Psyllid ID: psy128


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440------
MFPFQFSPFPSVAGPGLIPRLPPMLQHPLIPQPLVHPPGTPPPSKMKDKVSPKDKTSPKEKMSSKEKTSPKEKEYSKVKDVELGVTPMVPNIVKVTSSEDLGEIKKDKSIKKDKKTHKKKEKEKIKKKKDKKDKDKIKNKEKDKEKKEKEKGKKEEKEKKEEKEKKEEKEFKMKEDKEKPVEKIRKEEKDSEKEKKSKDKDKKLKKEKLKKKKKEKERSSHEKEVIPKLTFKFGTDMEEKTKRESSPKIVIKPVKSPSPPPVAAADEYDTGDSKQVWICPACGVQDDGSLPMIGCDGCDAWYHWVCVGLVAEPETSDWFCPKCSKVDEGSRKEKKKRGRKKKTHQDIIMSTYRFERDPSELVDKSACAGSRADLKLCLLETDCVQVDRKTPRQCLREGLAPQCEALKNTFFECKRSLLDTRQTVCRWIGKHPDNVYGKASHRSVRL
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccHHHHccccccccccccccccccccccccccHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccEEcccccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccccccccccccccc
ccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccHHHccHcccccccccccccccccccccccccccccEEcccccccccHHHHcccccccccccccHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHcHHHHHcHHHHHHHccccccccccccccccccHHHHccccHHHHHcccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccEEccccccccEcccEccEEccccccccccHHHcccccccccccccccccccccccccccccEEcccccccccccHHHHHHHHHHHHHccccHHHcccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEcc
mfpfqfspfpsvagpgliprlppmlqhplipqplvhppgtpppskmkdkvspkdktspkekmsskektspkekeyskvkdvelgvtpmvpnivkvtssedlgeikkdksikkdKKTHKKKEKEKIKKKKDKKDKDKIKNKEKDKEKKEKEKGKKEEKEKKEEKEKKEEKEFKmkedkekpvEKIRKEEKDSEKEKKSKDKDKKLKKEKLKKKKKEkersshekevipkltfkfgtdmeektkresspkivikpvkspspppvaaadeydtgdskqvwicpacgvqddgslpmigcdgcdawYHWVCVGLvaepetsdwfcpkcskvdegsrkekkkrgrkkkthqDIIMSTyrferdpselvdksacagsraDLKLCLLEtdcvqvdrktprqclreglapQCEALKNTFFECKRSLLDTRQTVCRWigkhpdnvygkashrsvrl
mfpfqfspfpsvAGPGLIPRLPPMLQHPLIPQPLVHPPGtpppskmkdkvspkdktspkekmsskektspkekeyskvkdvelgvtpmvpnivkvtssedlgeikkdksikkdkkthkkkekekikkkkdkkdkdkiknkekdkekkekekgkkeekekkeekekkeekefkmkedkekpvekirkeekdsekekkskdkdkklkkeklkkkkkekersshekevipkltfkfgtdmeektkresspkivikpvkspspppVAAADEYDTGDSKQVWICPACGVQDDGSLPMIGCDGCDAWYHWVCVGLVAepetsdwfcpkcskvdegsrkekkkrgrkkkthqdiimstyrferdpselVDKSACAGSRADLKLCLLETDCVQVDRKTPRQCLREGLAPQCEALKNTFFECKRSLLDTRQTVCRwigkhpdnvygkashrsvrl
MFPFQFSPFPSVAGPGLIPRLPPMLQHPLIPQPLVHPPGTPPPSKMKDKVSPKDktspkekmsskektspkekeyskVKDVELGVTPMVPNIVKVTSSEDLGeikkdksikkdkkthkkkekekikkkkdkkdkdkiknkekdkekkekekgkkeekekkeekekkeekefkmkedkekPVekirkeekdsekekkskdkdkklkkeklkkkkkekersshekeVIPKLTFKFGTDMEEKTKRESspkivikpvkspspppvaaaDEYDTGDSKQVWICPACGVQDDGSLPMIGCDGCDAWYHWVCVGLVAEPETSDWFCPKCSKVDEGSrkekkkrgrkkkTHQDIIMSTYRFERDPSELVDKSACAGSRADLKLCLLETDCVQVDRKTPRQCLREGLAPQCEALKNTFFECKRSLLDTRQTVCRWIGKHPDNVYGKASHRSVRL
************************************************************************************V**MV*NI*************************************************************************************************************************************************************************************KQVWICPACGVQDDGSLPMIGCDGCDAWYHWVCVGLVAEPETSDWFCPKC***************************TY***********KSACAGSRADLKLCLLETDCVQVDRKTPRQCLREGLAPQCEALKNTFFECKRSLLDTRQTVCRWIGKHPDNVY**********
*FPF*****************************************************************************************************************************************************************************************************************************************************************************KQVWICPACGVQDDGSLPMIGCDGCDAWYHWVCVGLVAEPETSDWFC********************************RFERDPSELVDKSACAGSRADLKLCLLETDCVQ*********LREGLAPQCEALKNTFFECKRSLLDTRQTVCRWIGKHPDNVYGKA**R****
MFPFQFSPFPSVAGPGLIPRLPPMLQHPLIPQPLVHPPGT************************************KVKDVELGVTPMVPNIVKVTSSEDLGEIKKDKS******************************************************************************************************************EVIPKLTFKFGTD**********PKIVIKPVK****************DSKQVWICPACGVQDDGSLPMIGCDGCDAWYHWVCVGLVAEPETSDWFCPKCSK*******************QDIIMSTYRFERDPSELVDKSACAGSRADLKLCLLETDCVQVDRKTPRQCLREGLAPQCEALKNTFFECKRSLLDTRQTVCRWIGKHPDNVY**********
****QFSPFPSVA*************************************************************************************************************************************************************************************************************************************************************EYD*GDSKQVWICPACGVQDDGSLPMIGCDGCDAWYHWVCVGLVAEPETSDWFCPKCSK*********************************SELVDKSACAGSRADLKLCLLETDCVQVDRKTPRQCLREGLAPQCEALKNTFFECKRSLLDTRQTVCRWIGKHPDNVYGK*SH*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFPFQFSPFPSVAGPGLIPRLPPMLQHPLIPQPLVHPPGTPPPSKMKDKVSPKDKTSPKEKMSSKEKTSPKEKEYSKVKDVELGVTPMVPNIVKVTSSEDLGEIKKDKSIKKDKKTHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVIPKLTFKFGTDMEEKTKRESSPKIVIKPVKSPSPPPVAAADEYDTGDSKQVWICPACGVQDDGSLPMIGCDGCDAWYHWVCVGLVAEPETSDWFCPKCSKVDEGSRKEKKKRGRKKKTHQDIIMSTYRFERDPSELVDKSACAGSRADLKLCLLETDCVQVDRKTPRQCLREGLAPQCEALKNTFFECKRSLLDTRQTVCRWIGKHPDNVYGKASHRSVRL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query446 2.2.26 [Sep-21-2011]
Q5HZG4932 Transcription initiation yes N/A 0.114 0.054 0.641 8e-17
Q5VWG9929 Transcription initiation yes N/A 0.114 0.054 0.641 1e-16
Q5EAW9845 Transcription initiation N/A N/A 0.109 0.057 0.647 2e-15
Q5F489930 Transcription initiation yes N/A 0.114 0.054 0.603 9e-15
Q3ZCK874 Cytochrome c oxidase asse no N/A 0.121 0.729 0.614 2e-12
Q28CA175 Cytochrome c oxidase asse no N/A 0.125 0.746 0.610 3e-12
Q8IDX63130 Reticulocyte-binding prot yes N/A 0.311 0.044 0.236 2e-05
F1QBY1 2876 Nipped-B-like protein B O no N/A 0.226 0.035 0.409 0.0002
>sp|Q5HZG4|TAF3_MOUSE Transcription initiation factor TFIID subunit 3 OS=Mus musculus GN=Taf3 PE=1 SV=2 Back     alignment and function desciption
 Score = 89.0 bits (219), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 38/53 (71%), Gaps = 2/53 (3%)

Query: 274 KQVWICPACGVQDDGSLPMIGCDGCDAWYHWVCVGLVAE-PETSDWFCPKCSK 325
            Q+WICP C   DDGS PMIGCD CD WYHW CVG++A  PE   WFCPKC+ 
Sbjct: 865 NQIWICPGCNKPDDGS-PMIGCDDCDDWYHWPCVGIMAAPPEEMQWFCPKCAN 916




Transcription factor TFIID is one of the general factors required for accurate and regulated initiation by RNA polymerase II. TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. Required in complex with TBPL2 for the differentiation of myoblasts into myocytes. The complex replaces TFIID at specific promoters at an early stage in the differentiation process.
Mus musculus (taxid: 10090)
>sp|Q5VWG9|TAF3_HUMAN Transcription initiation factor TFIID subunit 3 OS=Homo sapiens GN=TAF3 PE=1 SV=1 Back     alignment and function description
>sp|Q5EAW9|TAF3_XENLA Transcription initiation factor TFIID subunit 3 OS=Xenopus laevis GN=taf3 PE=2 SV=1 Back     alignment and function description
>sp|Q5F489|TAF3_CHICK Transcription initiation factor TFIID subunit 3 OS=Gallus gallus GN=TAF3 PE=2 SV=1 Back     alignment and function description
>sp|Q3ZCK8|COA5_BOVIN Cytochrome c oxidase assembly factor 5 OS=Bos taurus GN=COA5 PE=3 SV=1 Back     alignment and function description
>sp|Q28CA1|COA5_XENTR Cytochrome c oxidase assembly factor 5 OS=Xenopus tropicalis GN=coa5 PE=3 SV=1 Back     alignment and function description
>sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 Back     alignment and function description
>sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query446
193713718 590 PREDICTED: hypothetical protein LOC10016 0.192 0.145 0.521 7e-20
270015055 865 hypothetical protein TcasGA2_TC014217 [T 0.154 0.079 0.578 9e-20
328700739 906 PREDICTED: hypothetical protein LOC10016 0.152 0.075 0.586 1e-19
189233756 872 PREDICTED: similar to bip2 CG2009-PA [Tr 0.116 0.059 0.685 7e-18
357604267 1167 hypothetical protein KGM_08958 [Danaus p 0.165 0.063 0.5 3e-17
195133998 1094 GI14094 [Drosophila mojavensis] gi|19391 0.125 0.051 0.603 5e-17
353230188 1690 hypothetical protein Smp_127180 [Schisto 0.165 0.043 0.452 9e-17
256072183 1282 hypothetical protein [Schistosoma manson 0.165 0.057 0.452 1e-16
195172552 1497 GL18176 [Drosophila persimilis] gi|19411 0.161 0.048 0.5 1e-16
115711961 1047 PREDICTED: uncharacterized protein LOC59 0.116 0.049 0.615 1e-16
>gi|193713718|ref|XP_001949510.1| PREDICTED: hypothetical protein LOC100161166 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  105 bits (261), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 60/94 (63%), Gaps = 8/94 (8%)

Query: 250 VIKPVKSPSPPPVAAADEYDTGDSKQVWICPACGVQDDGSLPMIGCDGCDAWYHWVCVGL 309
           VI PV   +PPP    DE       QVWICP C   DDGS PMIGCDGCD WYHWVCVG+
Sbjct: 503 VIPPVNE-TPPPAFYFDEA----GNQVWICPMCTKPDDGS-PMIGCDGCDVWYHWVCVGI 556

Query: 310 VAEPETSDWFCPKCSKVDEGSRKEKKKRGRKKKT 343
              P+ + WFCP+C  + + +++ K KRGR +K 
Sbjct: 557 QCPPDCAVWFCPRC--LAKRAQQPKGKRGRPRKN 588




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270015055|gb|EFA11503.1| hypothetical protein TcasGA2_TC014217 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328700739|ref|XP_001945181.2| PREDICTED: hypothetical protein LOC100167514 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|189233756|ref|XP_001814148.1| PREDICTED: similar to bip2 CG2009-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357604267|gb|EHJ64117.1| hypothetical protein KGM_08958 [Danaus plexippus] Back     alignment and taxonomy information
>gi|195133998|ref|XP_002011425.1| GI14094 [Drosophila mojavensis] gi|193912048|gb|EDW10915.1| GI14094 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|353230188|emb|CCD76359.1| hypothetical protein Smp_127180 [Schistosoma mansoni] Back     alignment and taxonomy information
>gi|256072183|ref|XP_002572416.1| hypothetical protein [Schistosoma mansoni] Back     alignment and taxonomy information
>gi|195172552|ref|XP_002027061.1| GL18176 [Drosophila persimilis] gi|194112839|gb|EDW34882.1| GL18176 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|115711961|ref|XP_797041.2| PREDICTED: uncharacterized protein LOC592424 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query446
UNIPROTKB|E1BIA9932 TAF3 "Uncharacterized protein" 0.107 0.051 0.68 1.9e-21
UNIPROTKB|Q5VWG9929 TAF3 "Transcription initiation 0.109 0.052 0.666 3.2e-20
ZFIN|ZDB-GENE-030131-6406898 taf3 "TAF3 RNA polymerase II, 0.109 0.054 0.666 1.2e-19
UNIPROTKB|F1RUM5794 TAF3 "Uncharacterized protein" 0.107 0.060 0.7 1.5e-19
UNIPROTKB|F1NZW0874 TAF3 "Transcription initiation 0.109 0.056 0.627 2.2e-19
UNIPROTKB|Q5F489930 TAF3 "Transcription initiation 0.109 0.052 0.627 2.7e-19
UNIPROTKB|F1PI56932 TAF3 "Uncharacterized protein" 0.109 0.052 0.666 6.7e-19
MGI|MGI:2388097932 Taf3 "TAF3 RNA polymerase II, 0.109 0.052 0.666 1.7e-18
FB|FBgn00262621408 bip2 "bip2" [Drosophila melano 0.118 0.037 0.607 8.5e-16
WB|WBGene000063841007 taf-3 [Caenorhabditis elegans 0.134 0.059 0.5 1.2e-14
UNIPROTKB|E1BIA9 TAF3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 215 (80.7 bits), Expect = 1.9e-21, Sum P(3) = 1.9e-21
 Identities = 34/50 (68%), Positives = 37/50 (74%)

Query:   275 QVWICPACGVQDDGSLPMIGCDGCDAWYHWVCVGLVAEP-ETSDWFCPKC 323
             Q+WICP C   DDGS PMIGCD CD WYHW CVG++A P E   WFCPKC
Sbjct:   867 QIWICPGCNKPDDGS-PMIGCDDCDDWYHWPCVGIMAAPPEEMQWFCPKC 915


GO:0051457 "maintenance of protein location in nucleus" evidence=IEA
GO:0043433 "negative regulation of sequence-specific DNA binding transcription factor activity" evidence=IEA
GO:0005669 "transcription factor TFIID complex" evidence=IEA
GO:0002039 "p53 binding" evidence=IEA
GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
UNIPROTKB|Q5VWG9 TAF3 "Transcription initiation factor TFIID subunit 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-6406 taf3 "TAF3 RNA polymerase II, TATA box binding protein (TBP)-associated facto" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1RUM5 TAF3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NZW0 TAF3 "Transcription initiation factor TFIID subunit 3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5F489 TAF3 "Transcription initiation factor TFIID subunit 3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PI56 TAF3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2388097 Taf3 "TAF3 RNA polymerase II, TATA box binding protein (TBP)-associated factor" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0026262 bip2 "bip2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00006384 taf-3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query446
pfam1020368 pfam10203, Pet191_N, Cytochrome c oxidase assembly 2e-18
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-10
PRK04195482 PRK04195, PRK04195, replication factor C large sub 7e-10
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 9e-10
PRK05901509 PRK05901, PRK05901, RNA polymerase sigma factor; P 1e-09
smart0024947 smart00249, PHD, PHD zinc finger 1e-09
PRK04195482 PRK04195, PRK04195, replication factor C large sub 2e-09
pfam0062851 pfam00628, PHD, PHD-finger 2e-09
PRK04195482 PRK04195, PRK04195, replication factor C large sub 3e-09
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 4e-09
PRK04195482 PRK04195, PRK04195, replication factor C large sub 4e-09
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-08
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-08
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 4e-08
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 4e-08
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 5e-08
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-07
PRK04195482 PRK04195, PRK04195, replication factor C large sub 1e-07
PRK04195482 PRK04195, PRK04195, replication factor C large sub 2e-07
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 3e-07
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 4e-07
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-07
PRK04195482 PRK04195, PRK04195, replication factor C large sub 5e-07
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 7e-07
PRK05901509 PRK05901, PRK05901, RNA polymerase sigma factor; P 7e-07
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 8e-07
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 9e-07
TIGR02794346 TIGR02794, tolA_full, TolA protein 1e-06
COG4499434 COG4499, COG4499, Predicted membrane protein [Func 2e-06
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 3e-06
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 3e-06
PRK05306 746 PRK05306, infB, translation initiation factor IF-2 3e-06
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 4e-06
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 4e-06
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 5e-06
PRK05896605 PRK05896, PRK05896, DNA polymerase III subunits ga 5e-06
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 6e-06
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 7e-06
PRK00409782 PRK00409, PRK00409, recombination and DNA strand e 8e-06
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 1e-05
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 1e-05
TIGR02794346 TIGR02794, tolA_full, TolA protein 1e-05
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 1e-05
pfam05262489 pfam05262, Borrelia_P83, Borrelia P83/100 protein 1e-05
PRK12903925 PRK12903, secA, preprotein translocase subunit Sec 1e-05
PTZ00372413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 1e-05
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 1e-05
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 2e-05
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 2e-05
TIGR02794346 TIGR02794, tolA_full, TolA protein 2e-05
CHL00189 742 CHL00189, infB, translation initiation factor 2; P 2e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 3e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-05
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 3e-05
PRK00409782 PRK00409, PRK00409, recombination and DNA strand e 3e-05
COG3064387 COG3064, TolA, Membrane protein involved in colici 3e-05
COG3064387 COG3064, TolA, Membrane protein involved in colici 3e-05
pfam05087 887 pfam05087, Rota_VP2, Rotavirus VP2 protein 3e-05
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 4e-05
smart00435391 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota 4e-05
pfam05758 832 pfam05758, Ycf1, Ycf1 4e-05
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 5e-05
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 6e-05
TIGR01069771 TIGR01069, mutS2, MutS2 family protein 6e-05
CHL002041832 CHL00204, ycf1, Ycf1; Provisional 6e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 7e-05
TIGR02794346 TIGR02794, tolA_full, TolA protein 7e-05
pfam05087 887 pfam05087, Rota_VP2, Rotavirus VP2 protein 7e-05
CHL002041832 CHL00204, ycf1, Ycf1; Provisional 8e-05
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 9e-05
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 1e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-04
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 1e-04
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 1e-04
pfam04615728 pfam04615, Utp14, Utp14 protein 1e-04
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 2e-04
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 2e-04
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 3e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 3e-04
PRK12903925 PRK12903, secA, preprotein translocase subunit Sec 3e-04
COG5271 4600 COG5271, MDN1, AAA ATPase containing von Willebran 3e-04
pfam13166 713 pfam13166, AAA_13, AAA domain 3e-04
COG4499434 COG4499, COG4499, Predicted membrane protein [Func 4e-04
PTZ00372413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 4e-04
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 4e-04
pfam13166 713 pfam13166, AAA_13, AAA domain 4e-04
pfam09756189 pfam09756, DDRGK, DDRGK domain 4e-04
COG2176 1444 COG2176, PolC, DNA polymerase III, alpha subunit ( 4e-04
smart00935140 smart00935, OmpH, Outer membrane protein (OmpH-lik 4e-04
pfam09592228 pfam09592, DUF2031, Protein of unknown function (D 5e-04
pfam13476204 pfam13476, AAA_23, AAA domain 5e-04
TIGR03319 514 TIGR03319, RNase_Y, ribonuclease Y 5e-04
PRK14160211 PRK14160, PRK14160, heat shock protein GrpE; Provi 5e-04
PRK05306 746 PRK05306, infB, translation initiation factor IF-2 6e-04
TIGR03319 514 TIGR03319, RNase_Y, ribonuclease Y 6e-04
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 7e-04
PRK05306 746 PRK05306, infB, translation initiation factor IF-2 7e-04
PRK05306 746 PRK05306, infB, translation initiation factor IF-2 7e-04
pfam06102168 pfam06102, DUF947, Domain of unknown function (DUF 7e-04
COG1293564 COG1293, COG1293, Predicted RNA-binding protein ho 7e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 8e-04
pfam05279240 pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylas 8e-04
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 8e-04
COG5185622 COG5185, HEC1, Protein involved in chromosome segr 9e-04
COG4499434 COG4499, COG4499, Predicted membrane protein [Func 0.001
PTZ00372413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 0.001
pfam05087 887 pfam05087, Rota_VP2, Rotavirus VP2 protein 0.001
TIGR01069771 TIGR01069, mutS2, MutS2 family protein 0.001
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 0.001
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 0.001
pfam04615728 pfam04615, Utp14, Utp14 protein 0.001
pfam13476204 pfam13476, AAA_23, AAA domain 0.001
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 0.001
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 0.001
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 0.001
pfam03839217 pfam03839, Sec62, Translocation protein Sec62 0.001
PRK00247429 PRK00247, PRK00247, putative inner membrane protei 0.001
PRK00448 1437 PRK00448, polC, DNA polymerase III PolC; Validated 0.001
COG5034271 COG5034, TNG2, Chromatin remodeling protein, conta 0.001
pfam07767387 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) 0.001
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.001
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.001
COG4487438 COG4487, COG4487, Uncharacterized protein conserve 0.001
pfam05793528 pfam05793, TFIIF_alpha, Transcription initiation f 0.001
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 0.002
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 0.002
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 0.002
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 0.002
COG4499434 COG4499, COG4499, Predicted membrane protein [Func 0.002
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 0.002
smart00435391 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota 0.002
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 0.002
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 0.002
pfam03839217 pfam03839, Sec62, Translocation protein Sec62 0.002
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.002
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.002
COG0610962 COG0610, COG0610, Type I site-specific restriction 0.002
COG5019373 COG5019, CDC3, Septin family protein [Cell divisio 0.002
pfam09507427 pfam09507, CDC27, DNA polymerase subunit Cdc27 0.002
PLN02381 1066 PLN02381, PLN02381, valyl-tRNA synthetase 0.002
pfam00012598 pfam00012, HSP70, Hsp70 protein 0.002
pfam09731493 pfam09731, Mitofilin, Mitochondrial inner membrane 0.002
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.002
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.003
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.003
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 0.003
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 0.003
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 0.003
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 0.003
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 0.003
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 0.003
PTZ00372413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 0.003
pfam05758 832 pfam05758, Ycf1, Ycf1 0.003
pfam09756189 pfam09756, DDRGK, DDRGK domain 0.003
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 0.003
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 0.003
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.003
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.003
COG4487438 COG4487, COG4487, Uncharacterized protein conserve 0.003
COG5019373 COG5019, CDC3, Septin family protein [Cell divisio 0.003
PRK14907295 PRK14907, rplD, 50S ribosomal protein L4; Provisio 0.003
PRK00106535 PRK00106, PRK00106, hypothetical protein; Provisio 0.003
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 0.003
PRK12705 508 PRK12705, PRK12705, hypothetical protein; Provisio 0.003
TIGR01554384 TIGR01554, major_cap_HK97, phage major capsid prot 0.003
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 0.004
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 0.004
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 0.004
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 0.004
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 0.004
pfam03839217 pfam03839, Sec62, Translocation protein Sec62 0.004
pfam06375561 pfam06375, BLVR, Bovine leukaemia virus receptor ( 0.004
pfam09736141 pfam09736, Bud13, Pre-mRNA-splicing factor of RES 0.004
COG5604 523 COG5604, COG5604, Uncharacterized conserved protei 0.004
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.004
PTZ00342 746 PTZ00342, PTZ00342, acyl-CoA synthetase; Provision 0.004
pfam06391200 pfam06391, MAT1, CDK-activating kinase assembly fa 0.004
>gnl|CDD|192483 pfam10203, Pet191_N, Cytochrome c oxidase assembly protein PET191 Back     alignment and domain information
 Score = 78.8 bits (195), Expect = 2e-18
 Identities = 32/63 (50%), Positives = 44/63 (69%), Gaps = 3/63 (4%)

Query: 363 DKSACAGSRADLKLCLLETDCVQVDRKTPRQCLREGLAP---QCEALKNTFFECKRSLLD 419
             S+C G R DL  CLLE+DCV+ +++TPR+CL+E L     +C AL+  FFECKR +LD
Sbjct: 1   MGSSCKGLREDLAECLLESDCVKKEKRTPRECLKEPLKELPEECIALRKAFFECKRGMLD 60

Query: 420 TRQ 422
            R+
Sbjct: 61  MRK 63


Pet191_N is the conserved N-terminal of a family of conserved proteins found from nematodes to humans. It carries six highly conserved cysteine residues. Pet191 is required for the assembly of active cytochrome c oxidase but does not form part of the final assembled complex. Length = 68

>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|235638 PRK05896, PRK05896, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein Back     alignment and domain information
>gnl|CDD|237258 PRK12903, secA, preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|191187 pfam05087, Rota_VP2, Rotavirus VP2 protein Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|214661 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota) Back     alignment and domain information
>gnl|CDD|218734 pfam05758, Ycf1, Ycf1 Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein Back     alignment and domain information
>gnl|CDD|214395 CHL00204, ycf1, Ycf1; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|191187 pfam05087, Rota_VP2, Rotavirus VP2 protein Back     alignment and domain information
>gnl|CDD|214395 CHL00204, ycf1, Ycf1; Provisional Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|218177 pfam04615, Utp14, Utp14 protein Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|237258 PRK12903, secA, preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|221952 pfam13166, AAA_13, AAA domain Back     alignment and domain information
>gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|221952 pfam13166, AAA_13, AAA domain Back     alignment and domain information
>gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain Back     alignment and domain information
>gnl|CDD|225087 COG2176, PolC, DNA polymerase III, alpha subunit (gram-positive type) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|214922 smart00935, OmpH, Outer membrane protein (OmpH-like) Back     alignment and domain information
>gnl|CDD|220303 pfam09592, DUF2031, Protein of unknown function (DUF2031) Back     alignment and domain information
>gnl|CDD|222160 pfam13476, AAA_23, AAA domain Back     alignment and domain information
>gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y Back     alignment and domain information
>gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|218899 pfam06102, DUF947, Domain of unknown function (DUF947) Back     alignment and domain information
>gnl|CDD|224212 COG1293, COG1293, Predicted RNA-binding protein homologous to eukaryotic snRNP [Transcription] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|191249 pfam05279, Asp-B-Hydro_N, Aspartyl beta-hydroxylase N-terminal region Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|227512 COG5185, HEC1, Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|191187 pfam05087, Rota_VP2, Rotavirus VP2 protein Back     alignment and domain information
>gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|218177 pfam04615, Utp14, Utp14 protein Back     alignment and domain information
>gnl|CDD|222160 pfam13476, AAA_23, AAA domain Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|217756 pfam03839, Sec62, Translocation protein Sec62 Back     alignment and domain information
>gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated Back     alignment and domain information
>gnl|CDD|234767 PRK00448, polC, DNA polymerase III PolC; Validated Back     alignment and domain information
>gnl|CDD|227367 COG5034, TNG2, Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|226889 COG4487, COG4487, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|214661 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota) Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|217756 pfam03839, Sec62, Translocation protein Sec62 Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223683 COG0610, COG0610, Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|227352 COG5019, CDC3, Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 Back     alignment and domain information
>gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|215656 pfam00012, HSP70, Hsp70 protein Back     alignment and domain information
>gnl|CDD|220369 pfam09731, Mitofilin, Mitochondrial inner membrane protein Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|218734 pfam05758, Ycf1, Ycf1 Back     alignment and domain information
>gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|226889 COG4487, COG4487, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|227352 COG5019, CDC3, Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>gnl|CDD|184900 PRK14907, rplD, 50S ribosomal protein L4; Provisional Back     alignment and domain information
>gnl|CDD|178867 PRK00106, PRK00106, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|237178 PRK12705, PRK12705, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|217756 pfam03839, Sec62, Translocation protein Sec62 Back     alignment and domain information
>gnl|CDD|115057 pfam06375, BLVR, Bovine leukaemia virus receptor (BLVR) Back     alignment and domain information
>gnl|CDD|220371 pfam09736, Bud13, Pre-mRNA-splicing factor of RES complex Back     alignment and domain information
>gnl|CDD|227891 COG5604, COG5604, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|240370 PTZ00342, PTZ00342, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|115072 pfam06391, MAT1, CDK-activating kinase assembly factor MAT1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 446
PF1020368 Pet191_N: Cytochrome c oxidase assembly protein PE 99.85
KOG4114|consensus73 99.84
KOG1973|consensus274 99.05
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 98.88
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 98.78
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 98.75
KOG0825|consensus 1134 98.27
KOG1244|consensus336 98.1
KOG4323|consensus 464 97.83
KOG4299|consensus 613 97.75
KOG1844|consensus 508 97.74
KOG1512|consensus381 97.73
KOG1632|consensus 345 97.11
KOG0955|consensus 1051 96.97
KOG1245|consensus 1404 96.91
KOG0383|consensus 696 96.91
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 96.77
KOG0957|consensus707 96.73
KOG0954|consensus 893 96.36
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 95.89
PTZ00266 1021 NIMA-related protein kinase; Provisional 95.67
PF07227 446 DUF1423: Protein of unknown function (DUF1423); In 95.42
KOG0957|consensus 707 95.24
COG5141 669 PHD zinc finger-containing protein [General functi 95.22
KOG1632|consensus345 95.21
KOG0956|consensus 900 94.81
KOG4364|consensus 811 94.76
KOG4443|consensus 694 94.74
KOG4364|consensus 811 92.83
KOG0163|consensus1259 91.52
KOG1029|consensus 1118 91.21
KOG1144|consensus 1064 91.05
KOG2891|consensus445 90.18
KOG3054|consensus299 88.87
PF05262489 Borrelia_P83: Borrelia P83/100 protein; InterPro: 88.27
PF15446175 zf-PHD-like: PHD/FYVE-zinc-finger like domain 88.02
KOG1029|consensus 1118 87.09
PF0764930 C1_3: C1-like domain; InterPro: IPR011424 This sho 86.9
KOG1144|consensus 1064 85.79
KOG2752|consensus345 85.64
PF0749650 zf-CW: CW-type Zinc Finger; InterPro: IPR011124 Zi 82.78
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 82.47
KOG4443|consensus 694 81.2
KOG1473|consensus 1414 80.98
>PF10203 Pet191_N: Cytochrome c oxidase assembly protein PET191; InterPro: IPR018793 This entry represents a family of conserved proteins found from nematodes to humans Back     alignment and domain information
Probab=99.85  E-value=4.8e-22  Score=159.50  Aligned_cols=64  Identities=44%  Similarity=1.021  Sum_probs=60.3

Q ss_pred             cchhhhhHHhHHHHhhhccccccCCCChhhhhcCC---ChhhHHHHHhHHHhccccCcccccccccccCC
Q psy128          364 KSACAGSRADLKLCLLETDCVQVDRKTPRQCLREG---LAPQCEALKNTFFECKRSLLDTRQTVCRWIGK  430 (446)
Q Consensus       364 ~~SC~~iredLa~CLleSdC~~~~~~t~keCL~~~---lp~eC~~l~~~f~eCKR~llD~r~Rfrr~rGn  430 (446)
                      ++||++++++|+.||++||||+++++||+|||+++   ||.+|++|+++||+|||||||||+   |||||
T Consensus         2 ~~sC~~~~~~L~~Cl~~SdCv~~~~~t~~~Cl~~~~~~~p~eC~~lr~~f~eCKrg~lDmr~---RfRGn   68 (68)
T PF10203_consen    2 SKSCKGIREALAECLQESDCVKKEKRTPKDCLKDPSDELPEECQQLRKAFFECKRGMLDMRK---RFRGN   68 (68)
T ss_pred             CchHHHHHHHHHHHHhhChhhccCCCCHHHHHcCCCCcCCHHHHHHHHHHHHHhcccccccc---cccCc
Confidence            57999999999999999999999999999999987   899999999999999999999999   55555



Cytochrome c oxidase assembly protein Pet191 carries six highly conserved cysteine residues. Pet191 is required for the assembly of active cytochrome c oxidase but does not form part of the final assembled complex [].

>KOG4114|consensus Back     alignment and domain information
>KOG1973|consensus Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>KOG1244|consensus Back     alignment and domain information
>KOG4323|consensus Back     alignment and domain information
>KOG4299|consensus Back     alignment and domain information
>KOG1844|consensus Back     alignment and domain information
>KOG1512|consensus Back     alignment and domain information
>KOG1632|consensus Back     alignment and domain information
>KOG0955|consensus Back     alignment and domain information
>KOG1245|consensus Back     alignment and domain information
>KOG0383|consensus Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>KOG0957|consensus Back     alignment and domain information
>KOG0954|consensus Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>PF07227 DUF1423: Protein of unknown function (DUF1423); InterPro: IPR004082 A total of 715 potential protein-coding genes have been identified in the nucleotide sequence of Arabidopsis thaliana chromosome 5, with an average gene density of 1 gene per 4001 bp [] Back     alignment and domain information
>KOG0957|consensus Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG1632|consensus Back     alignment and domain information
>KOG0956|consensus Back     alignment and domain information
>KOG4364|consensus Back     alignment and domain information
>KOG4443|consensus Back     alignment and domain information
>KOG4364|consensus Back     alignment and domain information
>KOG0163|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG1144|consensus Back     alignment and domain information
>KOG2891|consensus Back     alignment and domain information
>KOG3054|consensus Back     alignment and domain information
>PF05262 Borrelia_P83: Borrelia P83/100 protein; InterPro: IPR007926 This family consists of several Borrelia P83/P100 antigen proteins Back     alignment and domain information
>PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>PF07649 C1_3: C1-like domain; InterPro: IPR011424 This short domain is rich in cysteines and histidines Back     alignment and domain information
>KOG1144|consensus Back     alignment and domain information
>KOG2752|consensus Back     alignment and domain information
>PF07496 zf-CW: CW-type Zinc Finger; InterPro: IPR011124 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG4443|consensus Back     alignment and domain information
>KOG1473|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query446
2k16_A75 Solution Structure Of The Free Taf3 Phd Domain Leng 2e-13
2ri7_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 9e-04
>pdb|2K16|A Chain A, Solution Structure Of The Free Taf3 Phd Domain Length = 75 Back     alignment and structure

Iteration: 1

Score = 73.6 bits (179), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 34/54 (62%), Positives = 38/54 (70%), Gaps = 2/54 (3%) Query: 273 SKQVWICPACGVQDDGSLPMIGCDGCDAWYHWVCVGLVAE-PETSDWFCPKCSK 325 Q+WICP C DDGS PMIGCD CD WYHW CVG++A PE WFCPKC+ Sbjct: 15 GNQIWICPGCNKPDDGS-PMIGCDDCDDWYHWPCVGIMAAPPEEMQWFCPKCAN 67
>pdb|2RI7|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Y17e Mutant From Human Bptf In The H3(1-9)k4me2 Bound State Length = 174 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query446
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 99.45
2k16_A75 Transcription initiation factor TFIID subunit 3; p 99.4
1weu_A91 Inhibitor of growth family, member 4; structural g 99.37
1wee_A72 PHD finger family protein; structural genomics, PH 99.36
3o70_A68 PHD finger protein 13; PHF13, structural genomics 99.34
1wew_A78 DNA-binding family protein; structural genomics, P 99.31
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 99.3
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 99.3
1wem_A76 Death associated transcription factor 1; structura 99.29
1we9_A64 PHD finger family protein; structural genomics, PH 99.29
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 99.26
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 99.25
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 99.24
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 99.23
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 99.16
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 99.15
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 99.14
1x4i_A70 Inhibitor of growth protein 3; structural genomics 99.13
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 99.12
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 99.11
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 99.09
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 98.98
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 98.97
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 98.96
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 98.95
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 98.94
3kv5_D 488 JMJC domain-containing histone demethylation prote 98.93
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 98.91
2yt5_A66 Metal-response element-binding transcription facto 98.89
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 98.88
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 98.86
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 98.86
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 98.86
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 98.84
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 98.84
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 98.83
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 98.81
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 98.77
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 98.75
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 98.75
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 98.7
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 98.68
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 98.65
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 98.62
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 98.58
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 98.53
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 98.48
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.44
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 98.38
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 98.32
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.02
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 97.95
3rsn_A177 SET1/ASH2 histone methyltransferase complex subun; 97.78
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 97.78
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 97.54
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 97.5
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 97.45
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 97.21
1wil_A89 KIAA1045 protein; ring finger domain, structural g 95.87
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 92.19
2pv0_B 386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 91.11
2ysl_A73 Tripartite motif-containing protein 31; ring-type 85.6
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 83.65
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 82.95
2ect_A78 Ring finger protein 126; metal binding protein, st 82.61
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
Probab=99.45  E-value=4.2e-14  Score=119.36  Aligned_cols=65  Identities=25%  Similarity=0.615  Sum_probs=52.3

Q ss_pred             CCCCCcccccccccCCCCCCCeeecCCCCCcccccccccCCCCCCCcEEcCCCCCcccCchhhHhhh
Q psy128          271 GDSKQVWICPACGVQDDGSLPMIGCDGCDAWYHWVCVGLVAEPETSDWFCPKCSKVDEGSRKEKKKR  337 (446)
Q Consensus       271 ed~~~~~~C~VCg~pdd~~~~mIqCD~C~~WfH~~Cvg~~~~~~~~~w~Cp~C~~k~~~~~K~kr~k  337 (446)
                      ..+.+++.| ||+.+++++ .||+||.|+.|||+.|++++....++.|+|+.|.+......+....+
T Consensus        23 ~~~~d~vrC-iC~~~~~~~-~mi~Cd~C~~w~H~~C~~~~~~~~p~~w~C~~C~~~~~~~~~~~~~q   87 (98)
T 2lv9_A           23 SYGTDVTRC-ICGFTHDDG-YMICCDKCSVWQHIDCMGIDRQHIPDTYLCERCQPRNLDKERAVLLQ   87 (98)
T ss_dssp             CCCCCBCCC-TTSCCSCSS-CEEEBTTTCBEEETTTTTCCTTSCCSSBCCTTTSSSCCCHHHHHHHH
T ss_pred             CCCCCCEEe-ECCCccCCC-cEEEcCCCCCcCcCcCCCCCccCCCCCEECCCCcCCCCCHHHHHHHH
Confidence            344557789 999988877 89999999999999999998875556899999998776655544433



>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 446
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 1e-13
d1wepa_79 g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus 2e-11
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 6e-11
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 2e-10
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 1e-08
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 4e-08
d1wewa_78 g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale c 1e-07
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 1e-07
d2pnxa151 g.50.1.2 (A:195-245) Inhibitor of growth protein 4 2e-07
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 3e-07
d1wesa_71 g.50.1.2 (A:) PHD Inhibitor of growth protein 2, I 2e-06
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 8e-04
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 0.001
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 0.001
d1sa0e_138 a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus 0.002
d1twfa_1449 e.29.1.2 (A:) RBP1 {Baker's yeast (Saccharomyces c 0.003
d1twfa_ 1449 e.29.1.2 (A:) RBP1 {Baker's yeast (Saccharomyces c 0.004
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure

class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: PHD finger protein At5g26210
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
 Score = 63.5 bits (154), Expect = 1e-13
 Identities = 18/57 (31%), Positives = 22/57 (38%), Gaps = 2/57 (3%)

Query: 271 GDSKQVWICPACGVQDDGSLPMIGCDGCDAWYHWVCVGLVAE--PETSDWFCPKCSK 325
           G S     C ACG         I CD C+ W+H  CV +          + CP CS 
Sbjct: 1   GSSGSSGQCGACGESYAADEFWICCDLCEMWFHGKCVKITPARAEHIKQYKCPSCSN 57


>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 71 Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1twfa_ e.29.1.2 (A:) RBP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 1449 Back     information, alignment and structure
>d1twfa_ e.29.1.2 (A:) RBP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 1449 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query446
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 99.23
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 99.22
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 99.09
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 99.09
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 99.09
d1wema_76 Death associated transcription factor 1, Datf1 (DI 99.06
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 99.03
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 99.02
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 98.99
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 98.95
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 98.72
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 87.81
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 86.91
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 86.72
d1weqa_85 PHD finger protein 7 (NYD-SP6) {Mouse (Mus musculu 81.67
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: PHD finger protein At1g33420
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=99.23  E-value=1.3e-12  Score=101.91  Aligned_cols=54  Identities=31%  Similarity=0.800  Sum_probs=45.2

Q ss_pred             CCCCcccccccccCCCCCCCeeecCCCCCcccccccccCCC-CCCCcEEcCCCCCc
Q psy128          272 DSKQVWICPACGVQDDGSLPMIGCDGCDAWYHWVCVGLVAE-PETSDWFCPKCSKV  326 (446)
Q Consensus       272 d~~~~~~C~VCg~pdd~~~~mIqCD~C~~WfH~~Cvg~~~~-~~~~~w~Cp~C~~k  326 (446)
                      .+++.++| +|+.+++++..||+||.|+.|||+.|++++.. .+.+.|+|+.|...
T Consensus        12 ~~~~~~~C-~C~~~~~~~~~mv~Cd~C~~w~H~~C~g~~~~~~~~~~~~C~~C~~~   66 (72)
T d1weea_          12 VDNWKVDC-KCGTKDDDGERMLACDGCGVWHHTRCIGINNADALPSKFLCFRCIEL   66 (72)
T ss_dssp             SCSSEECC-TTCCCSCCSSCEEECSSSCEEEETTTTTCCTTSCCCSCCCCHHHHHH
T ss_pred             CCCCeEEe-eCCCCcCCCCeEEEeCCCCCcCchhhcCCccccCCCCcEECcCCcCc
Confidence            34567789 99988766658999999999999999999877 55679999999854



>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weqa_ g.50.1.2 (A:) PHD finger protein 7 (NYD-SP6) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure