Psyllid ID: psy12947

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----

MLSRICLAVFGFLSLVSCQVELPQKEWWQTAIMYQIYPRILIVESYTDIENTMKYFKYNGRPAAHYPFNFQLVIDPDRNSNATTISRLLHNWLDNLPAEDIERGLIVSKSKGLTEGTVTATFTKISSLVVPDIVCGGWWFESGPQTKFELKPPV

ccHHHHHHHHccccEEEccccccHHHHHHHHHHHcccccEEEEEccccHHHHHHcccccccccccccccEEEcccccccccHHHHHHHHHHHHHcccccccccEEccccccccccccccHHHHHHHHHHcccEEEccccccccccccccccccc

cHHHHHHHHHHHHHEcccEccccHHHHHHHHHHcccccEEEEEEEcccHHHHHHHHcccccccccccccEEEEEcccccccHHHHHHHHHHHHHcccccccccEEEEccccccccccEEcEcccccEEEcccEEEcccEEccccccEEEEcccc

MLSRICLAVFGFLSLVSCQVELPQKEWWQTAIMYQIYPRILIVESYTDIENTMKyfkyngrpaahypfnfqlvidpdrnsnaTTISRLLHNWldnlpaedierglivskskgltegtvTATFTKISslvvpdivcggwwfesgpqtkfelkppv

MLSRICLAVFGFLSLVSCQVELPQKEWWQTAIMYQIYPRILIVESYTDIENTMKYFKYNGRPAAHYPFNFQLVIDPDRNSNATTISRLLHNWLDNLPAEDIERGLIVskskgltegtvtatftkisslvvPDIVCGGWWfesgpqtkfelkppv

MLSRICLAVFGFLSLVSCQVELPQKEWWQTAIMYQIYPRILIVESYTDIENTMKYFKYNGRPAAHYPFNFQLVIDPDRNSNATTISRLLHNWLDNLPAEDIERGLIVSKSKGLTEGTVTATFTKISSLVVPDIVCGGWWFESGPQTKFELKPPV

***RICLAVFGFLSLVSCQVELPQKEWWQTAIMYQIYPRILIVESYTDIENTMKYFKYNGRPAAHYPFNFQLVIDPDRNSNATTISRLLHNWLDNLPAEDIERGLIVSKSKGLTEGTVTATFTKISSLVVPDIVCGGWWFE*************

**SRICLAVFGFLSLVSCQVELPQKEWWQTAIMYQIYPRILIVESYTDIENTMKYFKYNGRPAAHYPFNFQLVIDPDRNSNATTISRLLHNWLDNLPAEDIERGLIVSKSKGLTEGTVTATFTKISSLVVPDIVCGGWWFESGPQTKFELKPP*

MLSRICLAVFGFLSLVSCQVELPQKEWWQTAIMYQIYPRILIVESYTDIENTMKYFKYNGRPAAHYPFNFQLVIDPDRNSNATTISRLLHNWLDNLPAEDIERGLIVSKSKGLTEGTVTATFTKISSLVVPDIVCGGWWFESGPQTKFELKPPV

MLSRICLAVFGFLSLVSCQVELPQKEWWQTAIMYQIYPRILIVESYTDIENTMKYFKYNGRPAAHYPFNFQLVIDPDRNSNATTISRLLHNWLDNLPAEDIERGLIVSKSKGLTEGTVTATFTKISSLVVPDIVCGGWWFESGPQTKFELKPP*

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MLSRICLAVFGFLSLVSCQVELPQKEWWQTAIMYQIYPRILIVESYTDIENTMKYFKYNGRPAAHYPFNFQLVIDPDRNSNATTISRLLHNWLDNLPAEDIERGLIVSKSKGLTEGTVTATFTKISSLVVPDIVCGGWWFESGPQTKFELKPPV

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		154	2.2.26 [Sep-21-2011]
P07192		574	Maltase A3 OS=Drosophila	yes	N/A	0.383	0.102	0.389	5e-07
Q17058		567	Alpha-glucosidase OS=Apis	yes	N/A	0.389	0.105	0.343	1e-06
P07190		577	Probable maltase H OS=Dro	no	N/A	0.324	0.086	0.338	0.0001
O16098		632	Maltase 1 OS=Drosophila v	N/A	N/A	0.383	0.093	0.333	0.0006

>sp\|P07192\|MAL3_DROME Maltase A3 OS=Drosophila melanogaster GN=Mal-A3 PE=2 SV=2	Back alignment and function desciption

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 37/59 (62%)

Query: 39  RILIVESYTDIENTMKYFKYNGRPAAHYPFNFQLVIDPDRNSNATTISRLLHNWLDNLP 97
           R+L+ E+Y+ +E  M+Y+       +  PFNF+L+     +S+A   S L+HNWLDN+P
Sbjct: 288 RVLLTEAYSPLEVLMQYYGNGTHLGSQIPFNFELLAKISYSSDAYHYSELIHNWLDNMP 346

Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 2EC: .EC: 1EC: .EC: 2EC: 0

>sp\|Q17058\|MAL1_APIME Alpha-glucosidase OS=Apis mellifera PE=1 SV=1	Back alignment and function description

>sp\|P07190\|MAL2_DROME Probable maltase H OS=Drosophila melanogaster GN=LvpH PE=2 SV=2	Back alignment and function description

>sp\|O16098\|MAL1_DROVI Maltase 1 OS=Drosophila virilis GN=Mal-B1 PE=3 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		154
193709215		621	PREDICTED: probable maltase H [Acyrthosi	0.383	0.095	0.457	7e-08
195024836		575	GH20810 [Drosophila grimshawi] gi\|193901	0.389	0.104	0.416	3e-07
345493688		559	PREDICTED: alpha-glucosidase-like [Nason	0.376	0.103	0.387	5e-07
215259593		584	salivary alpha-glucosidase [Culex tarsal	0.389	0.102	0.466	6e-07
195430366		578	GK21811 [Drosophila willistoni] gi\|19415	0.383	0.102	0.423	6e-07
195381855		575	GJ20630 [Drosophila virilis] gi\|19414445	0.409	0.109	0.396	7e-07
215259637		297	alpha-glucosidase [Culex tarsalis]	0.389	0.202	0.466	9e-07
350415030		561	PREDICTED: maltase 1-like [Bombus impati	0.350	0.096	0.396	1e-06
307210528		560	Alpha-glucosidase [Harpegnathos saltator	0.383	0.105	0.353	2e-06
170062220		584	alpha-glucosidase [Culex quinquefasciatu	0.389	0.102	0.433	4e-06

>gi\|193709215\|ref\|XP_001943317.1\| PREDICTED: probable maltase H [Acyrthosiphon pisum]	Back alignment and taxonomy information

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 39/59 (66%)

Query: 39  RILIVESYTDIENTMKYFKYNGRPAAHYPFNFQLVIDPDRNSNATTISRLLHNWLDNLP 97
           R++I E+YT +ENTM+Y+       AH PFNF L+   +  SNAT  +  ++NWLDN+P
Sbjct: 297 RVMITEAYTSMENTMRYYGDETSLGAHMPFNFGLIDRLNEYSNATKFNEAINNWLDNMP 355

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|195024836\|ref\|XP_001985946.1\| GH20810 [Drosophila grimshawi] gi\|193901946\|gb\|EDW00813.1\| GH20810 [Drosophila grimshawi]	Back alignment and taxonomy information

>gi\|345493688\|ref\|XP_001604662.2\| PREDICTED: alpha-glucosidase-like [Nasonia vitripennis]	Back alignment and taxonomy information

>gi\|215259593\|gb\|ACJ64288.1\| salivary alpha-glucosidase [Culex tarsalis]	Back alignment and taxonomy information

>gi\|195430366\|ref\|XP_002063227.1\| GK21811 [Drosophila willistoni] gi\|194159312\|gb\|EDW74213.1\| GK21811 [Drosophila willistoni]	Back alignment and taxonomy information

>gi\|195381855\|ref\|XP_002049659.1\| GJ20630 [Drosophila virilis] gi\|194144456\|gb\|EDW60852.1\| GJ20630 [Drosophila virilis]	Back alignment and taxonomy information

>gi\|215259637\|gb\|ACJ64310.1\| alpha-glucosidase [Culex tarsalis]	Back alignment and taxonomy information

>gi\|350415030\|ref\|XP_003490510.1\| PREDICTED: maltase 1-like [Bombus impatiens]	Back alignment and taxonomy information

>gi\|307210528\|gb\|EFN87018.1\| Alpha-glucosidase [Harpegnathos saltator]	Back alignment and taxonomy information

>gi\|170062220\|ref\|XP_001866573.1\| alpha-glucosidase [Culex quinquefasciatus] gi\|167880215\|gb\|EDS43598.1\| alpha-glucosidase [Culex quinquefasciatus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		154
FB\|FBgn0002571		574	Mal-A3 "Maltase A3" [Drosophil	0.383	0.102	0.389	2.7e-11
FB\|FBgn0033297		588	Mal-A8 "Maltase A8" [Drosophil	0.383	0.100	0.3	7.4e-09
FB\|FBgn0002570		577	Mal-A1 "Maltase A1" [Drosophil	0.383	0.102	0.338	6.1e-07
FB\|FBgn0050359		630	Mal-A5 "Maltase A5" [Drosophil	0.383	0.093	0.338	1.4e-06
FB\|FBgn0033296		599	Mal-A7 "Maltase A7" [Drosophil	0.389	0.100	0.377	5e-06
ZFIN\|ZDB-GENE-090313-225		674	slc3a1 "solute carrier family	0.376	0.086	0.327	5.4e-06
FB\|FBgn0033294		579	Mal-A4 "Maltase A4" [Drosophil	0.512	0.136	0.352	4.9e-05
FB\|FBgn0050360		601	Mal-A6 "Maltase A6" [Drosophil	0.461	0.118	0.320	8.8e-05

FB\|FBgn0002571 Mal-A3 "Maltase A3" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 127 (49.8 bits), Expect = 2.7e-11, Sum P(2) = 2.7e-11
 Identities = 23/59 (38%), Positives = 37/59 (62%)

Query:    39 RILIVESYTDIENTMKYFKYNGRPAAHYPFNFQLVIDPDRNSNATTISRLLHNWLDNLP 97
             R+L+ E+Y+ +E  M+Y+       +  PFNF+L+     +S+A   S L+HNWLDN+P
Sbjct:   288 RVLLTEAYSPLEVLMQYYGNGTHLGSQIPFNFELLAKISYSSDAYHYSELIHNWLDNMP 346

GO:0004558 "alpha-glucosidase activity" evidence=NAS

GO:0006006 "glucose metabolic process" evidence=NAS

GO:0003824 "catalytic activity" evidence=IEA

GO:0005975 "carbohydrate metabolic process" evidence=IEA

GO:0043169 "cation binding" evidence=IEA

FB\|FBgn0033297 Mal-A8 "Maltase A8" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0002570 Mal-A1 "Maltase A1" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0050359 Mal-A5 "Maltase A5" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0033296 Mal-A7 "Maltase A7" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-090313-225 slc3a1 "solute carrier family 3, member 1" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

FB\|FBgn0033294 Mal-A4 "Maltase A4" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0050360 Mal-A6 "Maltase A6" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		154
cd11328		470	cd11328, AmyAc_maltase, Alpha amylase catalytic do	1e-18
cd11359		456	cd11359, AmyAc_SLC3A1, Alpha amylase catalytic dom	8e-12
cd11331		450	cd11331, AmyAc_OligoGlu_like, Alpha amylase cataly	2e-05
cd11328		470	cd11328, AmyAc_maltase, Alpha amylase catalytic do	2e-04
cd11359		456	cd11359, AmyAc_SLC3A1, Alpha amylase catalytic dom	2e-04
cd11331		450	cd11331, AmyAc_OligoGlu_like, Alpha amylase cataly	9e-04
cd11332		481	cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalyti	0.003

>gnl\|CDD\|200467 cd11328, AmyAc_maltase, Alpha amylase catalytic domain found in maltase (also known as alpha glucosidase) and related proteins	Back alignment and domain information

 Score = 81.1 bits (201), Expect = 1e-18
 Identities = 26/61 (42%), Positives = 42/61 (68%)

Query: 38  PRILIVESYTDIENTMKYFKYNGRPAAHYPFNFQLVIDPDRNSNATTISRLLHNWLDNLP 97
            R+++ E+Y+ ++NTMKY+       AH+PFNF+L+ + ++NSNAT    L+  WLDN+P
Sbjct: 265 TRVMMTEAYSSLDNTMKYYGNETTYGAHFPFNFELITNLNKNSNATDFKDLIDKWLDNMP 324

Query: 98  A 98
            
Sbjct: 325 E 325

Maltase (EC 3.2.1.20) hydrolyzes the terminal, non-reducing (1->4)-linked alpha-D-glucose residues in maltose, releasing alpha-D-glucose. In most cases, maltase is equivalent to alpha-glucosidase, but the term "maltase" emphasizes the disaccharide nature of the substrate from which glucose is cleaved, and the term "alpha-glucosidase" emphasizes the bond, whether the substrate is a disaccharide or polysaccharide. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase. Length = 470

>gnl\|CDD\|200494 cd11359, AmyAc_SLC3A1, Alpha amylase catalytic domain found in Solute Carrier family 3 member 1 proteins	Back alignment and domain information

>gnl\|CDD\|200470 cd11331, AmyAc_OligoGlu_like, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase) and related proteins	Back alignment and domain information

>gnl\|CDD\|200467 cd11328, AmyAc_maltase, Alpha amylase catalytic domain found in maltase (also known as alpha glucosidase) and related proteins	Back alignment and domain information

>gnl\|CDD\|200494 cd11359, AmyAc_SLC3A1, Alpha amylase catalytic domain found in Solute Carrier family 3 member 1 proteins	Back alignment and domain information

>gnl\|CDD\|200470 cd11331, AmyAc_OligoGlu_like, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase) and related proteins	Back alignment and domain information

>gnl\|CDD\|200471 cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), trehalose synthase (also called maltose alpha-D-glucosyltransferase), and related proteins	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		154
PRK10933		551	trehalose-6-phosphate hydrolase; Provisional	99.89
TIGR02403		543	trehalose_treC alpha,alpha-phosphotrehalase. Treha	99.88
TIGR02456		539	treS_nterm trehalose synthase. Trehalose synthase	99.74
KOG0471\|consensus		545		99.67
PRK09505		683	malS alpha-amylase; Reviewed	99.61
PF00128		316	Alpha-amylase: Alpha amylase, catalytic domain; In	99.61
PRK10785		598	maltodextrin glucosidase; Provisional	99.52
PRK09441		479	cytoplasmic alpha-amylase; Reviewed	99.34
COG0366		505	AmyA Glycosidases [Carbohydrate transport and meta	99.11
TIGR03852		470	sucrose_gtfA sucrose phosphorylase. In the forward	99.06
TIGR02402		542	trehalose_TreZ malto-oligosyltrehalose trehalohydr	98.87
PLN00196		428	alpha-amylase; Provisional	98.73
PLN02361		401	alpha-amylase	98.65
TIGR02104		605	pulA_typeI pullulanase, type I. Pullulan is an unu	98.65
TIGR02455		688	TreS_stutzeri trehalose synthase, Pseudomonas stut	98.49
TIGR01515		613	branching_enzym alpha-1,4-glucan:alpha-1,4-glucan	98.38
PRK13840		495	sucrose phosphorylase; Provisional	98.35
PRK12313		633	glycogen branching enzyme; Provisional	98.23
PRK05402		726	glycogen branching enzyme; Provisional	98.13
PRK14510		1221	putative bifunctional 4-alpha-glucanotransferase/g	98.1
PRK14706		639	glycogen branching enzyme; Provisional	97.91
TIGR02401		825	trehalose_TreY malto-oligosyltrehalose synthase. T	97.77
PLN02784		894	alpha-amylase	97.48
PRK14511		879	maltooligosyl trehalose synthase; Provisional	96.67
TIGR02100		688	glgX_debranch glycogen debranching enzyme GlgX. Th	96.43
PRK12568		730	glycogen branching enzyme; Provisional	96.1
PRK03705		658	glycogen debranching enzyme; Provisional	95.3
PRK14705		1224	glycogen branching enzyme; Provisional	94.34
TIGR02102		1111	pullulan_Gpos pullulanase, extracellular, Gram-pos	93.9
PLN02960		897	alpha-amylase	93.07
COG0296		628	GlgB 1,4-alpha-glucan branching enzyme [Carbohydra	81.76

>PRK10933 trehalose-6-phosphate hydrolase; Provisional	Back alignment and domain information

Probab=99.89  E-value=3.8e-23  Score=185.51  Aligned_cols=108  Identities=10%  Similarity=0.069  Sum_probs=89.1

Q ss_pred             CceEEEEeec-CHHHHHHhhhcCCCCCccccccccCCcCC---C-----CCCCHHHHHHHHHHHHHhCCCCCCcceeccC
Q psy12947         38 PRILIVESYT-DIENTMKYFKYNGRPAAHYPFNFQLVIDP---D-----RNSNATTISRLLHNWLDNLPAEDIERGLIVS  108 (154)
Q Consensus        38 ~r~lVGE~~~-~~~~~~~yyg~~~~~el~~~FNF~ll~~~---~-----~~~~~~~~~~~i~~w~~~l~~~~wp~wvlgN  108 (154)
                      +.++|||++. +.+.+..|... ..++++++|||..+...   .     ..++...+++++..|+..++..+|++|+++|
T Consensus       245 ~~~~vgE~~~~~~~~~~~y~~~-~~~~~~~~fnf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~fl~N  323 (551)
T PRK10933        245 GLMTVGEMSSTSLEHCQRYAAL-TGSELSMTFNFHHLKVDYPNGEKWTLAKPDFVALKTLFRHWQQGMHNVAWNALFWCN  323 (551)
T ss_pred             CcEEEEeecCCCHHHHHHhhcc-cCCeeeeEecHHHhhhhhccCCcccccccCHHHHHHHHHHHHHhhcccCeeccccCC
Confidence            6789999987 56677777653 34689999999864310   0     1235678999999999998888899999999


Q ss_pred             CCccccccchh---------HHHHHHHHhhCCCceeeecccccccCC
Q psy12947        109 KSKGLTEGTVT---------ATFTKISSLVVPDIVCGGWWFESGPQT  146 (154)
Q Consensus       109 HD~pR~vSR~g---------~~~l~~LlLtLpGt~~~y~geElG~~~  146 (154)
                      ||++|++||+|         +++++++++||||+||+|||||+||..
T Consensus       324 HD~~R~~sr~g~~~~~~~~~aklla~ll~tlpG~P~IYyGeEiGm~~  370 (551)
T PRK10933        324 HDQPRIVSRFGDEGEYRVPAAKMLAMVLHGMQGTPYIYQGEEIGMTN  370 (551)
T ss_pred             CCcccHHHHcCCchhHHHHHHHHHHHHHHhCCCceEEEeecccCCCC
Confidence            99999999997         346788999999999999999999987

>TIGR02403 trehalose_treC alpha,alpha-phosphotrehalase	Back alignment and domain information

>TIGR02456 treS_nterm trehalose synthase	Back alignment and domain information

>KOG0471\|consensus	Back alignment and domain information

>PRK09505 malS alpha-amylase; Reviewed	Back alignment and domain information

>PF00128 Alpha-amylase: Alpha amylase, catalytic domain; InterPro: IPR006047 O-Glycosyl hydrolases 3	Back alignment and domain information

>PRK10785 maltodextrin glucosidase; Provisional	Back alignment and domain information

>PRK09441 cytoplasmic alpha-amylase; Reviewed	Back alignment and domain information

>COG0366 AmyA Glycosidases [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR03852 sucrose_gtfA sucrose phosphorylase	Back alignment and domain information

>TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase	Back alignment and domain information

>PLN00196 alpha-amylase; Provisional	Back alignment and domain information

>PLN02361 alpha-amylase	Back alignment and domain information

>TIGR02104 pulA_typeI pullulanase, type I	Back alignment and domain information

>TIGR02455 TreS_stutzeri trehalose synthase, Pseudomonas stutzeri type	Back alignment and domain information

>TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase	Back alignment and domain information

>PRK13840 sucrose phosphorylase; Provisional	Back alignment and domain information

>PRK12313 glycogen branching enzyme; Provisional	Back alignment and domain information

>PRK05402 glycogen branching enzyme; Provisional	Back alignment and domain information

>PRK14510 putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional	Back alignment and domain information

>PRK14706 glycogen branching enzyme; Provisional	Back alignment and domain information

>TIGR02401 trehalose_TreY malto-oligosyltrehalose synthase	Back alignment and domain information

>PLN02784 alpha-amylase	Back alignment and domain information

>PRK14511 maltooligosyl trehalose synthase; Provisional	Back alignment and domain information

>TIGR02100 glgX_debranch glycogen debranching enzyme GlgX	Back alignment and domain information

>PRK12568 glycogen branching enzyme; Provisional	Back alignment and domain information

>PRK03705 glycogen debranching enzyme; Provisional	Back alignment and domain information

>PRK14705 glycogen branching enzyme; Provisional	Back alignment and domain information

>TIGR02102 pullulan_Gpos pullulanase, extracellular, Gram-positive	Back alignment and domain information

>PLN02960 alpha-amylase	Back alignment and domain information

>COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		154
1zja_A		557	Trehalulose synthase; sucrose isomerase, alpha-amy	4e-05
1m53_A		570	Isomaltulose synthase; klebsiella SP. LX3, sucrose	8e-05
2ze0_A		555	Alpha-glucosidase; TIM barrel, glucoside hydrolase	2e-04
2zic_A		543	Dextran glucosidase; TIM barrel, (beta/alpha)8-bar	2e-04
3aj7_A		589	Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro	2e-04
1uok_A		558	Oligo-1,6-glucosidase; sugar degradation, hydrolas	2e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	7e-04

>1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Length = 557	Back alignment and structure

 Score = 41.4 bits (98), Expect = 4e-05
 Identities = 9/17 (52%), Positives = 13/17 (76%)

Query: 23 PQKEWWQTAIMYQIYPR 39
          P   WW++A+ YQ+YPR
Sbjct: 2  PGAPWWKSAVFYQVYPR 18

PyMOL of 1zja

>1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Length = 570	Back alignment and structure

>2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Length = 555	Back alignment and structure

>2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Length = 543	Back alignment and structure

>3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Length = 589	Back alignment and structure

>1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Length = 558	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		154
2ze0_A		555	Alpha-glucosidase; TIM barrel, glucoside hydrolase	99.84
1uok_A		558	Oligo-1,6-glucosidase; sugar degradation, hydrolas	99.84
3k8k_A		669	Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet	99.83
3aj7_A		589	Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro	99.82
1zja_A		557	Trehalulose synthase; sucrose isomerase, alpha-amy	99.82
2zic_A		543	Dextran glucosidase; TIM barrel, (beta/alpha)8-bar	99.81
1m53_A		570	Isomaltulose synthase; klebsiella SP. LX3, sucrose	99.8
2dh2_A		424	4F2 cell-surface antigen heavy chain; TIM-barrel,	99.76
4aie_A		549	Glucan 1,6-alpha-glucosidase; hydrolase, glycoside	99.71
1wza_A		488	Alpha-amylase A; hydrolase, halophilic, thermophil	99.7
2wc7_A		488	Alpha amylase, catalytic region; CD/PUL-hydrolyzin	99.6
1lwj_A		441	4-alpha-glucanotransferase; alpha-amylase family,	99.58
3czg_A		644	Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC;	99.57
1qho_A		686	Alpha-amylase; glycoside hydrolase, starch degrada	99.57
1g5a_A		628	Amylosucrase; glycosyltransferase, glycoside hydro	99.57
3dhu_A		449	Alpha-amylase; structural genomics, hydrolase, gly	99.55
3edf_A		601	FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c	99.52
4aee_A		696	Alpha amylase, catalytic region; hydrolase, hypert	99.52
1cyg_A		680	Cyclodextrin glucanotransferase; glycosyltransfera	99.5
2aaa_A		484	Alpha-amylase; glycosidase; 2.10A {Aspergillus nig	99.5
2z1k_A		475	(NEO)pullulanase; hydrolase, structural genomics,	99.49
3bmv_A		683	Cyclomaltodextrin glucanotransferase; glycosidase,	99.49
1j0h_A		588	Neopullulanase; beta-alpha-barrels, hydrolase; 1.9	99.49
1d3c_A		686	Cyclodextrin glycosyltransferase; alpha-amylase, p	99.48
2guy_A		478	Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase;	99.46
3aie_A		844	Glucosyltransferase-SI; beta-alpha-barrels; HET: M	99.45
1wzl_A		585	Alpha-amylase II; pullulan, GH-13, alpha-amylase f	99.43
1ea9_C		583	Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A	99.42
1ji1_A		637	Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6	99.41
3zss_A		695	Putative glucanohydrolase PEP1A; alpha-glucan bios	99.41
3ucq_A		655	Amylosucrase; thermostability, amylose synthesis,	99.38
1r7a_A		504	Sucrose phosphorylase; beta-alpha-barrels, dimer,	99.38
4aef_A		645	Neopullulanase (alpha-amylase II); hydrolase, ther	99.37
1wpc_A		485	Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr	99.37
3bc9_A		599	AMYB, alpha amylase, catalytic region; acarbose, t	99.34
1ud2_A		480	Amylase, alpha-amylase; calcium-free, alkaline, hy	99.31
3bh4_A		483	Alpha-amylase; calcium, carbohydrate metabolism, g	99.3
1hvx_A		515	Alpha-amylase; hydrolase, glycosyltransferase, the	99.28
1gjw_A		637	Maltodextrin glycosyltransferase; alpha-amylase, m	99.21
3klk_A		1039	Glucansucrase; native form, open conformation, mul	99.21
1m7x_A		617	1,4-alpha-glucan branching enzyme; alpha/beta barr	99.09
2e8y_A		718	AMYX protein, pullulanase; multiple domain, beta-a	99.06
1g94_A		448	Alpha-amylase; beta-alpha-8-barrel, 3 domain struc	99.05
1mxg_A		435	Alpha amylase; hyperthermostable, family 13 glycos	99.04
1ht6_A		405	AMY1, alpha-amylase isozyme 1; barley, beta-alpha-	99.03
1jae_A		471	Alpha-amylase; glycosidase, carbohydrate metabolis	99.0
4aio_A		884	Limit dextrinase; hydrolase, pullulanase, glycosid	98.97
3m07_A		618	Putative alpha amylase; IDP00968, csgid, structura	98.95
2bhu_A		602	Maltooligosyltrehalose trehalohydrolase; alpha-amy	98.92
3aml_A		755	OS06G0726400 protein; starch-branching, transferas	98.89
2wan_A		921	Pullulanase; hydrolase, glycoside hydrolase, polys	98.85
3vgf_A		558	Malto-oligosyltrehalose trehalohydrolase; alpha/be	98.83
2wsk_A		657	Glycogen debranching enzyme; carbohydrate metaboli	98.57
2fhf_A		1083	Pullulanase; multiple domain, beta-alpha-barrel, a	98.48
1gcy_A		527	Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b	98.45
3k1d_A		722	1,4-alpha-glucan-branching enzyme; mycobacterium t	98.4
2vr5_A		718	Glycogen operon protein GLGX; hydrolase, glycosida	98.3
2ya0_A		714	Putative alkaline amylopullulanase; hydrolase, gly	98.2
2ya1_A		1014	Putative alkaline amylopullulanase; hydrolase, gly	97.96
1ua7_A		422	Alpha-amylase; beta-alpha-barrels, acarbose, greek	97.86
1bf2_A		750	Isoamylase; hydrolase, glycosidase, debranching en	97.49
4gqr_A		496	Pancreatic alpha-amylase; glycosyl hydrolase, diab	97.45
3faw_A		877	Reticulocyte binding protein; TIM barrel, beta bar	97.42
1iv8_A		720	Maltooligosyl trehalose synthase; beta alpha barre	93.3

>2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP}	Back alignment and structure

Probab=99.84  E-value=2.8e-21  Score=170.71  Aligned_cols=121  Identities=12%  Similarity=0.035  Sum_probs=99.0

Q ss_pred             hhHHHHH-HHHhhcCCCceEEEEeec-CHHHHHHhhhcCCCCCccccccccCCcCCC----CCCCHHHHHHHHHHHHHhC
Q psy12947         23 PQKEWWQ-TAIMYQIYPRILIVESYT-DIENTMKYFKYNGRPAAHYPFNFQLVIDPD----RNSNATTISRLLHNWLDNL   96 (154)
Q Consensus        23 ~~re~R~-vld~Y~g~~r~lVGE~~~-~~~~~~~yyg~~~~~el~~~FNF~ll~~~~----~~~~~~~~~~~i~~w~~~l   96 (154)
                      -.++||+ +.+++   +.++|||+++ +.+.+..|.+. ...+++++|||.+.....    ..++..++++.+.+|+..+
T Consensus       237 ~~~~~r~~v~~~~---~~~~vgE~~~~~~~~~~~y~~~-~~~~~~~~~~f~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~  312 (555)
T 2ze0_A          237 YLRELKEQTFARY---DIMTVGEANGVTVDEAEQWVGE-ENGVFNMIFQFEHLGLWERRADGSIDVRRLKRTLTKWQKGL  312 (555)
T ss_dssp             HHHHHHHHTGGGS---SCEEEEECTTCCTTTTHHHHCS-SSCSCSEEECCTTCCCCCCCC--CCCHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHhhccC---CeEEEeccCCCCHHHHHHHhcc-ccccccceeehHHHhhhhccccCCCCHHHHHHHHHHHHhhc
Confidence            3566776 44554   6899999995 66677788864 357899999999864211    3578899999999999888


Q ss_pred             CCCCCcceeccCCCccccccchh---------HHHHHHHHhhCCCceeeecccccccCCC
Q psy12947         97 PAEDIERGLIVSKSKGLTEGTVT---------ATFTKISSLVVPDIVCGGWWFESGPQTK  147 (154)
Q Consensus        97 ~~~~wp~wvlgNHD~pR~vSR~g---------~~~l~~LlLtLpGt~~~y~geElG~~~~  147 (154)
                      +..+|++++++|||++|++||+|         .++++++++++||+||+|||+|+||...
T Consensus       313 ~~~~~~~~fl~NHD~~R~~s~~g~~~~~~~~~~k~~~~~l~t~pG~P~iy~G~E~G~~~~  372 (555)
T 2ze0_A          313 ENRGWNALFLENHDLPRSVSTWGNDRDYWAESAKALGALYFFMQGTPFIYQGQEIGMTNV  372 (555)
T ss_dssp             TTTCCBEECSCCTTSCCHHHHTSCSSSSHHHHHHHHHHHHHTSSSEEEEETTGGGTCCCC
T ss_pred             cCCCceeeeecCCCCcchhhhhCCchhhhHHHHHHHHHHHHhCCCceEEEeceecCcCCC
Confidence            87789999999999999999985         4678899999999999999999999873

PyMOL of 2ze0

>1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1	Back alignment and structure

>3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A*	Back alignment and structure

>3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A*	Back alignment and structure

>1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A*	Back alignment and structure

>2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A*	Back alignment and structure

>1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1	Back alignment and structure

>2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A	Back alignment and structure

>4aie_A Glucan 1,6-alpha-glucosidase; hydrolase, glycoside hydrolase 13; HET: MES GOL; 2.05A {Lactobacillus acidophilus ncfm}	Back alignment and structure

>1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1	Back alignment and structure

>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A	Back alignment and structure

>1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A*	Back alignment and structure

>3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A	Back alignment and structure

>1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A*	Back alignment and structure

>1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A*	Back alignment and structure

>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum}	Back alignment and structure

>3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A	Back alignment and structure

>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus}	Back alignment and structure

>1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1	Back alignment and structure

>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1	Back alignment and structure

>2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus}	Back alignment and structure

>3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A	Back alignment and structure

>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A*	Back alignment and structure

>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ...	Back alignment and structure

>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A	Back alignment and structure

>3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A*	Back alignment and structure

>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A	Back alignment and structure

>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1	Back alignment and structure

>1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A	Back alignment and structure

>3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A*	Back alignment and structure

>3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A*	Back alignment and structure

>1r7a_A Sucrose phosphorylase; beta-alpha-barrels, dimer, glycoside hydrolase, transferase; 1.77A {Bifidobacterium adolescentis} SCOP: b.71.1.1 c.1.8.1 PDB: 2gdv_A* 2gdu_A*	Back alignment and structure

>4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus}	Back alignment and structure

>1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A*	Back alignment and structure

>3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A	Back alignment and structure

>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A	Back alignment and structure

>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A	Back alignment and structure

>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1	Back alignment and structure

>1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A*	Back alignment and structure

>3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* 4amc_A	Back alignment and structure

>1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A*	Back alignment and structure

>2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A*	Back alignment and structure

>1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A*	Back alignment and structure

>1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A*	Back alignment and structure

>1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A*	Back alignment and structure

>1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A*	Back alignment and structure

>4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A	Back alignment and structure

>3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp}	Back alignment and structure

>2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A*	Back alignment and structure

>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A	Back alignment and structure

>2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus}	Back alignment and structure

>3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A	Back alignment and structure

>2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12}	Back alignment and structure

>2fhf_A Pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with maltotetraose, hydrolase; HET: GLC; 1.65A {Klebsiella aerogenes} SCOP: b.1.18.2 b.1.18.2 b.3.1.3 b.71.1.1 c.1.8.1 PDB: 2fh6_A* 2fh8_A* 2fhb_A* 2fhc_A* 2fgz_A*	Back alignment and structure

>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A*	Back alignment and structure

>3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis}	Back alignment and structure

>2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A	Back alignment and structure

>2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A*	Back alignment and structure

>2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae}	Back alignment and structure

>1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A	Back alignment and structure

>1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1	Back alignment and structure

>4gqr_A Pancreatic alpha-amylase; glycosyl hydrolase, diabetes, obesity, digestion, glycosidas inhibition, flavonol, drug design; HET: NAG MYC; 1.20A {Homo sapiens} PDB: 1cpu_A* 1bsi_A 1u2y_A* 1u30_A* 1u33_A* 1xcw_A* 1xcx_A* 1xd0_A* 1xd1_A* 2qmk_A* 2qv4_A* 3bai_A* 3baj_A* 3baw_A* 3ij7_A* 1hny_A* 3ij9_A* 3ij8_A* 4gqq_A* 1kgw_A* ...	Back alignment and structure

>3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A*	Back alignment and structure

>1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		154
d1ji1a3		432	c.1.8.1 (A:123-554) Maltogenic amylase, central do	7e-04
d1uoka2		479	c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus	0.002

>d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} Length = 432	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Amylase, catalytic domain
domain: Maltogenic amylase, central domain
species: Thermoactinomyces vulgaris, TVAI [TaxId: 2026]

 Score = 36.7 bits (83), Expect = 7e-04
 Identities = 12/56 (21%), Positives = 24/56 (42%), Gaps = 1/56 (1%)

Query: 26 EWWQTAIMYQIYPRILIVESYTDIENTMKYFKYNGRPAAHYPFNFQLVIDPDRNSN 81
          +W +  +MYQI+P        +  +     + YNG P     +   +  DP  +++
Sbjct: 6  DWLKNGVMYQIFPD-RFYNGDSSNDVQTGSYTYNGTPTEKKAWGSSVYADPGYDNS 60

PyMOL of d1ji1a3

>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Length = 479	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		154
d1m53a2		478	Isomaltulose synthase PalI {Klebsiella sp., lx3 [T	99.73
d1uoka2		479	Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13	99.67
d2guya2		381	Fungal alpha-amylases {Aspergillus oryzae, Taka-am	99.61
d1wzaa2		409	Bacterial alpha-amylase {Halothermothrix orenii [T	99.53
d1ji1a3		432	Maltogenic amylase, central domain {Thermoactinomy	99.51
d2aaaa2		381	Fungal alpha-amylases {Aspergillus niger, acid amy	99.49
d1qhoa4		407	Cyclodextrin glycosyltransferase {Bacillus stearot	99.46
d1h3ga3		422	Cyclomaltodextrinase, central domain {Flavobacteri	99.44
d3bmva4		406	Cyclodextrin glycosyltransferase {Thermoanaerobact	99.42
d1lwha2		391	4-alpha-glucanotransferase {Thermotoga maritima [T	99.4
d1hvxa2		393	Bacterial alpha-amylase {Bacillus stearothermophil	99.34
d1j0ha3		382	Neopullulanase, central domain {Bacillus stearothe	99.33
d1e43a2		393	Bacterial alpha-amylase {Chimera (Bacillus amyloli	99.32
d1wzla3		382	Maltogenic amylase, central domain {Thermoactinomy	99.25
d1g5aa2		554	Amylosucrase {Neisseria polysaccharea [TaxId: 489]	99.25
d2fhfa5		563	Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57	99.24
d1ea9c3		382	Maltogenic amylase, central domain {Bacillus sp.,	99.22
d2d3na2		394	Bacterial alpha-amylase {Bacillus sp. 707 [TaxId:	99.19
d1mxga2		361	Bacterial alpha-amylase {Archaeon Pyrococcus woese	99.12
d1ud2a2		390	Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta	99.07
d1r7aa2		434	Sucrose phosphorylase {Bifidobacterium adolescenti	98.91
d1ht6a2		347	Plant alpha-amylase {Barley (Hordeum vulgare), AMY	98.86
d1eh9a3		400	Glycosyltrehalose trehalohydrolase, central domain	98.8
d1gjwa2		572	Maltosyltransferase {Thermotoga maritima [TaxId: 2	98.79
d2bhua3		420	Glycosyltrehalose trehalohydrolase, central domain	98.76
d1gcya2		357	G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase	98.75
d1m7xa3		396	1,4-alpha-glucan branching enzyme, central domain	98.63
d1g94a2		354	Bacterial alpha-amylase {Pseudoalteromonas halopla	98.5
d1ua7a2		344	Bacterial alpha-amylase {Bacillus subtilis [TaxId:	98.45
d1hx0a2		403	Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982	98.26
d1jaea2		378	Animal alpha-amylase {Yellow mealworm (Tenebrio mo	97.9
d1bf2a3		475	Isoamylase, central domain {Pseudomonas amyloderam	97.81

>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Amylase, catalytic domain
domain: Isomaltulose synthase PalI
species: Klebsiella sp., lx3 [TaxId: 576]

Probab=99.73  E-value=2.7e-18  Score=143.29  Aligned_cols=108  Identities=9%  Similarity=0.019  Sum_probs=88.3

Q ss_pred             CceEEEEeecC-HHHHHHhhhcCCCCCccccccccCCcCCC--------CCCCHHHHHHHHHHHHHhCCCCCCcceeccC
Q psy12947         38 PRILIVESYTD-IENTMKYFKYNGRPAAHYPFNFQLVIDPD--------RNSNATTISRLLHNWLDNLPAEDIERGLIVS  108 (154)
Q Consensus        38 ~r~lVGE~~~~-~~~~~~yyg~~~~~el~~~FNF~ll~~~~--------~~~~~~~~~~~i~~w~~~l~~~~wp~wvlgN  108 (154)
                      +.+++||++.. .+....|+. ....+++++|+|+++....        ...++..+++.+..+....+..+|++|+++|
T Consensus       247 ~~~~~~e~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~n  325 (478)
T d1m53a2         247 DVATAGEIFGVPLDRSSQFFD-RRRHELNMAFMFDLIRLDRDSNERWRHKSWSLSQFRQIISKMDVTVGKYGWNTFFLDN  325 (478)
T ss_dssp             CCEEEEECTTCCGGGTHHHHC-GGGCSCSEEECCTTTTTTBCSSCTTCBCCCCHHHHHHHHHHHHHHHTTTCCBEECSCC
T ss_pred             ccceeeeecCCCHHHHHhhhc-ccCCccccccchhhhhhhhhhhhhhccccccHHHHHHHHHHHHhhhcccccceeeccC
Confidence            68999999984 455555554 3457899999998864211        2357899999999999888888899999999


Q ss_pred             CCccccccchh----------HHHHHHHHhhCCCceeeecccccccCC
Q psy12947        109 KSKGLTEGTVT----------ATFTKISSLVVPDIVCGGWWFESGPQT  146 (154)
Q Consensus       109 HD~pR~vSR~g----------~~~l~~LlLtLpGt~~~y~geElG~~~  146 (154)
                      ||.+|..|+++          .++++++++|+||+|++|||+|+||..
T Consensus       326 hd~~R~~~~~~~~~~~~~~~~~~~~~~lllt~pGiP~iyyGdEiG~~~  373 (478)
T d1m53a2         326 HDNPRAVSHFGDDRPQWREASAKALATITLTQRATPFIYQGSELGMTN  373 (478)
T ss_dssp             TTSCCHHHHHSCCSTTTHHHHHHHHHHHHTSSSSEEEEETTTTTTCCC
T ss_pred             CCCcccccccCCchHHHHHHHHHHHHHHHHhCCCCCEEecccccCCcC
Confidence            99999999975          346788999999999999999999964

PyMOL of d1m53a2

>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]}	Back information, alignment and structure

>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]}	Back information, alignment and structure

>d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]}	Back information, alignment and structure

>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]}	Back information, alignment and structure

>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]}	Back information, alignment and structure

>d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]}	Back information, alignment and structure

>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]}	Back information, alignment and structure

>d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]}	Back information, alignment and structure

>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}	Back information, alignment and structure

>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]}	Back information, alignment and structure

>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]}	Back information, alignment and structure

>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]}	Back information, alignment and structure

>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]}	Back information, alignment and structure

>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]}	Back information, alignment and structure

>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]}	Back information, alignment and structure

>d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]}	Back information, alignment and structure

>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]}	Back information, alignment and structure

>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]}	Back information, alignment and structure

>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]}	Back information, alignment and structure

>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]}	Back information, alignment and structure

>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]}	Back information, alignment and structure

>d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]}	Back information, alignment and structure

>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]}	Back information, alignment and structure