [General function prediction only] 99.24
PF10503220 Esterase_phd: Esterase PHB depolymerase 99.22
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 99.21
COG0823425 TolB Periplasmic component of the Tol biopolymer t 99.18
PLN02652395 hydrolase; alpha/beta fold family protein 99.16
KOG1552|consensus258 99.15
KOG1515|consensus336 99.14
KOG2281|consensus867 99.14
PF02129272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 99.13
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 99.11
TIGR00976550 /NonD putative hydrolase, CocE/NonD family. This m 99.11
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 99.1
KOG4391|consensus300 99.1
COG4946668 Uncharacterized protein related to the periplasmic 99.04
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 99.04
COG4099387 Predicted peptidase [General function prediction o 99.03
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 99.0
COG0429345 Predicted hydrolase of the alpha/beta-hydrolase fo 98.96
PLN02511388 hydrolase 98.95
COG0400207 Predicted esterase [General function prediction on 98.92
PRK10985324 putative hydrolase; Provisional 98.91
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 98.89
PF12715390 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 98.84
TIGR03611257 RutD pyrimidine utilization protein D. This protei 98.83
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 98.83
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 98.81
COG3509312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 98.8
PLN02872395 triacylglycerol lipase 98.77
PLN00021313 chlorophyllase 98.77
PLN02442283 S-formylglutathione hydrolase 98.76
PRK00870302 haloalkane dehalogenase; Provisional 98.72
PRK10566249 esterase; Provisional 98.72
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 98.71
COG2945210 Predicted hydrolase of the alpha/beta superfamily 98.69
COG2936563 Predicted acyl esterases [General function predict 98.67
PRK11071190 esterase YqiA; Provisional 98.67
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 98.63
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 98.63
PF08840213 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term 98.62
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 98.62
PRK03592295 haloalkane dehalogenase; Provisional 98.61
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 98.6
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 98.58
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 98.58
PRK10439411 enterobactin/ferric enterobactin esterase; Provisi 98.58
PRK10673255 acyl-CoA esterase; Provisional 98.56
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 98.55
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 98.55
PLN02824294 hydrolase, alpha/beta fold family protein 98.55
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 98.5
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 98.49
KOG1838|consensus409 98.48
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 98.47
KOG4667|consensus269 98.47
PLN02965255 Probable pheophorbidase 98.47
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 98.47
PRK03204286 haloalkane dehalogenase; Provisional 98.46
PRK06489360 hypothetical protein; Provisional 98.45
KOG4627|consensus270 98.45
COG2272491 PnbA Carboxylesterase type B [Lipid metabolism] 98.45
KOG3043|consensus242 98.44
PLN02894402 hydrolase, alpha/beta fold family protein 98.44
PLN02679360 hydrolase, alpha/beta fold family protein 98.42
COG4946668 Uncharacterized protein related to the periplasmic 98.41
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 98.41
PRK07581339 hypothetical protein; Validated 98.4
cd00312493 Esterase_lipase Esterases and lipases (includes fu 98.39
PRK13616591 lipoprotein LpqB; Provisional 98.39
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 98.38
PRK00175379 metX homoserine O-acetyltransferase; Provisional 98.33
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 98.3
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 98.3
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 98.29
PLN02578354 hydrolase 98.28
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.27
PF12740259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 98.26
PRK10349256 carboxylesterase BioH; Provisional 98.24
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.22
KOG4178|consensus322 98.22
PLN02211273 methyl indole-3-acetate methyltransferase 98.2
PRK13604307 luxD acyl transferase; Provisional 98.15
PF00135535 COesterase: Carboxylesterase family The prints ent 98.14
KOG2984|consensus277 98.11
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 98.11
PRK08775343 homoserine O-acetyltransferase; Provisional 98.08
PRK10162318 acetyl esterase; Provisional 98.08
PRK11460232 putative hydrolase; Provisional 97.98
KOG3101|consensus283 97.97
PF00756251 Esterase: Putative esterase; InterPro: IPR000801 T 97.94
COG0657312 Aes Esterase/lipase [Lipid metabolism] 97.91
PLN03084383 alpha/beta hydrolase fold protein; Provisional 97.9
PRK06765389 homoserine O-acetyltransferase; Provisional 97.9
PRK13616591 lipoprotein LpqB; Provisional 97.9
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 97.89
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 97.89
COG0627316 Predicted esterase [General function prediction on 97.88
PF03403379 PAF-AH_p_II: Platelet-activating factor acetylhydr 97.84
PRK05855582 short chain dehydrogenase; Validated 97.81
KOG0293|consensus519 97.79
KOG4409|consensus365 97.78
TIGR01838532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 97.74
KOG0279|consensus315 97.73
COG4757281 Predicted alpha/beta hydrolase [General function p 97.73
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 97.71
KOG0271|consensus480 97.71
KOG1454|consensus326 97.69
KOG2112|consensus206 97.67
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.67
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 97.67
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.66
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 97.65
COG2819264 Predicted hydrolase of the alpha/beta superfamily 97.64
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 97.63
KOG0293|consensus519 97.62
PF07224307 Chlorophyllase: Chlorophyllase; InterPro: IPR01082 97.57
KOG1552|consensus258 97.55
KOG2564|consensus343 97.54
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 97.54
PF08538303 DUF1749: Protein of unknown function (DUF1749); In 97.53
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.53
PRK05077414 frsA fermentation/respiration switch protein; Revi 97.49
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 97.44
KOG3847|consensus399 97.43
COG4188365 Predicted dienelactone hydrolase [General function 97.42
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 97.41
COG2382299 Fes Enterochelin esterase and related enzymes [Ino 97.41
KOG0291|consensus893 97.36
PRK07868 994 acyl-CoA synthetase; Validated 97.35
COG3571213 Predicted hydrolase of the alpha/beta-hydrolase fo 97.28
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.28
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 97.27
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 97.24
TIGR03230442 lipo_lipase lipoprotein lipase. Members of this pr 97.23
KOG2314|consensus698 97.23
KOG0318|consensus603 97.21
KOG4497|consensus447 97.2
KOG1553|consensus517 97.17
PRK11028330 6-phosphogluconolactonase; Provisional 97.13
PTZ00420568 coronin; Provisional 97.1
COG0400207 Predicted esterase [General function prediction on 97.1
COG0412236 Dienelactone hydrolase and related enzymes [Second 97.1
PF10340374 DUF2424: Protein of unknown function (DUF2424); In 97.09
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.08
KOG2139|consensus445 97.07
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 97.06
KOG0266|consensus456 97.04
PF11339581 DUF3141: Protein of unknown function (DUF3141); In 97.02
KOG0291|consensus893 97.01
PF02129272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 97.0
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 96.98
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 96.96
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 96.95
PF06342297 DUF1057: Alpha/beta hydrolase of unknown function 96.93
PLN02298330 hydrolase, alpha/beta fold family protein 96.92
PTZ00420568 coronin; Provisional 96.87
PF05677365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 96.87
KOG2314|consensus698 96.84
PLN02385349 hydrolase; alpha/beta fold family protein 96.84
PTZ00421493 coronin; Provisional 96.81
TIGR03611257 RutD pyrimidine utilization protein D. This protei 96.75
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 96.75
KOG2624|consensus403 96.75
KOG1516|consensus545 96.74
KOG0318|consensus603 96.71
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 96.69
TIGR02171912 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogou 96.67
COG1647243 Esterase/lipase [General function prediction only] 96.67
TIGR01839560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 96.67
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 96.63
PTZ00421493 coronin; Provisional 96.6
KOG1407|consensus313 96.58
PHA02857276 monoglyceride lipase; Provisional 96.56
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 96.52
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 96.45
PRK11028330 6-phosphogluconolactonase; Provisional 96.38
KOG2048|consensus691 96.37
KOG2055|consensus514 96.35
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 96.32
KOG0266|consensus456 96.32
TIGR03502792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 96.28
COG4099387 Predicted peptidase [General function prediction o 96.27
KOG0305|consensus484 96.22
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 96.22
COG3386307 Gluconolactonase [Carbohydrate transport and metab 96.18
PF10503220 Esterase_phd: Esterase PHB depolymerase 96.17
KOG4389|consensus601 96.05
PF09752348 DUF2048: Uncharacterized conserved protein (DUF204 96.04
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 96.02
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 95.97
PF1214679 Hydrolase_4: Putative lysophospholipase; InterPro: 95.97
PF05448320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 95.97
KOG0772|consensus641 95.96
KOG0973|consensus942 95.96
KOG2055|consensus514 95.93
PRK10439411 enterobactin/ferric enterobactin esterase; Provisi 95.92
KOG1273|consensus405 95.91
PF02273294 Acyl_transf_2: Acyl transferase; InterPro: IPR0031 95.89
KOG0275|consensus508 95.88
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 95.85
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 95.76
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 95.75
COG1073299 Hydrolases of the alpha/beta superfamily [General 95.72
KOG1407|consensus313 95.71
KOG4497|consensus447 95.69
PF11144403 DUF2920: Protein of unknown function (DUF2920); In 95.66
KOG0315|consensus311 95.6
KOG0272|consensus459 95.56
COG3208244 GrsT Predicted thioesterase involved in non-riboso 95.54
PF05577434 Peptidase_S28: Serine carboxypeptidase S28; InterP 95.48
PF10142367 PhoPQ_related: PhoPQ-activated pathogenicity-relat 95.31
KOG1446|consensus311 95.29
KOG0973|consensus942 95.26
KOG1445|consensus1012 95.13
KOG1838|consensus409 95.1
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 95.09
KOG3253|consensus 784 95.07
KOG0645|consensus312 95.0
TIGR02171912 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogou 94.94
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 94.82
KOG0272|consensus459 94.71
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 94.62
KOG2096|consensus420 94.61
PF06057192 VirJ: Bacterial virulence protein (VirJ); InterPro 94.59
KOG0271|consensus480 94.54
KOG0273|consensus524 94.41
PRK10749330 lysophospholipase L2; Provisional 94.17
PLN02578354 hydrolase 94.15
PRK04940180 hypothetical protein; Provisional 94.1
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 94.09
KOG0284|consensus464 94.09
PRK10673255 acyl-CoA esterase; Provisional 94.08
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 94.05
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 94.01
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 94.0
COG3490366 Uncharacterized protein conserved in bacteria [Fun 93.99
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 93.94
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 93.93
PTZ00472462 serine carboxypeptidase (CBP1); Provisional 93.88
COG2021368 MET2 Homoserine acetyltransferase [Amino acid tran 93.85
KOG2096|consensus420 93.79
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 93.78
PF00151331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 93.73
PLN00021313 chlorophyllase 93.62
PRK11071190 esterase YqiA; Provisional 93.56
KOG2394|consensus636 93.55
KOG1274|consensus933 93.54
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 93.38
PF08386103 Abhydrolase_4: TAP-like protein; InterPro: IPR0135 93.28
PLN02894402 hydrolase, alpha/beta fold family protein 93.28
KOG0263|consensus707 93.25
COG4947227 Uncharacterized protein conserved in bacteria [Fun 93.01
PF08840213 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term 92.99
COG2382299 Fes Enterochelin esterase and related enzymes [Ino 92.93
KOG0263|consensus707 92.92
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 92.89
KOG1455|consensus313 92.86
KOG0772|consensus641 92.73
KOG4391|consensus300 92.68
KOG0296|consensus399 92.68
PLN00181793 protein SPA1-RELATED; Provisional 92.65
KOG0650|consensus733 92.6
KOG1524|consensus737 92.57
KOG1446|consensus311 92.47
KOG2139|consensus445 92.37
KOG1063|consensus764 92.36
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 92.33
PLN02652395 hydrolase; alpha/beta fold family protein 92.24
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 92.17
TIGR01849406 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, 92.14
PF00450415 Peptidase_S10: Serine carboxypeptidase; InterPro: 91.74
KOG2382|consensus315 91.71
KOG1274|consensus933 91.7
KOG2183|consensus492 91.37
KOG2315|consensus566 91.34
KOG1538|consensus 1081 91.32
KOG0286|consensus343 91.13
KOG3043|consensus242 90.71
PF08386103 Abhydrolase_4: TAP-like protein; InterPro: IPR0135 90.68
COG3458321 Acetyl esterase (deacetylase) [Secondary metabolit 90.19
KOG1539|consensus910 90.01
KOG2110|consensus391 89.89
PF07519474 Tannase: Tannase and feruloyl esterase; InterPro: 89.86
KOG0299|consensus479 89.8
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 89.7
KOG2551|consensus230 89.66
KOG0315|consensus311 89.64
KOG0306|consensus888 89.62
KOG0275|consensus508 89.5
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 89.45
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 89.27
PLN02679360 hydrolase, alpha/beta fold family protein 89.16
KOG0643|consensus327 89.04
PRK02888635 nitrous-oxide reductase; Validated 88.87
KOG0771|consensus398 88.53
PLN02511388 hydrolase 88.51
KOG0286|consensus343 88.5
COG3386307 Gluconolactonase [Carbohydrate transport and metab 88.28
PLN02733440 phosphatidylcholine-sterol O-acyltransferase 88.18
KOG2182|consensus514 88.09
COG2945210 Predicted hydrolase of the alpha/beta superfamily 87.84
PRK00175379 metX homoserine O-acetyltransferase; Provisional 87.69
PRK10349256 carboxylesterase BioH; Provisional 87.66
COG3243445 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me 87.59
PF07519474 Tannase: Tannase and feruloyl esterase; InterPro: 87.46
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 87.36
KOG2112|consensus206 87.34
KOG3253|consensus 784 87.28
KOG0282|consensus503 87.22
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 87.11
PLN02211273 methyl indole-3-acetate methyltransferase 87.01
KOG0273|consensus524 86.98
COG1073299 Hydrolases of the alpha/beta superfamily [General 86.84
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 86.72
COG3391381 Uncharacterized conserved protein [Function unknow 86.68
PF12740259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 86.56
PRK06765389 homoserine O-acetyltransferase; Provisional 86.44
KOG1282|consensus454 86.39
KOG1273|consensus405 86.18
KOG0282|consensus503 85.74
KOG2106|consensus626 85.58
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 85.5
PF01674219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 85.03
KOG3967|consensus297 84.99
KOG2315|consensus566 84.77
PLN03016433 sinapoylglucose-malate O-sinapoyltransferase 84.66
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 84.46
PF11187224 DUF2974: Protein of unknown function (DUF2974); In 84.43
COG2267298 PldB Lysophospholipase [Lipid metabolism] 84.33
KOG2919|consensus406 84.28
KOG1515|consensus336 84.21
PLN02965255 Probable pheophorbidase 83.96
KOG4388|consensus880 83.82
COG3150191 Predicted esterase [General function prediction on 83.6
KOG0639|consensus705 83.3
KOG4499|consensus310 82.96
PRK07581339 hypothetical protein; Validated 82.76
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 82.62
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 82.61
PRK00870302 haloalkane dehalogenase; Provisional 82.61
KOG2984|consensus277 82.28
PRK06489360 hypothetical protein; Provisional 82.25
PLN02209437 serine carboxypeptidase 82.21
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 82.11
KOG0303|consensus472 82.06
KOG2919|consensus406 82.01
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 81.89
KOG0288|consensus459 81.68
PRK03592295 haloalkane dehalogenase; Provisional 81.53
PRK13613599 lipoprotein LpqB; Provisional 81.52
COG0429345 Predicted hydrolase of the alpha/beta-hydrolase fo 81.41
KOG0265|consensus338 81.26
PRK13614573 lipoprotein LpqB; Provisional 81.05
KOG0296|consensus399 80.97
PRK10985324 putative hydrolase; Provisional 80.82
PLN029191057 haloacid dehalogenase-like hydrolase family protei 80.81
PF00756251 Esterase: Putative esterase; InterPro: IPR000801 T 80.59
KOG2110|consensus391 80.38
KOG1445|consensus1012 80.26
KOG0302|consensus440 80.22
KOG0645|consensus312 80.21
KOG0310|consensus487 80.21
PF07082250 DUF1350: Protein of unknown function (DUF1350); In 80.21
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=6.6e-88  Score=751.39  Aligned_cols=616  Identities=30%  Similarity=0.534  Sum_probs=546.6

Q ss_pred             CCCCCCccCcceeecccCccccCCCCCCCCCC--CHHHHHHHHHhhhchHhhhccC-CChHHHHHHHhhcccCCCCCCCe
Q psy1288          36 FEYPKARKNESLVDEYHGVKIPDPYGWMEDPD--SEETKKFVDEENAISRPYLEDH-PDRDKVKAELTKMWDYPKYSSPQ  112 (1012)
Q Consensus        36 ~~~P~a~~~~~~~~~~hG~~~~Dpy~WLed~~--~~~~~~~l~~qn~~t~~~l~~~-~~~~~l~~~~~~~~~~~~~s~p~  112 (1012)
                      +.||.|+|.|+. .+.||++++|+|+||+|.+  +|+|++||+|||+|++++|+++ +++++|++||+.+++.++.|+|.
T Consensus         4 p~pP~a~k~~~~-~~~hg~~~~D~Y~WlRd~~~~~p~vl~yL~aEN~Yt~~~~a~~~~L~~~if~Ei~~Rik~dd~Svp~   82 (682)
T COG1770           4 PLPPIAKKVPTT-RTHHGDTRVDDYAWLRDDNWSNPEVLAYLEAENAYTEAVMAHLQPLQKKIFEEIKGRIKEDDLSVPY   82 (682)
T ss_pred             CCCCCcccccee-eeecCceeecchHhhhCCcccChHHHHHHHHhhHHHHHhhhhhHHHHHHHHHHHhhhccCcCCCCcc
Confidence            469999999965 8889999999999999998  9999999999999999999999 99999999999999999999999


Q ss_pred             eeCCEEEEEEEcCCCCeeEEEEEeCCCCc-eEEEcCCCCCCCC-CceEeeeEEECCCCcEEEEEEeCCCCceEEEEEEEC
Q psy1288         113 RQGDHYFFFHNTGLQNHSVMYIQDSLDGE-ARVFLDPNNLSDD-GTVSLGSYSFSEDGKTLAYCLSSSGSDWTSMHFKDV  190 (1012)
Q Consensus       113 ~dG~~~yy~~~~~~~~~~~l~~~~~~~g~-~~~L~D~n~la~~-g~~~i~~~~~SPDGk~iAy~~~~~G~~~~~L~v~dl  190 (1012)
                      ++|.+.||.+.+.+.+++.-||+...++. +++|+|.|+++.+ .++.++.+.+|||++++||+.+..|++++.|.++|+
T Consensus        83 ~~~~~~Yy~r~~~g~~y~~~~R~~~~g~~~eevlLD~n~~A~g~~f~~Lg~~~~s~D~~~la~s~D~~G~e~y~lr~kdL  162 (682)
T COG1770          83 RKGPYEYYSRTEEGKEYPIYCRQPDEGGEGEEVLLDVNKEAEGHDFFSLGAASISPDHNLLAYSVDVLGDEQYTLRFKDL  162 (682)
T ss_pred             ccCCeeEEEEecCCCcceeEEeccCCCCCceeEeecchhccCcccceeeeeeeeCCCCceEEEEEecccccEEEEEEEec
Confidence            99999999999888777666664444554 8999999999988 688999999999999999999999999999999999


Q ss_pred             CCCceeceeecceeeeeeEEeeCCCeEEEEecCCCCCcc------c-CCCCCceEEEEeeccc-----------------
Q psy1288         191 ATGKEYPEVLHRLKFVSIAWTHDHKGVFYSNQEPKSKSK------K-HSKKNRSSAYHLTVNV-----------------  246 (1012)
Q Consensus       191 ~tg~~~~~t~~~~~~~~~~WSpDG~~l~y~~~~~~~~g~------~-~~~~~~~l~~~~~~~~-----------------  246 (1012)
                      ++|+..++.+.++. .+++|.+|+++|+|++.+...+-.      . ......+++|++....                 
T Consensus       163 ~tg~~~~d~i~~~~-~~~~Wa~d~~~lfYt~~d~~~rp~kv~~h~~gt~~~~d~lvyeE~d~~f~~~v~~s~s~~yi~i~  241 (682)
T COG1770         163 ATGEELPDEITNTS-GSFAWAADGKTLFYTRLDENHRPDKVWRHRLGTPGSSDELVYEEKDDRFFLSVGRSRSEAYIVIS  241 (682)
T ss_pred             ccccccchhhcccc-cceEEecCCCeEEEEEEcCCCCcceEEEEecCCCCCcceEEEEcCCCcEEEEeeeccCCceEEEE
Confidence            99999888877653 779999999999999876532111      0 1112345556552000                 


Q ss_pred             ----------------------------cceeeeeeecCCCEEEEEECCCCCCceEEEEeCCCCcccCcEEeeccCCCce
Q psy1288         247 ----------------------------APITSQYITNEGPQFVFKTNKDAPNYRLITIDFDNFAESNWKTLIEENKDDV  298 (1012)
Q Consensus       247 ----------------------------~~i~~~~~s~dg~~l~~~tn~~~~~~~L~~~dl~~~~~~~~~~l~~~~~~~~  298 (1012)
                                                  .+++|. ..+.|+.+|+.+|.++++++|++.++ .+..++|+.++++.++..
T Consensus       242 ~~~~~tsE~~ll~a~~p~~~p~vv~pr~~g~eY~-~eh~~d~f~i~sN~~gknf~l~~ap~-~~~~~~w~~~I~h~~~~~  319 (682)
T COG1770         242 LGSHITSEVRLLDADDPEAEPKVVLPRENGVEYS-VEHGGDRFYILSNADGKNFKLVRAPV-SADKSNWRELIPHREDVR  319 (682)
T ss_pred             cCCCcceeEEEEecCCCCCceEEEEEcCCCcEEe-eeecCcEEEEEecCCCcceEEEEccC-CCChhcCeeeeccCCCce
Confidence                                        234454 67789999999999989999999998 666678999999999999


Q ss_pred             eeeeEEecCCEEEEEEEcCceEEEEEEecCCCceeeeecCC--ceEEE-eecccccCcEEEEEecCCCCCcEEEEEeCCC
Q psy1288         299 LDWATCVANDKLILSYIHHVKNVMHLHDLASGKHLYTFPLD--VGTIV-GFSGKKKYSEIFYSFMSFLQPTIIFHCNIPA  375 (1012)
Q Consensus       299 ~~~~~~~~~~~l~~~~~~~g~~~l~~~dl~~G~~~~~l~~~--~~~v~-~~~~spdg~~l~~~~ss~~~p~~l~~~d~~~  375 (1012)
                      ++.+..++ ++|++..+.++.+++++.+..+|+.. .|.++  .++.. ..+..++.+.|+|.++|+++|.++|.+|+  
T Consensus       320 l~~~~~f~-~~lVl~eR~~glp~v~v~~~~~~~~~-~i~f~~~ay~~~l~~~~e~~s~~lR~~ysS~ttP~~~~~~dm--  395 (682)
T COG1770         320 LEGVDLFA-DHLVLLERQEGLPRVVVRDRKTGEER-GIAFDDEAYSAGLSGNPEFDSDRLRYSYSSMTTPATLFDYDM--  395 (682)
T ss_pred             eeeeeeec-cEEEEEecccCCceEEEEecCCCcee-eEEecchhhhccccCCCCCCCccEEEEeecccccceeEEeec--
Confidence            99999998 99999999999999999999777653 35555  22221 33445678999999999999999999999  


Q ss_pred             CCCCCCCcceEEEEeccCCC-CCCCCCceEEEEEECCCCceEEEEEEEeCCCCCCCCCcEEEEEcCCCCCCCCCCcChhH
Q psy1288         376 RVDPNSKLETSIFREIKVPD-FDPSLFETKQVFYPSKDGTKIPMFILSRKGAQLDGNNPCILYGYGGFAVSLQPGFSVTK  454 (1012)
Q Consensus       376 ~~~~~g~~~~~~l~~~~~~~-~~~~~~~~~~v~~~s~DG~~i~~~l~~p~~~~~~~~~P~vv~~hGg~~~~~~~~~~~~~  454 (1012)
                         .++  +.++|++.++++ ++++.|.++++++++.||.+||..++++++...+++.|+++++||+++.++.+.|+...
T Consensus       396 ---~t~--er~~LkqqeV~~g~dp~~Y~s~riwa~a~dgv~VPVSLvyrkd~~~~g~~p~lLygYGaYG~s~~p~Fs~~~  470 (682)
T COG1770         396 ---ATG--ERTLLKQQEVPGGFDPEDYVSRRIWATADDGVQVPVSLVYRKDTKLDGSAPLLLYGYGAYGISMDPSFSIAR  470 (682)
T ss_pred             ---cCC--cEEEEEeccCCCCCChhHeEEEEEEEEcCCCcEeeEEEEEecccCCCCCCcEEEEEeccccccCCcCcccce
Confidence               577  788999988887 99999999999999999999999999999988899999999999999999999999888


Q ss_pred             HHHHHhCCeEEEEEcCCCCCCCchhHHhhhhcCCCcchHhHHHHHHHHHHHcCCCCCCcEEEEecChHHHHHHHHHhhCC
Q psy1288         455 IVFLRDFNGIYAIPNIRGGGEYGERWHDGGRLLNKQNVFDDFQCAAEYLIASGYTQSSRLAIQGGSNGGLLTAACINQRP  534 (1012)
Q Consensus       455 ~~~l~~~G~~v~~~d~RG~g~~g~~~~~~~~~~~~~~~~~D~~a~~~~l~~~~~~d~~~i~i~G~S~GG~l~~~~~~~~p  534 (1012)
                      +++++ ||++++++++||||+.|+.|+++|+...+.++|.||++|+++|++++++++++|+++|+|+||+++++++++.|
T Consensus       471 lSLlD-RGfiyAIAHVRGGgelG~~WYe~GK~l~K~NTf~DFIa~a~~Lv~~g~~~~~~i~a~GGSAGGmLmGav~N~~P  549 (682)
T COG1770         471 LSLLD-RGFVYAIAHVRGGGELGRAWYEDGKLLNKKNTFTDFIAAARHLVKEGYTSPDRIVAIGGSAGGMLMGAVANMAP  549 (682)
T ss_pred             eeeec-CceEEEEEEeecccccChHHHHhhhhhhccccHHHHHHHHHHHHHcCcCCccceEEeccCchhHHHHHHHhhCh
Confidence            88887 79999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CceeEEEEccCCCccccCcceeeeecccccccCcccccc-cCCCCcccccCCCCcchhhhhhhhhhhccccccccccccc
Q psy1288         535 DLFGAAIVQVGNPEISDCGRWLIVHTMKDCKNNMFHFCD-LDTIPDRKIEGKLPLTQVVHKVLDMLKFNKFTIGYFWESD  613 (1012)
Q Consensus       535 ~~f~a~v~~~~~~~i~d~~~~~~~~~~~~~~~~~~~~~d-l~~~~~~~~~~~~plt~~~~~~~d~~~~~~~~~g~~~~~~  613 (1012)
                      ++|+++|+.+|                         |+| +++|.+    +++|||..                 +| .|
T Consensus       550 ~lf~~iiA~VP-------------------------FVDvltTMlD----~slPLT~~-----------------E~-~E  582 (682)
T COG1770         550 DLFAGIIAQVP-------------------------FVDVLTTMLD----PSLPLTVT-----------------EW-DE  582 (682)
T ss_pred             hhhhheeecCC-------------------------ccchhhhhcC----CCCCCCcc-----------------ch-hh
Confidence            99999999999                         999 688876    79999985                 34 79


Q ss_pred             cCCCCChHHHHHHHcCCcccCCCCCCcccCCCCCcEEEEeeCCCCCCChHHHHHHHHHHHhhhccCCCCCCcEEEEEeCC
Q psy1288         614 YGSPANSSQFEYLLGYSPLHNIQGPDELKGKQYPATLLMTADHDDRVSPVHSLKFAATLQEKLRDYPHQTNPLLIRIETK  693 (1012)
Q Consensus       614 ~g~p~~~~~~~~~~~~sP~~~~~~p~~~~~~~~P~vLiihG~~D~~v~~~~s~~~~~~L~~~~~~~~~~~~~~~l~~~p~  693 (1012)
                      ||+|.+++.++++++|||+.|+.      .+.||++|++.|.+|+||.++++.+|.++|++.    .+++.+++|++++.
T Consensus       583 WGNP~d~e~y~yikSYSPYdNV~------a~~YP~ilv~~Gl~D~rV~YwEpAKWvAkLR~~----~td~~plLlkt~M~  652 (682)
T COG1770         583 WGNPLDPEYYDYIKSYSPYDNVE------AQPYPAILVTTGLNDPRVQYWEPAKWVAKLREL----KTDGNPLLLKTNMD  652 (682)
T ss_pred             hCCcCCHHHHHHHhhcCchhccc------cCCCCceEEEccccCCccccchHHHHHHHHhhc----ccCCCcEEEEeccc
Confidence            99999999999999999999999      689999999999999999999999999999998    56688999999999


Q ss_pred             CCCCCCCccccchhhhhHHHHHHHHhCCC
Q psy1288         694 AGHGGGKPTTKQFPLTIPVIYFYLTSGPV  722 (1012)
Q Consensus       694 ~gHg~~~~~~~~~~~~~~~~~fl~~~l~~  722 (1012)
                      +|||...++.+.+++.+..++|+.+.++.
T Consensus       653 aGHgG~SgRf~~lee~A~eYaF~l~~~~~  681 (682)
T COG1770         653 AGHGGASGRFQRLEEIAFEYAFLLKLAGT  681 (682)
T ss_pred             ccCCCCCCchHHHHHHHHHHHHHhhhccC
Confidence            99999888888899999999999887643

>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG2237|consensus Back     alignment and domain information
>COG1505 Serine proteases of the peptidase family S9A [Amino acid transport and metabolism] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2100|consensus Back     alignment and domain information
>KOG2281|consensus Back     alignment and domain information
>KOG2237|consensus Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>COG1505 Serine proteases of the peptidase family S9A [Amino acid transport and metabolism] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>KOG2100|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>KOG1455|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>KOG1552|consensus Back     alignment and domain information
>KOG1515|consensus Back     alignment and domain information
>KOG2281|consensus Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG4391|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>COG2936 Predicted acyl esterases [General function prediction only] Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>KOG1838|consensus Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>KOG4667|consensus Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>KOG4627|consensus Back     alignment and domain information
>COG2272 PnbA Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>KOG3043|consensus Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG4178|consensus Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases Back     alignment and domain information
>KOG2984|consensus Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>KOG3101|consensus Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>COG0627 Predicted esterase [General function prediction only] Back     alignment and domain information
>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG4409|consensus Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG1454|consensus Back     alignment and domain information
>KOG2112|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>KOG1552|consensus Back     alignment and domain information
>KOG2564|consensus Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>KOG3847|consensus Back     alignment and domain information
>COG4188 Predicted dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>COG2382 Fes Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG1553|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>PF11339 DUF3141: Protein of unknown function (DUF3141); InterPro: IPR024501 This family of proteins appears to be predominantly expressed in Proteobacteria Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG2624|consensus Back     alignment and domain information
>KOG1516|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171 Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>KOG4389|consensus Back     alignment and domain information
>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>PF02273 Acyl_transf_2: Acyl transferase; InterPro: IPR003157 LuxD proteins are bacterial acyl transferases Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>COG1073 Hydrolases of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF10142 PhoPQ_related: PhoPQ-activated pathogenicity-related protein; InterPro: IPR009199 Proteins in this entry are believed to play a role in virulence/pathogenicity in Salmonella Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG1838|consensus Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>KOG3253|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171 Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PRK04940 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF08386 Abhydrolase_4: TAP-like protein; InterPro: IPR013595 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>COG4947 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH Back     alignment and domain information
>COG2382 Fes Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>KOG1455|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG4391|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2382|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG2183|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG3043|consensus Back     alignment and domain information
>PF08386 Abhydrolase_4: TAP-like protein; InterPro: IPR013595 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ] Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>KOG2551|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>KOG2182|consensus Back     alignment and domain information
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] Back     alignment and domain information
>PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ] Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>KOG2112|consensus Back     alignment and domain information
>KOG3253|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>COG1073 Hydrolases of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>KOG1282|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>KOG3967|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>PLN03016 sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG1515|consensus Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>KOG4388|consensus Back     alignment and domain information
>COG3150 Predicted esterase [General function prediction only] Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>KOG2984|consensus Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PLN02209 serine carboxypeptidase Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK13613 lipoprotein LpqB; Provisional Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>PRK13614 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1012
1qfm_A710 Prolyl Oligopeptidase From Porcine Muscle Length = 1e-137
1qfm_A710 Prolyl Oligopeptidase From Porcine Muscle Length = 2e-31
1qfm_A 710 Prolyl Oligopeptidase From Porcine Muscle Length = 6e-27
1vz3_A710 Prolyl Oligopeptidase From Porcine Brain, T597c Mut 1e-137
1vz3_A710 Prolyl Oligopeptidase From Porcine Brain, T597c Mut 2e-31
1vz3_A 710 Prolyl Oligopeptidase From Porcine Brain, T597c Mut 7e-27
3ddu_A709 Prolyl Oligopeptidase With Gsk552 Length = 709 1e-133
3ddu_A709 Prolyl Oligopeptidase With Gsk552 Length = 709 1e-31
3ddu_A 709 Prolyl Oligopeptidase With Gsk552 Length = 709 7e-27
1qfs_A710 Prolyl Oligopeptidase From Porcine Muscle With Cova 1e-133
1qfs_A710 Prolyl Oligopeptidase From Porcine Muscle With Cova 1e-31
1qfs_A 710 Prolyl Oligopeptidase From Porcine Muscle With Cova 7e-27
1e8m_A710 Prolyl Oligopeptidase From Porcine Brain, Mutant, C 1e-133
1e8m_A710 Prolyl Oligopeptidase From Porcine Brain, Mutant, C 1e-31
1e8m_A 710 Prolyl Oligopeptidase From Porcine Brain, Mutant, C 7e-27
1h2x_A710 Prolyl Oligopeptidase From Porcine Brain, Y473f Mut 1e-133
1h2x_A710 Prolyl Oligopeptidase From Porcine Brain, Y473f Mut 1e-31
1h2x_A 710 Prolyl Oligopeptidase From Porcine Brain, Y473f Mut 2e-26
1vz2_A710 Prolyl Oligopeptidase From Porcine Brain, Y73c/v427 1e-133
1vz2_A710 Prolyl Oligopeptidase From Porcine Brain, Y73c/v427 1e-31
1vz2_A 710 Prolyl Oligopeptidase From Porcine Brain, Y73c/v427 2e-26
1o6g_A710 Prolyl Oligopeptidase From Porcine Brain, D641n Mut 1e-133
1o6g_A710 Prolyl Oligopeptidase From Porcine Brain, D641n Mut 4e-31
1o6g_A 710 Prolyl Oligopeptidase From Porcine Brain, D641n Mut 7e-27
1e5t_A710 Prolyl Oligopeptidase From Porcine Brain, Mutant Le 1e-133
1e5t_A710 Prolyl Oligopeptidase From Porcine Brain, Mutant Le 5e-31
1e5t_A 710 Prolyl Oligopeptidase From Porcine Brain, Mutant Le 6e-27
1o6f_A710 Prolyl Oligopeptidase From Porcine Brain, D641a Mut 1e-132
1o6f_A710 Prolyl Oligopeptidase From Porcine Brain, D641a Mut 8e-31
1o6f_A 710 Prolyl Oligopeptidase From Porcine Brain, D641a Mut 7e-27
4ax4_A710 Prolyl Oligopeptidase From Porcine Brain, H680a Mut 1e-132
4ax4_A710 Prolyl Oligopeptidase From Porcine Brain, H680a Mut 1e-30
4ax4_A 710 Prolyl Oligopeptidase From Porcine Brain, H680a Mut 7e-27
1yr2_A741 Structural And Mechanistic Analysis Of Two Prolyl E 1e-94
1yr2_A741 Structural And Mechanistic Analysis Of Two Prolyl E 2e-23
1yr2_A 741 Structural And Mechanistic Analysis Of Two Prolyl E 5e-15
3iun_A693 Appep_d622n Opened State Length = 693 7e-87
3iun_A693 Appep_d622n Opened State Length = 693 4e-25
3iun_A 693 Appep_d622n Opened State Length = 693 4e-16
3mun_A693 Appep_pepclose Closed State Length = 693 4e-86
3mun_A693 Appep_pepclose Closed State Length = 693 1e-25
3mun_A 693 Appep_pepclose Closed State Length = 693 3e-16
3iuj_A693 Appep_wt2 Opened State Length = 693 3e-85
3iuj_A693 Appep_wt2 Opened State Length = 693 2e-24
3iuj_A 693 Appep_wt2 Opened State Length = 693 3e-16
3ivm_A693 Appep_wt+pp Closed State Length = 693 3e-85
3ivm_A693 Appep_wt+pp Closed State Length = 693 2e-24
3ivm_A 693 Appep_wt+pp Closed State Length = 693 3e-16
2bkl_A695 Structural And Mechanistic Analysis Of Two Prolyl E 2e-74
2bkl_A695 Structural And Mechanistic Analysis Of Two Prolyl E 4e-16
2bkl_A 695 Structural And Mechanistic Analysis Of Two Prolyl E 3e-15
4hvt_A711 Structure Of A Post-Proline Cleaving Enzyme From Ri 3e-35
4hvt_A 711 Structure Of A Post-Proline Cleaving Enzyme From Ri 4e-06
2xe4_A751 Structure Of Oligopeptidase B From Leishmania Major 6e-35
2xe4_A 751 Structure Of Oligopeptidase B From Leishmania Major 3e-06
3o4j_A582 Structure And Catalysis Of Acylaminoacyl Peptidase 1e-05
3o4h_A582 Structure And Catalysis Of Acylaminoacyl Peptidase 1e-05
1ve6_A582 Crystal Structure Of An Acylpeptide HydrolaseESTERA 1e-05
2qzp_A562 Crystal Structure Of Mutation Of An Acylptide Hydro 2e-05
2hu8_A582 Binding Of Inhibitors By Acylaminoacyl Peptidase Le 3e-05
2qr5_A582 Aeropyrum Pernix Acylaminoacyl Peptidase, H367a Mut 3e-05
>pdb|1QFM|A Chain A, Prolyl Oligopeptidase From Porcine Muscle Length = 710 Back     alignment and structure 
Iteration: 1

 Score =  486 bits (1250), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 238/452 (52%), Positives = 298/452 (65%), Gaps = 55/452 (12%)
Query: 253 YITNEGPQFVFKTNKDAPNYRLITIDFDNFAESNWKTLIEENKDDVLDWATCVANDKLIL 312
           Y+TNEG  F FKTN+ +PNYRLI IDF +  ES WK L+ E++ DVL+W  CV ++ L+L
Sbjct: 292 YVTNEGTVFTFKTNRHSPNYRLINIDFTDPEESKWKVLVPEHEKDVLEWVACVRSNFLVL 351
Query: 313 SYIHHVKNVMHLHDLASGKHLYTFPLDVGTIVGFSGKKKYSEIFYSFMSFLQPTIIFHCN 372
            Y+H VKN + LHDLA+G  L  FPL+VG++VG+SG+KK +EIFY F SFL P II+HC+
Sbjct: 352 CYLHDVKNTLQLHDLATGALLKIFPLEVGSVVGYSGQKKDTEIFYQFTSFLSPGIIYHCD 411
Query: 373 IPARVDPNSKLETSIFREIKVPDFDPSLFETKQVFYPSKDGTKIPMFILSRKGAQLDGNN 432
           +        +LE  +FRE+ V   D S ++T Q+FYPSKDGTKIPMFI+ +KG +LDG++
Sbjct: 412 LT-----KEELEPRVFREVTVKGIDASDYQTVQIFYPSKDGTKIPMFIVHKKGIKLDGSH 466
Query: 433 PCILYGYGGFAVSLQPGFSVTKIVFLRDFNGIYAIPNIRGGGEYGERWHDGGRLLNKQNV 492
           P  LYGYGGF +S+ P +SV++++F+R   G+ A+ NIRGGGEYGE WH GG L NKQN 
Sbjct: 467 PAFLYGYGGFNISITPNYSVSRLIFVRHMGGVLAVANIRGGGEYGETWHKGGILANKQNC 526
Query: 493 FDDFQCAAEYLIASGYTQSSRLAIQGGSNGGLLTAACINQRPDLFGAAIVQVGNPEISDC 552
           FDDFQCAAEYLI  GYT   RL I GGSNGGLL A C NQRPDLFG  I QVG       
Sbjct: 527 FDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLVATCANQRPDLFGCVIAQVG------- 579
Query: 553 GRWLIVHTMKDCKNNMFHFCDLDTIPDRKIEGKLPLTQVVHKVLDMLKFNKFTIGYFWES 612
                                                     V+DMLKF+K+TIG+ W +
Sbjct: 580 ------------------------------------------VMDMLKFHKYTIGHAWTT 597
Query: 613 DYGSPANSSQFEYLLGYSPLHNIQGPDELKGKQYPATLLMTADHDDRVSPVHSLKFAATL 672
           DYG   +   FE+L+ YSPLHN++ P E    QYP+ LL+TADHDDRV P+HSLKF ATL
Sbjct: 598 DYGXSDSKQHFEWLIKYSPLHNVKLP-EADDIQYPSMLLLTADHDDRVVPLHSLKFIATL 656
Query: 673 QEKLRDYPHQTNPLLIRIETKAGHGGGKPTTK 704
           Q  +     Q NPLLI ++TKAGHG GKPT K
Sbjct: 657 QYIVGRSRKQNNPLLIHVDTKAGHGAGKPTAK 688
>pdb|1QFM|A Chain A, Prolyl Oligopeptidase From Porcine Muscle Length = 710 Back     alignment and structure
>pdb|1QFM|A Chain A, Prolyl Oligopeptidase From Porcine Muscle Length = 710 Back     alignment and structure
>pdb|1VZ3|A Chain A, Prolyl Oligopeptidase From Porcine Brain, T597c Mutant Length = 710 Back     alignment and structure
>pdb|1VZ3|A Chain A, Prolyl Oligopeptidase From Porcine Brain, T597c Mutant Length = 710 Back     alignment and structure
>pdb|1VZ3|A Chain A, Prolyl Oligopeptidase From Porcine Brain, T597c Mutant Length = 710 Back     alignment and structure
>pdb|3DDU|A Chain A, Prolyl Oligopeptidase With Gsk552 Length = 709 Back     alignment and structure
>pdb|3DDU|A Chain A, Prolyl Oligopeptidase With Gsk552 Length = 709 Back     alignment and structure
>pdb|3DDU|A Chain A, Prolyl Oligopeptidase With Gsk552 Length = 709 Back     alignment and structure
>pdb|1QFS|A Chain A, Prolyl Oligopeptidase From Porcine Muscle With Covalently Bound Inhibitor Z-Pro-Prolinal Length = 710 Back     alignment and structure
>pdb|1QFS|A Chain A, Prolyl Oligopeptidase From Porcine Muscle With Covalently Bound Inhibitor Z-Pro-Prolinal Length = 710 Back     alignment and structure
>pdb|1QFS|A Chain A, Prolyl Oligopeptidase From Porcine Muscle With Covalently Bound Inhibitor Z-Pro-Prolinal Length = 710 Back     alignment and structure
>pdb|1E8M|A Chain A, Prolyl Oligopeptidase From Porcine Brain, Mutant, Complexed With Inhibitor Length = 710 Back     alignment and structure
>pdb|1E8M|A Chain A, Prolyl Oligopeptidase From Porcine Brain, Mutant, Complexed With Inhibitor Length = 710 Back     alignment and structure
>pdb|1E8M|A Chain A, Prolyl Oligopeptidase From Porcine Brain, Mutant, Complexed With Inhibitor Length = 710 Back     alignment and structure
>pdb|1H2X|A Chain A, Prolyl Oligopeptidase From Porcine Brain, Y473f Mutant Length = 710 Back     alignment and structure
>pdb|1H2X|A Chain A, Prolyl Oligopeptidase From Porcine Brain, Y473f Mutant Length = 710 Back     alignment and structure
>pdb|1H2X|A Chain A, Prolyl Oligopeptidase From Porcine Brain, Y473f Mutant Length = 710 Back     alignment and structure
>pdb|1VZ2|A Chain A, Prolyl Oligopeptidase From Porcine Brain, Y73c/v427c/c255t Mutant Length = 710 Back     alignment and structure
>pdb|1VZ2|A Chain A, Prolyl Oligopeptidase From Porcine Brain, Y73c/v427c/c255t Mutant Length = 710 Back     alignment and structure
>pdb|1VZ2|A Chain A, Prolyl Oligopeptidase From Porcine Brain, Y73c/v427c/c255t Mutant Length = 710 Back     alignment and structure
>pdb|1O6G|A Chain A, Prolyl Oligopeptidase From Porcine Brain, D641n Mutant With Bound Peptide Ligand Suc-Gly-Pro Length = 710 Back     alignment and structure
>pdb|1O6G|A Chain A, Prolyl Oligopeptidase From Porcine Brain, D641n Mutant With Bound Peptide Ligand Suc-Gly-Pro Length = 710 Back     alignment and structure
>pdb|1O6G|A Chain A, Prolyl Oligopeptidase From Porcine Brain, D641n Mutant With Bound Peptide Ligand Suc-Gly-Pro Length = 710 Back     alignment and structure
>pdb|1E5T|A Chain A, Prolyl Oligopeptidase From Porcine Brain, Mutant Length = 710 Back     alignment and structure
>pdb|1E5T|A Chain A, Prolyl Oligopeptidase From Porcine Brain, Mutant Length = 710 Back     alignment and structure
>pdb|1E5T|A Chain A, Prolyl Oligopeptidase From Porcine Brain, Mutant Length = 710 Back     alignment and structure
>pdb|1O6F|A Chain A, Prolyl Oligopeptidase From Porcine Brain, D641a Mutant With Bound Peptide Ligand Suc-Gly-Pro Length = 710 Back     alignment and structure
>pdb|1O6F|A Chain A, Prolyl Oligopeptidase From Porcine Brain, D641a Mutant With Bound Peptide Ligand Suc-Gly-Pro Length = 710 Back     alignment and structure
>pdb|1O6F|A Chain A, Prolyl Oligopeptidase From Porcine Brain, D641a Mutant With Bound Peptide Ligand Suc-Gly-Pro Length = 710 Back     alignment and structure
>pdb|4AX4|A Chain A, Prolyl Oligopeptidase From Porcine Brain, H680a Mutant Length = 710 Back     alignment and structure
>pdb|4AX4|A Chain A, Prolyl Oligopeptidase From Porcine Brain, H680a Mutant Length = 710 Back     alignment and structure
>pdb|4AX4|A Chain A, Prolyl Oligopeptidase From Porcine Brain, H680a Mutant Length = 710 Back     alignment and structure
>pdb|1YR2|A Chain A, Structural And Mechanistic Analysis Of Two Prolyl Endopeptidases: Role Of Inter-Domain Dynamics In Catalysis And Specificity Length = 741 Back     alignment and structure
>pdb|1YR2|A Chain A, Structural And Mechanistic Analysis Of Two Prolyl Endopeptidases: Role Of Inter-Domain Dynamics In Catalysis And Specificity Length = 741 Back     alignment and structure
>pdb|1YR2|A Chain A, Structural And Mechanistic Analysis Of Two Prolyl Endopeptidases: Role Of Inter-Domain Dynamics In Catalysis And Specificity Length = 741 Back     alignment and structure
>pdb|3IUN|A Chain A, Appep_d622n Opened State Length = 693 Back     alignment and structure
>pdb|3IUN|A Chain A, Appep_d622n Opened State Length = 693 Back     alignment and structure
>pdb|3IUN|A Chain A, Appep_d622n Opened State Length = 693 Back     alignment and structure
>pdb|3MUN|A Chain A, Appep_pepclose Closed State Length = 693 Back     alignment and structure
>pdb|3MUN|A Chain A, Appep_pepclose Closed State Length = 693 Back     alignment and structure
>pdb|3MUN|A Chain A, Appep_pepclose Closed State Length = 693 Back     alignment and structure
>pdb|3IUJ|A Chain A, Appep_wt2 Opened State Length = 693 Back     alignment and structure
>pdb|3IUJ|A Chain A, Appep_wt2 Opened State Length = 693 Back     alignment and structure
>pdb|3IUJ|A Chain A, Appep_wt2 Opened State Length = 693 Back     alignment and structure
>pdb|3IVM|A Chain A, Appep_wt+pp Closed State Length = 693 Back     alignment and structure
>pdb|3IVM|A Chain A, Appep_wt+pp Closed State Length = 693 Back     alignment and structure
>pdb|3IVM|A Chain A, Appep_wt+pp Closed State Length = 693 Back     alignment and structure
>pdb|2BKL|A Chain A, Structural And Mechanistic Analysis Of Two Prolyl Endopeptidases: Role Of Inter-Domain Dynamics In Catalysis And Specificity Length = 695 Back     alignment and structure
>pdb|2BKL|A Chain A, Structural And Mechanistic Analysis Of Two Prolyl Endopeptidases: Role Of Inter-Domain Dynamics In Catalysis And Specificity Length = 695 Back     alignment and structure
>pdb|2BKL|A Chain A, Structural And Mechanistic Analysis Of Two Prolyl Endopeptidases: Role Of Inter-Domain Dynamics In Catalysis And Specificity Length = 695 Back     alignment and structure
>pdb|4HVT|A Chain A, Structure Of A Post-Proline Cleaving Enzyme From Rickettsia Typhi Length = 711 Back     alignment and structure
>pdb|4HVT|A Chain A, Structure Of A Post-Proline Cleaving Enzyme From Rickettsia Typhi Length = 711 Back     alignment and structure
>pdb|2XE4|A Chain A, Structure Of Oligopeptidase B From Leishmania Major Length = 751 Back     alignment and structure
>pdb|2XE4|A Chain A, Structure Of Oligopeptidase B From Leishmania Major Length = 751 Back     alignment and structure
>pdb|3O4J|A Chain A, Structure And Catalysis Of Acylaminoacyl Peptidase Length = 582 Back     alignment and structure
>pdb|3O4H|A Chain A, Structure And Catalysis Of Acylaminoacyl Peptidase Length = 582 Back     alignment and structure
>pdb|1VE6|A Chain A, Crystal Structure Of An Acylpeptide HydrolaseESTERASE FROM Aeropyrum Pernix K1 Length = 582 Back     alignment and structure
>pdb|2QZP|A Chain A, Crystal Structure Of Mutation Of An Acylptide HydrolaseESTERASE FROM AEROPYRUM PERNIX K1 Length = 562 Back     alignment and structure
>pdb|2HU8|A Chain A, Binding Of Inhibitors By Acylaminoacyl Peptidase Length = 582 Back     alignment and structure
>pdb|2QR5|A Chain A, Aeropyrum Pernix Acylaminoacyl Peptidase, H367a Mutant Length = 582 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1012
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 100.0
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 100.0
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 100.0
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 100.0
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 100.0
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 100.0
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 100.0
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 100.0
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 100.0
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 100.0
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 100.0
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 100.0
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 100.0
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.93
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.93
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.93
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.93
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.93
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.92
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.9
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.9
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.9
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.89
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 99.89
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.88
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 99.76
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 99.75
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 99.74
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 99.73
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 99.73
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 99.72
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 99.72
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 99.71
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 99.69
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 99.69
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 99.68
1mpx_A615 Alpha-amino acid ester hydrolase; alpha/beta hydro 99.66
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 99.66
3bjr_A283 Putative carboxylesterase; structural genomics, jo 99.65
2b9v_A652 Alpha-amino acid ester hydrolase; catalytic triad, 99.65
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 99.64
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 99.63
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 99.63
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 99.63
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 99.63
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 99.63
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 99.62
3ain_A323 303AA long hypothetical esterase; carboxylesterase 99.62
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 99.62
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 99.62
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 99.61
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 99.61
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 99.61
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 99.6
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 99.6
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 99.6
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 99.59
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 99.59
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 99.58
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 99.57
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 99.57
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 99.57
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.55
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 99.55
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 99.55
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 99.54
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 99.54
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 99.54
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 99.53
3h04_A275 Uncharacterized protein; protein with unknown func 99.53
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 99.53
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 99.52
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 99.51
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 99.5
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 99.5
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 99.5
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 99.5
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.5
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 99.5
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.49
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 99.49
1lns_A763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 99.49
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 99.48
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 99.48
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.47
3iii_A560 COCE/NOND family hydrolase; structural genomics, c 99.46
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 99.46
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 99.44
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 99.43
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 99.43
3llc_A270 Putative hydrolase; structural genomics, joint cen 99.42
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 99.42
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 99.42
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 99.41
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.4
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 99.4
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 99.4
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 99.4
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.39
1vkh_A273 Putative serine hydrolase; structural genomics, jo 99.39
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 99.39
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.39
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 99.38
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 99.38
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 99.37
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.35
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 99.35
3i2k_A587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 99.33
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 99.33
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 99.32
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 99.32
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 99.32
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 99.32
3d59_A383 Platelet-activating factor acetylhydrolase; secret 99.31
4f21_A246 Carboxylesterase/phospholipase family protein; str 99.31
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 99.3
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 99.29
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 99.29
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 99.29
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 99.29
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 99.28
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 99.26
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 99.26
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 99.25
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 99.25
4fle_A202 Esterase; structural genomics, PSI-biology, northe 99.24
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 99.22
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 99.21
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 99.21
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.18
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 99.18
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 99.16
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 99.15
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.15
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 99.14
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 99.14
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 99.12
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 99.12
3nuz_A398 Putative acetyl xylan esterase; structural genomic 99.12
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 99.07
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 99.07
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 99.07
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 99.07
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 99.07
3vdx_A456 Designed 16NM tetrahedral protein CAGE containing 99.06
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 99.05
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 99.05
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 99.05
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 99.05
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 99.04
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 99.04
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 99.03
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 99.03
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 99.02
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 99.02
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 99.01
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 99.01
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 99.01
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 99.01
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 99.01
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 99.0
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 99.0
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 99.0
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 99.0
1qe3_A489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 99.0
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 98.99
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 98.99
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 98.99
1k32_A1045 Tricorn protease; protein degradation, substrate g 98.98
3gff_A331 IROE-like serine hydrolase; NP_718593.1, structura 98.98
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 98.98
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 98.97
1k32_A 1045 Tricorn protease; protein degradation, substrate g 98.97
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 98.97
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.96
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 98.96
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 98.93
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 98.92
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 98.92
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 98.92
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 98.91
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 98.9
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 98.9
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 98.89
1iup_A282 META-cleavage product hydrolase; aromatic compound 98.89
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 98.88
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 98.87
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 98.87
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 98.87
2d81_A318 PHB depolymerase; alpha/beta hydrolase fold, circu 98.86
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 98.86
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 98.86
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 98.83
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 98.83
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 98.82
1ukc_A522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 98.82
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 98.81
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 98.81
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 98.81
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 98.81
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 98.79
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 98.78
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 98.78
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 98.77
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.77
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 98.77
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 98.75
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 98.73
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 98.73
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 98.72
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 98.72
4fol_A299 FGH, S-formylglutathione hydrolase; D-type esteras 98.71
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 98.71
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 98.71
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 98.71
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 98.7
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 98.69
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 98.68
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 98.68
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 98.67
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 98.67
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 98.67
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 98.66
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 98.65
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 98.64
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 98.64
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 98.64
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 98.64
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 98.64
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 98.62
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 98.61
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 98.6
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 98.59
3bjr_A283 Putative carboxylesterase; structural genomics, jo 98.59
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 98.58
3pic_A375 CIP2; alpha/beta hydrolase fold, glucuronoyl ester 98.56
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 98.56
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 98.55
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.55
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 98.55
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.55
2h7c_A542 Liver carboxylesterase 1; enzyme, cholesteryl este 98.53
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 98.51
4g4g_A433 4-O-methyl-glucuronoyl methylesterase; alpha/beta 98.51
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 98.51
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 98.5
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.47
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.44
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.44
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 97.81
2ha2_A543 ACHE, acetylcholinesterase; hydrolase fold, serine 98.43
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 98.42
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 98.41
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 98.4
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 98.39
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 98.39
2ogt_A498 Thermostable carboxylesterase EST50; alpha/beta hy 98.39
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 98.38
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.38
1llf_A534 Lipase 3; candida cylindracea cholesterol esterase 98.36
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 98.35
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 98.34
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 98.33
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 98.33
1thg_A544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 98.32
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 98.32
1p0i_A529 Cholinesterase; serine hydrolase, butyrate, hydrol 98.31
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 98.31
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 98.29
2fj0_A551 JuvenIle hormone esterase; manduca sexta, alpha-be 98.28
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 98.26
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 98.25
1ea5_A537 ACHE, acetylcholinesterase; hydrolase, serine hydr 98.25
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.24
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 98.24
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 98.23
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 98.23
2d81_A318 PHB depolymerase; alpha/beta hydrolase fold, circu 98.23
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 98.21
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 98.21
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.2
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.2
1dx4_A585 ACHE, acetylcholinesterase; hydrolase, serine este 98.19
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 98.19
3ow8_A321 WD repeat-containing protein 61; structural genomi 98.18
4fle_A202 Esterase; structural genomics, PSI-biology, northe 98.18
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 98.17
2bce_A579 Cholesterol esterase; hydrolase, serine esterase, 98.17
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 98.16
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 98.16
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 98.15
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 98.12
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 98.12
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 98.11
1gpl_A432 RP2 lipase; serine esterase, hydrolase, lipid degr 98.11
3ow8_A321 WD repeat-containing protein 61; structural genomi 98.1
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 98.1
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 98.1
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 98.08
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.08
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 98.08
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 98.08
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 98.07
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 98.07
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 98.07
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 98.05
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 98.04
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 98.04
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 98.03
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 98.03
1r3d_A264 Conserved hypothetical protein VC1974; structural 98.03
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 98.02
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 98.01
1vkh_A273 Putative serine hydrolase; structural genomics, jo 98.01
3bix_A574 Neuroligin-1, neuroligin I; esterase domain, alpha 98.01
2ymu_A577 WD-40 repeat protein; unknown function, two domain 98.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 97.99
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 97.98
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.97
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 97.97
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 97.96
3ain_A323 303AA long hypothetical esterase; carboxylesterase 97.96
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 97.95
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 97.94
1kez_A300 Erythronolide synthase; polyketide synthase, modul 97.94
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 97.94
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.94
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 97.93
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 97.93
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 97.93
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 97.92
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.92
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 97.92
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 97.92
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 97.92
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 97.92
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 97.9
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 97.9
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 97.88
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 97.88
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 97.88
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 97.87
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.87
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 97.85
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 97.84
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 97.84
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 97.83
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 97.82
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 97.82
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 97.82
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 97.81
1bu8_A452 Protein (pancreatic lipase related protein 2); hyd 97.81
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 97.81
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 97.8
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 97.8
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 97.8
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 97.8
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 97.79
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 97.79
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 97.79
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.78
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.77
4g56_B357 MGC81050 protein; protein arginine methyltransfera 97.76
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.75
3llc_A270 Putative hydrolase; structural genomics, joint cen 97.74
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 97.74
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 97.74
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 97.74
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 97.74
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 97.73
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 97.73
1w52_X452 Pancreatic lipase related protein 2; detergent, cl 97.72
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 97.71
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 97.71
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 97.7
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 97.68
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 97.67
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 97.67
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 97.65
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 97.65
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 97.65
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 97.63
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 97.63
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 97.63
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 97.63
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 97.63
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 97.62
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 97.62
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 97.61
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 97.61
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 97.6
3lp5_A250 Putative cell surface hydrolase; structural genom 97.6
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 97.59
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 97.59
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 97.59
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 97.58
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 97.58
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 97.58
3gff_A331 IROE-like serine hydrolase; NP_718593.1, structura 97.56
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 97.55
3n2z_B446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 97.55
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.54
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 97.54
4g56_B357 MGC81050 protein; protein arginine methyltransfera 97.53
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 97.53
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 97.52
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 97.51
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 97.51
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 97.51
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 97.5
1hpl_A449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 97.49
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 97.48
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 97.46
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 97.46
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 97.43
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 97.43
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 97.42
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 97.41
3jrp_A379 Fusion protein of protein transport protein SEC13 97.4
1qe3_A489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 97.39
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 97.38
1rp1_A450 Pancreatic lipase related protein 1; hydrolase, li 97.37
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 97.37
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 97.34
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 97.32
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 97.31
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 97.29
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 97.27
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 97.27
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 97.27
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 97.26
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 97.26
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 97.24
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 97.24
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 97.22
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 97.22
4f21_A246 Carboxylesterase/phospholipase family protein; str 97.22
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.21
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 97.2
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 97.19
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 97.19
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 97.18
4e54_B435 DNA damage-binding protein 2; beta barrel, double 97.17
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 97.16
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 97.14
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 97.14
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 97.14
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 97.13
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 97.12
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 97.11
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 97.11
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 97.11
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.11
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 97.09
3jrp_A379 Fusion protein of protein transport protein SEC13 97.08
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 97.07
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 97.06
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 97.06
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 97.03
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 97.03
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 97.03
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 97.02
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 97.01
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 97.01
3d59_A383 Platelet-activating factor acetylhydrolase; secret 97.0
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 96.94
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 96.93
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 96.92
4e54_B435 DNA damage-binding protein 2; beta barrel, double 96.9
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 96.87
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 96.87
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 96.87
2xyi_A430 Probable histone-binding protein CAF1; transcripti 96.86
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 96.86
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 96.82
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 96.8
2xyi_A430 Probable histone-binding protein CAF1; transcripti 96.8
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 96.8
3v65_B386 Low-density lipoprotein receptor-related protein; 96.78
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 96.77
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 96.76
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 96.75
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 96.74
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 96.73
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 96.73
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 96.72
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 96.68
2zyr_A484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 96.68
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 96.65
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 96.65
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 96.64
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 96.61
3jro_A753 Fusion protein of protein transport protein SEC13 96.6
3vdx_A456 Designed 16NM tetrahedral protein CAGE containing 96.59
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 96.58
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 96.55
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 96.54
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 96.54
2hih_A431 Lipase 46 kDa form; A1 phospholipase, phospholipid 96.54
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 96.53
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
Probab=100.00  E-value=1e-75  Score=726.88  Aligned_cols=614  Identities=43%  Similarity=0.777  Sum_probs=513.4

Q ss_pred             cCCCCCCccCcceeecccCccccCCCCCCCCCCCHHHHHHHHHhhhchHhhhccCCChHHHHHHHhhcccCCCCCCCeee
Q psy1288          35 KFEYPKARKNESLVDEYHGVKIPDPYGWMEDPDSEETKKFVDEENAISRPYLEDHPDRDKVKAELTKMWDYPKYSSPQRQ  114 (1012)
Q Consensus        35 ~~~~P~a~~~~~~~~~~hG~~~~Dpy~WLed~~~~~~~~~l~~qn~~t~~~l~~~~~~~~l~~~~~~~~~~~~~s~p~~d  114 (1012)
                      .+.||+|+|+|++ +++||+++.|||+||||.++|+|++||++||+||+++|++++++++|++||+++++++++++|+++
T Consensus         9 ~~~~p~~~~~~~~-~~~~g~~~~d~y~wl~~~~~~~~~~~~~~~n~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~p~~~   87 (693)
T 3iuj_A            9 RLHYPVTRQGEQV-DHYFGQAVADPYRWLEDDRSPETEAWVKAQNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFRE   87 (693)
T ss_dssp             -CCCCCCCCCCCE-EEETTEEEECTTGGGGCTTSHHHHHHHHHHHHHHHHHHTTCTTHHHHHHHHHHHSCCCEECCCEEE
T ss_pred             CCCCCCCCCCCeE-EEeCCccccCCchhhcCCCCHHHHHHHHHHHHHHHHHHccChhHHHHHHHHHHhhccccCCCCEEE
Confidence            3579999999965 999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCEEEEEEEcCCCCeeEEEEEeCCCCceEEEcCCCCCCCCCceEeeeEEECCCCcEEEEEEeCCCCceEEEEEEECCCCc
Q psy1288         115 GDHYFFFHNTGLQNHSVMYIQDSLDGEARVFLDPNNLSDDGTVSLGSYSFSEDGKTLAYCLSSSGSDWTSMHFKDVATGK  194 (1012)
Q Consensus       115 G~~~yy~~~~~~~~~~~l~~~~~~~g~~~~L~D~n~la~~g~~~i~~~~~SPDGk~iAy~~~~~G~~~~~L~v~dl~tg~  194 (1012)
                      |+++||.+++++++++.+||++. ++++++|+|+|++++++.+.++.++|||||++|||+.+..|+++++|+++|+++|+
T Consensus        88 g~~~y~~~~~~~~~~~~~~r~~~-~~~~~vllD~n~la~~~~~~l~~~~~SpDg~~lAy~~~~~G~~~~~i~v~dl~tg~  166 (693)
T 3iuj_A           88 GRYHYFFKNDGLQNQNVLWRQQE-GKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLAGSDWREIHLMDVESKQ  166 (693)
T ss_dssp             TTEEEEEEECSSCSSCEEEEECT-TSCCEEEECGGGGSTTSCCEEEEEEECTTSSEEEEEEECSSCCEEEEEEEETTTCS
T ss_pred             CCEEEEEEEcCCCceeEEEEeCC-CCCcEEEEehhhccCCCcEEEEEEEECCCCCEEEEEEecCCCceEEEEEEECCCCC
Confidence            99999999999888899999764 56789999999999998889999999999999999999999999999999999999


Q ss_pred             eeceeecceeeeeeEEeeCCCeEEEEecCCC--------C---------Ccc---------cCCC-------------CC
Q psy1288         195 EYPEVLHRLKFVSIAWTHDHKGVFYSNQEPK--------S---------KSK---------KHSK-------------KN  235 (1012)
Q Consensus       195 ~~~~t~~~~~~~~~~WSpDG~~l~y~~~~~~--------~---------~g~---------~~~~-------------~~  235 (1012)
                      .+++++...++++++|| ||+.|+|++.+..        .         .++         ....             ..
T Consensus       167 ~~~~~~~~~k~~~~~Ws-Dg~~l~y~~~~~~~~~~~~~~~~~~~v~~~~lgt~~~~~~~v~~~~~~~~~~~~~~~~SpDg  245 (693)
T 3iuj_A          167 PLETPLKDVKFSGISWL-GNEGFFYSSYDKPDGSELSARTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDD  245 (693)
T ss_dssp             EEEEEEEEEESCCCEEE-TTTEEEEEESSCCC-------CCCCEEEEEETTSCGGGCEEEESCSGGGCCSEEEEEECTTS
T ss_pred             CCccccCCceeccEEEe-CCCEEEEEEecCcccccccccCCCcEEEEEECCCCcccceEEEecCCCCCeEEEEEEEcCCC
Confidence            88877777656889999 9999999986532        0         111         0000             00


Q ss_pred             ceEEEEeecc----c--------c--c---e------eeeeeecCCCEEEEEECCCCCCceEEEEeCCCCcccCcEEeec
Q psy1288         236 RSSAYHLTVN----V--------A--P---I------TSQYITNEGPQFVFKTNKDAPNYRLITIDFDNFAESNWKTLIE  292 (1012)
Q Consensus       236 ~~l~~~~~~~----~--------~--~---i------~~~~~s~dg~~l~~~tn~~~~~~~L~~~dl~~~~~~~~~~l~~  292 (1012)
                      ..+++.....    .        .  .   +      .+..|+++|++|||++|+++++++|+.+++++++...|+.|++
T Consensus       246 ~~l~~~~~~~~~~~~i~~~d~~~~~~~~~~l~~~~~~~~~~~~~~g~~l~~~t~~~~~~~~l~~~d~~~~~~~~~~~l~~  325 (693)
T 3iuj_A          246 RFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNRDAPNRRLVTVDAANPGPAHWRDLIP  325 (693)
T ss_dssp             CEEEEEEESSSSCCEEEEEETTSTTCCCEEEECSSSSCEEEEEEETTEEEEEECTTCTTCEEEEEETTSCCGGGCEEEEC
T ss_pred             CEEEEEEccCCCCcEEEEEECCCCCCceEEEeCCCCceEEEEeccCCEEEEEECCCCCCCEEEEEeCCCCCccccEEEec
Confidence            0111111100    0        0  0   1      1234889999999999998889999999998877667899998


Q ss_pred             cCCCceeeeeEEecCCEEEEEEEcCceEEEEEEecCCCceeeeecCC-ceEEEeecccccCcEEEEEecCCCCCcEEEEE
Q psy1288         293 ENKDDVLDWATCVANDKLILSYIHHVKNVMHLHDLASGKHLYTFPLD-VGTIVGFSGKKKYSEIFYSFMSFLQPTIIFHC  371 (1012)
Q Consensus       293 ~~~~~~~~~~~~~~~~~l~~~~~~~g~~~l~~~dl~~G~~~~~l~~~-~~~v~~~~~spdg~~l~~~~ss~~~p~~l~~~  371 (1012)
                      +.+.. + .+... +++|++.+.+++..+|++++++ |+..+.++++ .+.+..++++++++.++|.++++.+|.++|.+
T Consensus       326 ~~~~~-~-~~s~~-g~~lv~~~~~~g~~~l~~~d~~-g~~~~~l~~p~~~~~~~~~~~~d~~~l~~~~ss~~tP~~l~~~  401 (693)
T 3iuj_A          326 ERQQV-L-TVHSG-SGYLFAEYMVDATARVEQFDYE-GKRVREVALPGLGSVSGFNGKHDDPALYFGFENYAQPPTLYRF  401 (693)
T ss_dssp             CCSSC-E-EEEEE-TTEEEEEEEETTEEEEEEECTT-SCEEEEECCSSSSEEEECCCCTTCSCEEEEEECSSSCCEEEEE
T ss_pred             CCCCE-E-EEEEE-CCEEEEEEEECCeeEEEEEECC-CCeeEEeecCCCceEEeeecCCCCCEEEEEecCCCCCCEEEEE
Confidence            87654 4 44444 4899999999999999999995 5555677766 56777888899999999999999999999999


Q ss_pred             eCCCCCCCCCCcceEEEEeccCCCCCCCCCceEEEEEECCCCceEEEEEEEeCCCCCCCCCcEEEEEcCCCCCCCCCCcC
Q psy1288         372 NIPARVDPNSKLETSIFREIKVPDFDPSLFETKQVFYPSKDGTKIPMFILSRKGAQLDGNNPCILYGYGGFAVSLQPGFS  451 (1012)
Q Consensus       372 d~~~~~~~~g~~~~~~l~~~~~~~~~~~~~~~~~v~~~s~DG~~i~~~l~~p~~~~~~~~~P~vv~~hGg~~~~~~~~~~  451 (1012)
                      |+     +++  +.++++.... .+++..+.++++++++.||.+|++++++|++...+++.|+||++|||++....+.|+
T Consensus       402 d~-----~~g--~~~~l~~~~~-~~~~~~~~~~~~~~~~~dg~~i~~~l~~p~~~~~~~~~P~ll~~hGg~~~~~~~~~~  473 (693)
T 3iuj_A          402 EP-----KSG--AISLYRASAA-PFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKLDGSNPTILYGYGGFDVSLTPSFS  473 (693)
T ss_dssp             CT-----TTC--CEEEEECCCS-SCCGGGEEEEEEEEECTTSCEEEEEEEEESSCCCSSCCCEEEECCCCTTCCCCCCCC
T ss_pred             EC-----CCC--eEEEEEeCCC-CcChhhCeeEEEEEecCCCcEEEEEEEecCCCCCCCCccEEEEECCCCCcCCCCccC
Confidence            99     466  5677776544 477778889999999999999999999999876678899999999999888888998


Q ss_pred             hhHHHHHHhCCeEEEEEcCCCCCCCchhHHhhhhcCCCcchHhHHHHHHHHHHHcCCCCCCcEEEEecChHHHHHHHHHh
Q psy1288         452 VTKIVFLRDFNGIYAIPNIRGGGEYGERWHDGGRLLNKQNVFDDFQCAAEYLIASGYTQSSRLAIQGGSNGGLLTAACIN  531 (1012)
Q Consensus       452 ~~~~~~l~~~G~~v~~~d~RG~g~~g~~~~~~~~~~~~~~~~~D~~a~~~~l~~~~~~d~~~i~i~G~S~GG~l~~~~~~  531 (1012)
                      .....+++ +||+|+++|+||++++|..|+..+....+.+.++|+.+++++|++++.+++++|+|+|+|+||++++++++
T Consensus       474 ~~~~~l~~-~G~~v~~~d~RG~g~~g~~~~~~~~~~~~~~~~~D~~~~~~~l~~~~~~d~~ri~i~G~S~GG~la~~~~~  552 (693)
T 3iuj_A          474 VSVANWLD-LGGVYAVANLRGGGEYGQAWHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAVMT  552 (693)
T ss_dssp             HHHHHHHH-TTCEEEEECCTTSSTTCHHHHHTTSGGGTHHHHHHHHHHHHHHHHTTSCCGGGEEEEEETHHHHHHHHHHH
T ss_pred             HHHHHHHH-CCCEEEEEeCCCCCccCHHHHHhhhhhcCCCcHHHHHHHHHHHHHcCCCCcceEEEEEECHHHHHHHHHHh
Confidence            87655555 79999999999999999999999888888899999999999999999999999999999999999999999


Q ss_pred             hCCCceeEEEEccCCCccccCcceeeeecccccccCcccccccCCCCcccccCCCCcchhhhhhhhhhhccccccccccc
Q psy1288         532 QRPDLFGAAIVQVGNPEISDCGRWLIVHTMKDCKNNMFHFCDLDTIPDRKIEGKLPLTQVVHKVLDMLKFNKFTIGYFWE  611 (1012)
Q Consensus       532 ~~p~~f~a~v~~~~~~~i~d~~~~~~~~~~~~~~~~~~~~~dl~~~~~~~~~~~~plt~~~~~~~d~~~~~~~~~g~~~~  611 (1012)
                      ++|++|+++|+.+|   +                                              .|++.+..+..+..|.
T Consensus       553 ~~p~~~~a~v~~~~---~----------------------------------------------~d~~~~~~~~~~~~~~  583 (693)
T 3iuj_A          553 QRPDLMRVALPAVG---V----------------------------------------------LDMLRYHTFTAGTGWA  583 (693)
T ss_dssp             HCTTSCSEEEEESC---C----------------------------------------------CCTTTGGGSGGGGGCH
T ss_pred             hCccceeEEEecCC---c----------------------------------------------chhhhhccCCCchhHH
Confidence            99999999999999   2                                              2223333344555677


Q ss_pred             cccCCCCChHH-HHHHHcCCcccCCCCCCcccC-CCCCcEEEEeeCCCCCCChHHHHHHHHHHHhhhccCCCCCCcEEEE
Q psy1288         612 SDYGSPANSSQ-FEYLLGYSPLHNIQGPDELKG-KQYPATLLMTADHDDRVSPVHSLKFAATLQEKLRDYPHQTNPLLIR  689 (1012)
Q Consensus       612 ~~~g~p~~~~~-~~~~~~~sP~~~~~~p~~~~~-~~~P~vLiihG~~D~~v~~~~s~~~~~~L~~~~~~~~~~~~~~~l~  689 (1012)
                      .+||+|.+++. ++.+..+||+.++.      . +++|++|++||.+|++|++.++.+++++|+++    ..++.+++++
T Consensus       584 ~~~g~p~~~~~~~~~~~~~sp~~~~~------~~~~~Pp~Li~~G~~D~~v~~~~~~~~~~~l~~~----~~~~~~~~~~  653 (693)
T 3iuj_A          584 YDYGTSADSEAMFDYLKGYSPLHNVR------PGVSYPSTMVTTADHDDRVVPAHSFKFAATLQAD----NAGPHPQLIR  653 (693)
T ss_dssp             HHHCCTTSCHHHHHHHHHHCHHHHCC------TTCCCCEEEEEEESSCSSSCTHHHHHHHHHHHHH----CCSSSCEEEE
T ss_pred             HHcCCccCHHHHHHHHHhcCHHHhhc------ccCCCCceeEEecCCCCCCChhHHHHHHHHHHhh----CCCCCCEEEE
Confidence            78999987777 88899999999988      5 79999999999999999999999999999988    2224799999


Q ss_pred             EeCCCCCCCCCccccchhhhhHHHHHHHHhCCCC
Q psy1288         690 IETKAGHGGGKPTTKQFPLTIPVIYFYLTSGPVL  723 (1012)
Q Consensus       690 ~~p~~gHg~~~~~~~~~~~~~~~~~fl~~~l~~~  723 (1012)
                      +++++||++........+..+++++||.++++..
T Consensus       654 ~~~~~gH~~~~~~~~~~~~~~~~~~fl~~~l~~~  687 (693)
T 3iuj_A          654 IETNAGHGAGTPVAKLIEQSADIYAFTLYEMGYR  687 (693)
T ss_dssp             EEC-------CHHHHHHHHHHHHHHHHHHHTTCS
T ss_pred             EeCCCCCCCcccHHHHHHHHHHHHHHHHHHcCCC
Confidence            9999999998765556788889999999998763
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>4g4g_A 4-O-methyl-glucuronoyl methylesterase; alpha/beta hydrolase, 3-layer alpha/beta/alpha sandwich, ROS fold, glucuronoyl esterase; 1.55A {Myceliophthora thermophila} PDB: 4g4i_A 4g4j_A* Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1012
d1qfma1430 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-termin 6e-56
d1qfma1430 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-termin 2e-04
d1qfma2280 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-term 3e-32
d1qfma2 280 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-term 2e-14
d1qfma2280 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-term 6e-12
d2hu7a2260 c.69.1.33 (A:322-581) Acylamino-acid-releasing enz 1e-10
d2hu7a2 260 c.69.1.33 (A:322-581) Acylamino-acid-releasing enz 5e-10
d1l7aa_318 c.69.1.25 (A:) Cephalosporin C deacetylase {Bacill 1e-07
d1sfra_288 c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculo 1e-07
d1vlqa_322 c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Therm 1e-07
d1xfda2258 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-li 2e-07
d1dqza_280 c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculo 3e-06
d2bgra2258 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26 4e-06
d1r88a_267 c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tu 5e-05
d1wb4a1273 c.69.1.2 (A:803-1075) Feruloyl esterase domain of 0.003
d1lnsa3405 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopep 0.004
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 430 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: Peptidase/esterase 'gauge' domain
family: Prolyl oligopeptidase, N-terminal domain
domain: Prolyl oligopeptidase, N-terminal domain
species: Pig (Sus scrofa) [TaxId: 9823]

 Score =  198 bits (503), Expect = 6e-56
 Identities = 133/435 (30%), Positives = 193/435 (44%), Gaps = 80/435 (18%)

Query: 33  MTKFEYPKARKNESLVDEYHGVKIPDPYGWMEDPDSEETKKFVDEENAISRPYLEDHPDR 92
           M  F+YP   ++E+ + +YHG K+ DPY W+EDPDSE+TK FV+ +N I+ P+LE  P R
Sbjct: 1   MLSFQYPDVYRDETAIQDYHGHKVCDPYAWLEDPDSEQTKAFVEAQNKITVPFLEQCPIR 60

Query: 93  DKVKAELTKMWDYPKYSSPQRQGDHYFFFHNTGLQ------------------------- 127
              K  +T+++DYPKYS   ++G  YF+F+NTGLQ                         
Sbjct: 61  GLYKERMTELYDYPKYSCHFKKGKRYFYFYNTGLQNQRVLYVQDSLEGEARVFLDPNILS 120

Query: 128 ---------------NHSVMYIQDSLDGEARVFLDPNNLSD------DGTVSLGSYSFSE 166
                               Y   +   +                     V     +++ 
Sbjct: 121 DDGTVALRGYAFSEDGEYFAYGLSASGSDWVTIKFMKVDGAKELPDVLERVKFSCMAWTH 180

Query: 167 DGKTLAYCLSSSGSDWTSMHFKDVATGKEYPEVLHRL----KFVSIAWTHDHKGVFY--- 219
           DGK + Y         +        T        H L        +      +  +    
Sbjct: 181 DGKGMFYNAYPQQDGKSDGTETS--TNLHQKLYYHVLGTDQSEDILCAEFPDEPKWMGGA 238

Query: 220 SNQEPKSKSKKHSKKNRSSAYHLTVNVAPITS--------------------QYITNEGP 259
              +         ++       L        S                     Y+TNEG 
Sbjct: 239 ELSDDGRYVLLSIREGCDPVNRLWYCDLQQESNGITGILKWVKLIDNFEGEYDYVTNEGT 298

Query: 260 QFVFKTNKDAPNYRLITIDFDNFAESNWKTLIEENKDDVLDWATCVANDKLILSYIHHVK 319
            F FKTN+ +PNYRLI IDF +  ES WK L+ E++ DVL+W  CV ++ L+L Y+H VK
Sbjct: 299 VFTFKTNRHSPNYRLINIDFTDPEESKWKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVK 358

Query: 320 NVMHLHDLASGKHLYTFPLDVGTIVGFSGKKKYSEIFYSFMSFLQPTIIFHCNIPARVDP 379
           N + LHDLA+G  L  FPL+VG++VG+SG+KK +EIFY F SFL P II+HC++      
Sbjct: 359 NTLQLHDLATGALLKIFPLEVGSVVGYSGQKKDTEIFYQFTSFLSPGIIYHCDLTKE--- 415

Query: 380 NSKLETSIFREIKVP 394
             +LE  +FRE+ V 
Sbjct: 416 --ELEPRVFREVTVK 428
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 430 Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 280 Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 280 Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 280 Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Length = 260 Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Length = 260 Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Length = 318 Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Length = 288 Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Length = 322 Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 280 Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 258 Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 267 Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Length = 273 Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Length = 405 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1012
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 100.0
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 99.94
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 99.93
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 99.92
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 99.9
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 99.76
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 99.74
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 99.69
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 99.66
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 99.65
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.64
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 99.62
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 99.61
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 99.61
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 99.59
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 99.56
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 99.56
d1lnsa3405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 99.56
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 99.56
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 99.56
d1ju3a2347 Bacterial cocaine esterase N-terminal domain {Rhod 99.55
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 99.55
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 99.53
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 99.51
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 99.51
d2b9va2385 Alpha-amino acid ester hydrolase {Acetobacter past 99.51
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 99.49
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 99.49
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 99.48
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 99.43
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 99.41
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 99.38
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 99.38
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 99.36
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 99.35
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 99.35
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 99.33
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.3
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 99.28
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.28
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 99.23
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.22
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.22
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 99.21
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.21
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 99.18
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 99.18
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 99.16
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 99.15
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 99.15
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 99.14
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 99.13
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 99.07
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 99.03
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 98.99
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 98.97
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 98.96
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 98.96
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 98.95
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.95
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 98.94
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 98.92
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 98.92
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 98.92
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 98.91
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 98.91
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 98.88
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 98.81
d1pv1a_299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 98.81
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 98.81
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 98.8
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 98.8
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 98.77
d2d81a1318 Polyhydroxybutyrate depolymerase {Penicillium funi 98.75
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 98.74
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 98.69
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 98.69
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 98.67
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 98.66
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.65
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 98.65
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 98.62
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 98.57
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 98.56
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 98.55
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 98.55
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 98.54
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 98.54
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 98.49
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.46
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 98.46
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 98.42
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 98.42
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 98.38
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 98.36
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 98.33
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.28
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 98.27
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 98.26
d1ukca_517 Esterase EstA {Aspergillus niger [TaxId: 5061]} 98.25
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 98.24
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 98.16
d1qe3a_483 Thermophilic para-nitrobenzyl esterase (PNB estera 98.16
d1llfa_534 Type-B carboxylesterase/lipase {Candida cylindrace 98.14
d2d81a1318 Polyhydroxybutyrate depolymerase {Penicillium funi 98.12
d2h7ca1532 Mammalian carboxylesterase (liver carboxylesterase 98.11
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 98.1
d2ha2a1542 Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 98.09
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 98.08
d1thga_544 Type-B carboxylesterase/lipase {Fungus (Geotrichum 98.07
d1lnsa3405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 98.05
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.05
d1ea5a_532 Acetylcholinesterase {Pacific electric ray (Torped 98.04
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 98.03
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 98.02
d1p0ia_526 Butyryl cholinesterase {Human (Homo sapiens) [TaxI 98.0
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 97.95
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 97.91
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 97.89
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 97.88
d1dx4a_571 Acetylcholinesterase {Fruit fly (Drosophila melano 97.86
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 97.86
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 97.8
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 97.78
d2bcea_579 Bile-salt activated lipase (cholesterol esterase) 97.77
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 97.77
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 97.75
d1tbga_340 beta1-subunit of the signal-transducing G protein 97.74
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 97.71
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 97.7
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 97.69
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 97.68
d1ju3a2347 Bacterial cocaine esterase N-terminal domain {Rhod 97.66
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 97.65
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 97.65
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 97.64
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 97.63
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 97.62
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 97.57
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 97.57
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 97.54
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 97.54
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 97.52
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 97.51
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 97.51
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 97.51
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 97.48
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 97.39
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 97.38
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.36
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 97.28
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 97.27
d2vata1376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 97.18
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 97.12
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 97.12
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 97.09
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 97.07
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.03
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.03
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 97.02
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 97.02
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 96.96
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 96.88
d2b9va2385 Alpha-amino acid ester hydrolase {Acetobacter past 96.86
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 96.82
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 96.76
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 96.7
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 96.69
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 96.65
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 96.19
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 96.15
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 96.13
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 96.09
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 96.08
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 95.99
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 95.99
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 95.98
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 95.94
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 95.94
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 95.87
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 95.83
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 95.83
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 95.81
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 95.56
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 95.53
d1pv1a_299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 95.45
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 95.45
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 95.45
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 95.41
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 95.22
d1ei9a_279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 95.04
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 94.93
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 94.92
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 94.69
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 94.45
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 94.38
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 94.08
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 93.57
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 92.9
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 92.64
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 92.55
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 92.34
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 92.17
d1tbga_340 beta1-subunit of the signal-transducing G protein 92.15
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 91.69
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 90.46
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 89.63
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 89.62
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 88.93
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 88.48
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 88.23
g1wht.1409 Serine carboxypeptidase II {Wheat (Triticum vulgar 88.05
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 87.36
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 87.31
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 86.98
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 86.7
d1ku0a_388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 86.58
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 86.19
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 86.14
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 85.71
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 85.16
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 84.87
d1ivya_452 Human 'protective protein', HPP {Human (Homo sapie 84.65
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 84.5
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 83.55
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 83.26
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 81.35
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 80.59
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 80.51
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: Peptidase/esterase 'gauge' domain
family: Prolyl oligopeptidase, N-terminal domain
domain: Prolyl oligopeptidase, N-terminal domain
species: Pig (Sus scrofa) [TaxId: 9823]

Probab=100.00  E-value=8.5e-42  Score=395.23  Aligned_cols=358  Identities=51%  Similarity=0.969  Sum_probs=291.9

Q ss_pred             cccCCCCCCccCcceeecccCccccCCCCCCCCCCCHHHHHHHHHhhhchHhhhccCCChHHHHHHHhhcccCCCCCCCe
Q psy1288          33 MTKFEYPKARKNESLVDEYHGVKIPDPYGWMEDPDSEETKKFVDEENAISRPYLEDHPDRDKVKAELTKMWDYPKYSSPQ  112 (1012)
Q Consensus        33 ~~~~~~P~a~~~~~~~~~~hG~~~~Dpy~WLed~~~~~~~~~l~~qn~~t~~~l~~~~~~~~l~~~~~~~~~~~~~s~p~  112 (1012)
                      |+.++||+++|+..+++++||+++.|||+||||.++|++++||++||+||+++|++.+.++.+.+++++++..++.++|.
T Consensus         1 ~~~~~yP~~~~~~~~~~~~hG~~~~DpY~WLed~~~~~v~~wl~~eN~~t~~~l~~~~~~~~~~~~~~~~~~~~~~~~p~   80 (430)
T d1qfma1           1 MLSFQYPDVYRDETAIQDYHGHKVCDPYAWLEDPDSEQTKAFVEAQNKITVPFLEQCPIRGLYKERMTELYDYPKYSCHF   80 (430)
T ss_dssp             CCCSCCCCCCCCTTCEEEETTEEEECTTGGGGCTTSHHHHHHHHHHHHHHHHHHHSSTHHHHHHHHHHHHTCSCEECCCE
T ss_pred             CCCCCCCCCcCCCCeeeccCCCEEeeCchhhcCCCCHHHHHHHHHHHHHHHHHHcCChhHHHHHHHHHhhhcCCceeeeE
Confidence            34567888877765669999999999999999999999999999999999999999999999999999999988999999


Q ss_pred             eeCCEEEEEEEcCCCCeeEEEEEeCCCCceEEEcCCCCCCCCCceEeeeEEECCCCcEEEEEEeCCCCceEEEEEEECCC
Q psy1288         113 RQGDHYFFFHNTGLQNHSVMYIQDSLDGEARVFLDPNNLSDDGTVSLGSYSFSEDGKTLAYCLSSSGSDWTSMHFKDVAT  192 (1012)
Q Consensus       113 ~dG~~~yy~~~~~~~~~~~l~~~~~~~g~~~~L~D~n~la~~g~~~i~~~~~SPDGk~iAy~~~~~G~~~~~L~v~dl~t  192 (1012)
                      .+|+++||.+..+++++..+|++...++++++|+|+|++++++.+.+.+.++||||++|||+++.+|++.++|+++|+++
T Consensus        81 ~~g~~y~~~~~~~~~~~~~~~~~~~~~~~~evllD~n~la~~~~~~~~~~~~Spd~~~la~s~d~~G~e~~~l~v~Dl~t  160 (430)
T d1qfma1          81 KKGKRYFYFYNTGLQNQRVLYVQDSLEGEARVFLDPNILSDDGTVALRGYAFSEDGEYFAYGLSASGSDWVTIKFMKVDG  160 (430)
T ss_dssp             EETTEEEEEEECSSCSSCEEEEESSSSSCCEEEECGGGGCSSSCEEEEEEEECTTSSEEEEEEEETTCSCEEEEEEETTT
T ss_pred             EeCCEEEEEEecCCCccceEEeccccCCCeeeecchhhhcccccceecceEecCCCCEEEEEeccccCchheeEEeccCc
Confidence            99999999999887888899999888899999999999999888888889999999999999999999999999999999


Q ss_pred             CceeceeecceeeeeeEEeeCCCeEEEEecCCCC---Ccc-cCCCCCceEEEEe--------------e-----------
Q psy1288         193 GKEYPEVLHRLKFVSIAWTHDHKGVFYSNQEPKS---KSK-KHSKKNRSSAYHL--------------T-----------  243 (1012)
Q Consensus       193 g~~~~~t~~~~~~~~~~WSpDG~~l~y~~~~~~~---~g~-~~~~~~~~l~~~~--------------~-----------  243 (1012)
                      |+.+...+.....++++|++|++.|+|+..+...   .+. .+.....++++|.              .           
T Consensus       161 g~~~~~~i~~~~~~~~~W~~D~~~~~Y~~~~~~~~~~~~~~~~~~~~~~v~~h~lgt~~~~d~~v~~e~d~~~~~~~~~~  240 (430)
T d1qfma1         161 AKELPDVLERVKFSCMAWTHDGKGMFYNAYPQQDGKSDGTETSTNLHQKLYYHVLGTDQSEDILCAEFPDEPKWMGGAEL  240 (430)
T ss_dssp             TEEEEEEEEEECSCCEEECTTSSEEEEEECCCCSSCCSSSCCCCCCCCEEEEEETTSCGGGCEEEECCTTCTTCEEEEEE
T ss_pred             ceecccccccccccceEEcCCCCEEEEEEeccccCcccccccccCCcceEEEEECCCCccccccccccccCCceEEeeec
Confidence            9998888877766889999999999999743211   000 0011111222221              0           


Q ss_pred             ------------ccc---------------cc-------e--------eeeeeecCCCEEEEEECCCCCCceEEEEeCCC
Q psy1288         244 ------------VNV---------------AP-------I--------TSQYITNEGPQFVFKTNKDAPNYRLITIDFDN  281 (1012)
Q Consensus       244 ------------~~~---------------~~-------i--------~~~~~s~dg~~l~~~tn~~~~~~~L~~~dl~~  281 (1012)
                                  .+.               ..       .        .+..+.++|+.||+++|.++++++|+.++++.
T Consensus       241 s~d~~~l~i~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Tn~~a~~~~L~~~~~~~  320 (430)
T d1qfma1         241 SDDGRYVLLSIREGCDPVNRLWYCDLQQESNGITGILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRHSPNYRLINIDFTD  320 (430)
T ss_dssp             CTTSCEEEEEEECSSSSCCEEEEEEGGGSSSSSCSSCCCEEEECSSSSCEEEEEEETTEEEEEECTTCTTCEEEEEETTB
T ss_pred             cCCcceeeEEeeccCCccEEEEEeeCCCcccccccccceeEeecccccceEEEecCCceeecccCcccccceeEEecCCC
Confidence                        000               00       0        02235668899999999999999999999998


Q ss_pred             CcccCcEEeeccCCCceeeeeEEecCCEEEEEEEcCceEEEEEEecCCCceeeeecCCceEEEeecccccCcEEEEEecC
Q psy1288         282 FAESNWKTLIEENKDDVLDWATCVANDKLILSYIHHVKNVMHLHDLASGKHLYTFPLDVGTIVGFSGKKKYSEIFYSFMS  361 (1012)
Q Consensus       282 ~~~~~~~~l~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~l~~~dl~~G~~~~~l~~~~~~v~~~~~spdg~~l~~~~ss  361 (1012)
                      +....|+.|+++.+..++.......+++|++.+++++.++|.++++++++.......+.+++.+++.+++++.++|.+++
T Consensus       321 ~~~~~w~~vi~~~~~~~~~~~~~~~~~~lvl~~~~~~~~~l~v~~~~~~~~~~~~~~~~~sv~~~~~~~~~~~~~~~~ss  400 (430)
T d1qfma1         321 PEESKWKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNTLQLHDLATGALLKIFPLEVGSVVGYSGQKKDTEIFYQFTS  400 (430)
T ss_dssp             CCGGGCEEEECCCSSCEEEEEEEETTTEEEEEEEETTEEEEEEEETTTCCEEEEECCCSSEEEEEECCTTCSEEEEEEEC
T ss_pred             CccccceEEecccCcceeeeEEEEECCEEEEEEEcCCEeEEEEEECCCCcEEEecCCCCceEeeccCCCCCCEEEEEEcC
Confidence            87778999999876666554444444899999999999999999997776654444557788788888888999999999


Q ss_pred             CCCCcEEEEEeCCCCCCCCCCcceEEEEeccCCC
Q psy1288         362 FLQPTIIFHCNIPARVDPNSKLETSIFREIKVPD  395 (1012)
Q Consensus       362 ~~~p~~l~~~d~~~~~~~~g~~~~~~l~~~~~~~  395 (1012)
                      +.+|+++|.+|+     ++++.+.+++++.++++
T Consensus       401 ~~tP~~~y~~Dl-----~t~~~~~~~~k~~~v~G  429 (430)
T d1qfma1         401 FLSPGIIYHCDL-----TKEELEPRVFREVTVKG  429 (430)
T ss_dssp             SSCCCEEEEEET-----TSSSCCCEEEEECCCTT
T ss_pred             CCCCCeEEEEEC-----CCCCcceeeEeccCCCC
Confidence            999999999999     46755567788766553
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure