Psyllid ID: psy12951


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
MAANAAPKLRTLSQKFRPLLDRILVIKDEPLTKTKGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEVEGQELHLFKEADLLAVIEKDS
cccccccHHHHccccccccccEEEEEEccccccccccEEEcccccccccEEEEEEEcccccccccEEEccccccccEEEcccccccEEEEccEEEEEEEcccEEEEEEccc
cccccccccccEEEEEcccccEEEEEEEcccccccccEEEcccccccccccEEEEEccccccccccEEEEEEEcccEEEEEEccccEEEEcccEEEEEEHHHEEEEEEccc
maanaapklrTLSQKFRPLLDRILVikdepltktkggvlipekaqqeVNNAVVVAvgpgartpngeyikpvvnvgdkvllpkfggtkieVEGQELHLFKEADLLAVIEKDS
maanaapklrtlsqkfrplldrilvikdepltktkggvlipekaqqevnNAVVVAVGPgartpngeyikpvvnVGDKVLLPKFGGTKIEvegqelhlfkeadllaviekds
MAANAAPKLRTLSQKFRPLLDRILVIKDEPLTKTKGGVLIPEKAQQEvnnavvvavGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEVEGQELHLFKEADLLAVIEKDS
**************KFRPLLDRILVIKDEPLTKTKGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEVEGQELHLFKEADLLAVI****
**************KFRPLLDRILVIKDEPLTKTKGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEVEGQELHLFKEADLLAVIEK**
********LRTLSQKFRPLLDRILVIKDEPLTKTKGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEVEGQELHLFKEADLLAVIEKDS
*******KLRTLSQKFRPLLDRILVIKDEPLTKTKGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEVEGQELHLFKEADLLAVIEKD*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAANAAPKLRTLSQKFRPLLDRILVIKDEPLTKTKGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEVEGQELHLFKEADLLAVIEKDS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query111 2.2.26 [Sep-21-2011]
Q5DC69102 10 kDa heat shock protein N/A N/A 0.864 0.941 0.520 1e-21
P0CAU096 10 kDa chaperonin OS=Caul yes N/A 0.846 0.979 0.489 1e-19
B8H16496 10 kDa chaperonin OS=Caul yes N/A 0.846 0.979 0.489 1e-19
B0SXR396 10 kDa chaperonin OS=Caul yes N/A 0.846 0.979 0.468 7e-19
Q98IV4104 10 kDa chaperonin 1 OS=Rh yes N/A 0.855 0.913 0.442 2e-18
Q9W6X399 10 kDa heat shock protein N/A N/A 0.828 0.929 0.5 3e-18
A5G9I196 10 kDa chaperonin OS=Geob yes N/A 0.855 0.989 0.505 5e-18
Q5LV1695 10 kDa chaperonin OS=Rueg yes N/A 0.837 0.978 0.451 5e-18
B9LZ3696 10 kDa chaperonin OS=Geob yes N/A 0.855 0.989 0.494 7e-18
P35474104 10 kDa chaperonin 5 OS=Rh yes N/A 0.828 0.884 0.478 8e-18
>sp|Q5DC69|CH10_SCHJA 10 kDa heat shock protein, mitochondrial OS=Schistosoma japonicum GN=SJCHGC01960 PE=3 SV=2 Back     alignment and function desciption
 Score =  101 bits (252), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 68/96 (70%)

Query: 14  QKFRPLLDRILVIKDEPLTKTKGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVN 73
           +KF PL DR+LV + E  TK+KGG+++PEKA+ +V  A VVA GPG +   GE +   V 
Sbjct: 7   RKFAPLFDRVLVQRFEAETKSKGGIMLPEKAKGKVLEATVVAHGPGVKNEKGEVVPVCVT 66

Query: 74  VGDKVLLPKFGGTKIEVEGQELHLFKEADLLAVIEK 109
           VGDKV LP++GGTK+ +E  E  LF+E+D+LA  EK
Sbjct: 67  VGDKVFLPEYGGTKVVLEDTEYFLFRESDILAKFEK 102




Eukaryotic CPN10 homolog which is essential for mitochondrial protein biogenesis, together with CPN60. Binds to CPN60 in the presence of Mg-ATP and suppresses the ATPase activity of the latter.
Schistosoma japonicum (taxid: 6182)
>sp|P0CAU0|CH10_CAUCR 10 kDa chaperonin OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=groS PE=3 SV=1 Back     alignment and function description
>sp|B8H164|CH10_CAUCN 10 kDa chaperonin OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=groS PE=2 SV=1 Back     alignment and function description
>sp|B0SXR3|CH10_CAUSK 10 kDa chaperonin OS=Caulobacter sp. (strain K31) GN=groS PE=3 SV=1 Back     alignment and function description
>sp|Q98IV4|CH101_RHILO 10 kDa chaperonin 1 OS=Rhizobium loti (strain MAFF303099) GN=groS1 PE=3 SV=1 Back     alignment and function description
>sp|Q9W6X3|CH10_ORYLA 10 kDa heat shock protein, mitochondrial OS=Oryzias latipes GN=hspe1 PE=3 SV=1 Back     alignment and function description
>sp|A5G9I1|CH10_GEOUR 10 kDa chaperonin OS=Geobacter uraniireducens (strain Rf4) GN=groS PE=3 SV=1 Back     alignment and function description
>sp|Q5LV16|CH10_RUEPO 10 kDa chaperonin OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=groS PE=3 SV=1 Back     alignment and function description
>sp|B9LZ36|CH10_GEOSF 10 kDa chaperonin OS=Geobacter sp. (strain FRC-32) GN=groS PE=3 SV=1 Back     alignment and function description
>sp|P35474|CH105_RHIME 10 kDa chaperonin 5 OS=Rhizobium meliloti (strain 1021) GN=groS5 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query111
242016119109 10 kDa heat shock protein, putative [Ped 0.972 0.990 0.550 2e-25
321473721101 hypothetical protein DAPPUDRAFT_209506 [ 0.864 0.950 0.572 4e-25
357612773103 putative 10 kDa heat shock protein [Dana 0.900 0.970 0.549 1e-23
390339575103 PREDICTED: 10 kDa heat shock protein, mi 0.873 0.941 0.556 1e-23
156541992104 PREDICTED: 10 kDa heat shock protein, mi 0.918 0.980 0.541 2e-23
423292354105 10 kDa heat shock protein [Lygus hesperu 0.855 0.904 0.541 5e-23
91083979103 PREDICTED: similar to AGAP001502-PA [Tri 0.837 0.902 0.585 8e-23
312374891100 hypothetical protein AND_29109 [Anophele 0.864 0.96 0.571 9e-23
241998156101 heat shock protein [Ixodes scapularis] g 0.846 0.930 0.542 2e-22
427786059101 Putative mitochondrial chaperonin [Rhipi 0.846 0.930 0.542 8e-22
>gi|242016119|ref|XP_002428683.1| 10 kDa heat shock protein, putative [Pediculus humanus corporis] gi|212513354|gb|EEB15945.1| 10 kDa heat shock protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 81/109 (74%), Gaps = 1/109 (0%)

Query: 1   MAANAAPKLRTLSQKFRPLLDRILVIKDEPLTKTKGGVLIPEKAQQEVNNAVVVAVGPGA 60
           MAA   P+     ++  PL DR+LV + E +TKTKGG++IPEKAQ +V +  VVAVGPG+
Sbjct: 1   MAAAVKPQFVPALKRLVPLFDRVLVQRAEAVTKTKGGIVIPEKAQSKVLHGTVVAVGPGS 60

Query: 61  RTPNGEYIKPVVNVGDKVLLPKFGGTKIEV-EGQELHLFKEADLLAVIE 108
           R  NGE+I   V VGDKVLLP++GGTK+E+ E +E HLF+E+D+LA +E
Sbjct: 61  RNQNGEFIPLAVKVGDKVLLPEYGGTKVELEENKEFHLFRESDILAKVE 109




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|321473721|gb|EFX84688.1| hypothetical protein DAPPUDRAFT_209506 [Daphnia pulex] Back     alignment and taxonomy information
>gi|357612773|gb|EHJ68162.1| putative 10 kDa heat shock protein [Danaus plexippus] Back     alignment and taxonomy information
>gi|390339575|ref|XP_003725038.1| PREDICTED: 10 kDa heat shock protein, mitochondrial-like isoform 2 [Strongylocentrotus purpuratus] gi|390339577|ref|XP_001198018.2| PREDICTED: 10 kDa heat shock protein, mitochondrial-like isoform 1 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|156541992|ref|XP_001599992.1| PREDICTED: 10 kDa heat shock protein, mitochondrial-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|423292354|gb|AFX84557.1| 10 kDa heat shock protein [Lygus hesperus] Back     alignment and taxonomy information
>gi|91083979|ref|XP_975179.1| PREDICTED: similar to AGAP001502-PA [Tribolium castaneum] gi|270006714|gb|EFA03162.1| hypothetical protein TcasGA2_TC013081 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|312374891|gb|EFR22359.1| hypothetical protein AND_29109 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|241998156|ref|XP_002433721.1| heat shock protein [Ixodes scapularis] gi|51011554|gb|AAT92186.1| heat shock protein 10 [Ixodes pacificus] gi|215495480|gb|EEC05121.1| heat shock protein [Ixodes scapularis] Back     alignment and taxonomy information
>gi|427786059|gb|JAA58481.1| Putative mitochondrial chaperonin [Rhipicephalus pulchellus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query111
FB|FBgn0036334103 CG11267 [Drosophila melanogast 0.855 0.922 0.489 5.1e-19
WB|WBGene00021248108 Y22D7AL.10 [Caenorhabditis ele 0.954 0.981 0.415 3.6e-18
GENEDB_PFALCIPARUM|PFL0740c103 PFL0740c "10 kd chaperonin, pu 0.891 0.961 0.4 1.2e-17
UNIPROTKB|F1NGP9101 HSPE1 "Uncharacterized protein 0.810 0.891 0.5 1.2e-17
UNIPROTKB|O42283102 HSPE1 "Uncharacterized protein 0.810 0.882 0.5 1.2e-17
UNIPROTKB|Q8I5Q3103 Cpn10 "10 kd chaperonin" [Plas 0.891 0.961 0.4 1.2e-17
ZFIN|ZDB-GENE-000906-2100 hspe1 "heat shock 10 protein 1 0.819 0.91 0.428 8.6e-17
MGI|MGI:104680102 Hspe1 "heat shock protein 1 (c 0.810 0.882 0.445 1.1e-16
UNIPROTKB|P61603102 HSPE1 "10 kDa heat shock prote 0.810 0.882 0.445 1.4e-16
UNIPROTKB|E2QUS9102 COQ10B "Uncharacterized protei 0.810 0.882 0.445 1.4e-16
FB|FBgn0036334 CG11267 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 228 (85.3 bits), Expect = 5.1e-19, P = 5.1e-19
 Identities = 48/98 (48%), Positives = 67/98 (68%)

Query:    14 QKFRPLLDRILVIKDEPLTKTKGGVLIPEKAQQEXXXXXXXXXGPGARTPN-GEYIKPVV 72
             +K  P+LDRIL+ + E LTKTKGG+++PEKA  +         GPG R  + G +I   V
Sbjct:     6 KKIIPMLDRILIQRAEALTKTKGGIVLPEKAVGKVLEGTVLAVGPGTRNASTGNHIPIGV 65

Query:    73 NVGDKVLLPKFGGTKIEVEG--QELHLFKEADLLAVIE 108
               GD+VLLP+FGGTK+ +EG  +EL LF+E+D+LA +E
Sbjct:    66 KEGDRVLLPEFGGTKVNLEGDQKELFLFRESDILAKLE 103




GO:0051082 "unfolded protein binding" evidence=ISS
GO:0005739 "mitochondrion" evidence=ISS
GO:0006458 "'de novo' protein folding" evidence=ISS
GO:0005759 "mitochondrial matrix" evidence=ISS
GO:0005811 "lipid particle" evidence=IDA
WB|WBGene00021248 Y22D7AL.10 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PFL0740c PFL0740c "10 kd chaperonin, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|F1NGP9 HSPE1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|O42283 HSPE1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q8I5Q3 Cpn10 "10 kd chaperonin" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-000906-2 hspe1 "heat shock 10 protein 1 (chaperonin 10)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:104680 Hspe1 "heat shock protein 1 (chaperonin 10)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P61603 HSPE1 "10 kDa heat shock protein, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUS9 COQ10B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q98IV4CH101_RHILONo assigned EC number0.44210.85580.9134yesN/A
Q5LV16CH10_RUEPONo assigned EC number0.45160.83780.9789yesN/A
P0CAU0CH10_CAUCRNo assigned EC number0.48930.84680.9791yesN/A
C5CPP9CH10_VARPSNo assigned EC number0.45260.85580.9895yesN/A
B1ZAU6CH10_METPBNo assigned EC number0.45160.83780.9687yesN/A
A5G9I1CH10_GEOURNo assigned EC number0.50520.85580.9895yesN/A
B6IU97CH10_RHOCSNo assigned EC number0.41230.87380.9417yesN/A
O59804CH10_SCHPONo assigned EC number0.40380.92790.9903yesN/A
Q747C8CH10_GEOSLNo assigned EC number0.48380.83780.9789yesN/A
B1LVA1CH10_METRJNo assigned EC number0.45160.83780.9687yesN/A
A8ZU47CH10_DESOHNo assigned EC number0.45740.84680.9894yesN/A
P60366CH101_RHOPANo assigned EC number0.44560.82880.9387yesN/A
Q9Z463CH10_PARDENo assigned EC number0.44560.82880.9684yesN/A
P30780CH10_AGRT5No assigned EC number0.43150.85580.9693yesN/A
B9KPJ9CH10_RHOSKNo assigned EC number0.42390.82880.9684yesN/A
Q1GJ37CH10_RUESTNo assigned EC number0.44560.82880.9684yesN/A
P25969CH101_RHOSHNo assigned EC number0.42390.82880.9684yesN/A
A4WUL6CH10_RHOS5No assigned EC number0.43470.82880.9684yesN/A
B1XXY8CH10_LEPCPNo assigned EC number0.43150.85580.9895yesN/A
B9LZ36CH10_GEOSFNo assigned EC number0.49470.85580.9895yesN/A
B8ER19CH10_METSBNo assigned EC number0.43470.82880.9684yesN/A
B5ZRD7CH10_RHILWNo assigned EC number0.41050.85580.9693yesN/A
B2ICU3CH10_BEII9No assigned EC number0.43470.82880.9684yesN/A
P35474CH105_RHIMENo assigned EC number0.47870.82880.8846yesN/A
P38910CH10_YEASTNo assigned EC number0.46800.83780.8773yesN/A
Q4FPA6CH10_PELUBNo assigned EC number0.43470.82880.9583yesN/A
Q5DC69CH10_SCHJANo assigned EC number0.52080.86480.9411N/AN/A
A5G1G3CH10_ACICJNo assigned EC number0.41480.84680.9038yesN/A
Q2GCC7CH10_NOVADNo assigned EC number0.45650.82880.9684yesN/A
B9K1Y7CH10_AGRVSNo assigned EC number0.43150.85580.9693yesN/A
A2SCV0CH10_METPPNo assigned EC number0.44210.85580.9895yesN/A
B0SXR3CH10_CAUSKNo assigned EC number0.46800.84680.9791yesN/A
Q3J420CH10_RHOS4No assigned EC number0.42390.82880.9684yesN/A
A7HQQ1CH10_PARL1No assigned EC number0.45740.84680.8952yesN/A
A1AST2CH10_PELPDNo assigned EC number0.46800.84680.9894yesN/A
A3PIC9CH10_RHOS1No assigned EC number0.42390.82880.9684yesN/A
P95677CH10_RHOCANo assigned EC number0.44560.82880.9684yesN/A
Q28LY6CH10_JANSCNo assigned EC number0.42390.82880.9684yesN/A
B8H164CH10_CAUCNNo assigned EC number0.48930.84680.9791yesN/A
A9BXL2CH10_DELASNo assigned EC number0.46800.84680.9791yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
smart0088393 smart00883, Cpn10, Chaperonin 10 Kd subunit 9e-36
cd0032093 cd00320, cpn10, Chaperonin 10 Kd subunit (cpn10 or 1e-34
COG023496 COG0234, GroS, Co-chaperonin GroES (HSP10) [Posttr 3e-29
PRK0036495 PRK00364, groES, co-chaperonin GroES; Reviewed 9e-29
pfam0016691 pfam00166, Cpn10, Chaperonin 10 Kd subunit 2e-27
PTZ00414100 PTZ00414, PTZ00414, 10 kDa heat shock protein; Pro 7e-20
PRK1453391 PRK14533, groES, co-chaperonin GroES; Provisional 8e-09
>gnl|CDD|197951 smart00883, Cpn10, Chaperonin 10 Kd subunit Back     alignment and domain information
 Score =  117 bits (295), Expect = 9e-36
 Identities = 44/93 (47%), Positives = 65/93 (69%)

Query: 15  KFRPLLDRILVIKDEPLTKTKGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNV 74
           K +PL DR+LV + E   KT GG++IP+ A+++     VVAVGPG R  NGE +   V V
Sbjct: 1   KIKPLGDRVLVKRIEEEEKTAGGIVIPDTAKEKPQEGEVVAVGPGKRLENGERVPLDVKV 60

Query: 75  GDKVLLPKFGGTKIEVEGQELHLFKEADLLAVI 107
           GDKVL  K+ GT+++++G+E  + +E+D+LAVI
Sbjct: 61  GDKVLFGKYAGTEVKLDGEEYLILRESDILAVI 93


The chaperonins are 'helper' molecules required for correct folding and subsequent assembly of some proteins. These are required for normal cell growth, and are stress-induced, acting to stabilise or protect disassembled polypeptides under heat-shock conditions. Type I chaperonins present in eubacteria, mitochondria and chloroplasts require the concerted action of 2 proteins, chaperonin 60 (cpn60) and chaperonin 10 (cpn10). The 10 kDa chaperonin (cpn10 - or groES in bacteria) exists as a ring-shaped oligomer of between six to eight identical subunits, while the 60 kDa chaperonin (cpn60 - or groEL in bacteria) forms a structure comprising 2 stacked rings, each ring containing 7 identical subunits. These ring structures assemble by self-stimulation in the presence of Mg2+-ATP. The central cavity of the cylindrical cpn60 tetradecamer provides as isolated environment for protein folding whilst cpn-10 binds to cpn-60 and synchronizes the release of the folded protein in an Mg2+-ATP dependent manner. The binding of cpn10 to cpn60 inhibits the weak ATPase activity of cpn60. Length = 93

>gnl|CDD|238197 cd00320, cpn10, Chaperonin 10 Kd subunit (cpn10 or GroES); Cpn10 cooperates with chaperonin 60 (cpn60 or GroEL), an ATPase, to assist the folding and assembly of proteins and is found in eubacterial cytosol, as well as in the matrix of mitochondria and chloroplasts Back     alignment and domain information
>gnl|CDD|223312 COG0234, GroS, Co-chaperonin GroES (HSP10) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|178988 PRK00364, groES, co-chaperonin GroES; Reviewed Back     alignment and domain information
>gnl|CDD|201050 pfam00166, Cpn10, Chaperonin 10 Kd subunit Back     alignment and domain information
>gnl|CDD|173604 PTZ00414, PTZ00414, 10 kDa heat shock protein; Provisional Back     alignment and domain information
>gnl|CDD|184730 PRK14533, groES, co-chaperonin GroES; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 111
COG023496 GroS Co-chaperonin GroES (HSP10) [Posttranslationa 100.0
PRK0036495 groES co-chaperonin GroES; Reviewed 100.0
PTZ00414100 10 kDa heat shock protein; Provisional 100.0
cd0032093 cpn10 Chaperonin 10 Kd subunit (cpn10 or GroES); C 100.0
PRK1453391 groES co-chaperonin GroES; Provisional 100.0
PF0016693 Cpn10: Chaperonin 10 Kd subunit; InterPro: IPR0208 100.0
KOG1641|consensus104 99.98
KOG1197|consensus 336 91.95
PF08240109 ADH_N: Alcohol dehydrogenase GroES-like domain; In 90.27
COG1062 366 AdhC Zn-dependent alcohol dehydrogenases, class II 89.81
COG4384203 Mu-like prophage protein gp45 [Function unknown] 84.66
COG0604 326 Qor NADPH:quinone reductase and related Zn-depende 83.06
COG1329 166 Transcriptional regulators, similar to M. xanthus 82.93
KOG0025|consensus 354 81.79
>COG0234 GroS Co-chaperonin GroES (HSP10) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=9.4e-41  Score=226.81  Aligned_cols=96  Identities=44%  Similarity=0.785  Sum_probs=93.8

Q ss_pred             cceeeeCCeEEEEecCCCCcccceEEeccCccccceeeEEEEecCceeCCCCeeecceeeeCCEEEccCCCceEEEECCE
Q psy12951         14 QKFRPLLDRILVIKDEPLTKTKGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEVEGQ   93 (111)
Q Consensus        14 ~~i~PlgDrVLVk~~~~e~~T~gGIiLP~~~~~k~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~y~g~~v~~~g~   93 (111)
                      |+|+||+|||||++.++|++|+|||+||+++++|+++|+|+|||+|..+++|+.+|++||+||+|+|++|+|+++++||+
T Consensus         1 m~ikPL~DRVlVk~~e~EekT~gGIvlpdsakeK~~~g~VvAVG~G~~~~~g~~~~~~VkvGD~Vlf~ky~G~evk~dge   80 (96)
T COG0234           1 MKIKPLGDRVLVKRVEEEEKTAGGIVLPDSAKEKPQEGEVVAVGPGRRDENGELVPLDVKVGDRVLFGKYAGTEVKIDGE   80 (96)
T ss_pred             CCceecCCEEEEEEchhhccccCcEEecCccccCCcceEEEEEccceecCCCCEeccccccCCEEEECccCCcEEEECCE
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEEecCcEEEEeec
Q psy12951         94 ELHLFKEADLLAVIEK  109 (111)
Q Consensus        94 ~y~iv~~~DIlavi~~  109 (111)
                      +|++++++||||++++
T Consensus        81 eylil~e~DILAiv~~   96 (96)
T COG0234          81 EYLILSESDILAIVEK   96 (96)
T ss_pred             EEEEechHHeeEEecC
Confidence            9999999999999874



>PRK00364 groES co-chaperonin GroES; Reviewed Back     alignment and domain information
>PTZ00414 10 kDa heat shock protein; Provisional Back     alignment and domain information
>cd00320 cpn10 Chaperonin 10 Kd subunit (cpn10 or GroES); Cpn10 cooperates with chaperonin 60 (cpn60 or GroEL), an ATPase, to assist the folding and assembly of proteins and is found in eubacterial cytosol, as well as in the matrix of mitochondria and chloroplasts Back     alignment and domain information
>PRK14533 groES co-chaperonin GroES; Provisional Back     alignment and domain information
>PF00166 Cpn10: Chaperonin 10 Kd subunit; InterPro: IPR020818 The chaperonins are `helper' molecules required for correct folding and subsequent assembly of some proteins [] Back     alignment and domain information
>KOG1641|consensus Back     alignment and domain information
>KOG1197|consensus Back     alignment and domain information
>PF08240 ADH_N: Alcohol dehydrogenase GroES-like domain; InterPro: IPR013154 This is the catalytic domain of alcohol dehydrogenases (1 Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>COG4384 Mu-like prophage protein gp45 [Function unknown] Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>COG1329 Transcriptional regulators, similar to M Back     alignment and domain information
>KOG0025|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
1we3_O100 Crystal Structure Of The Chaperonin Complex Cpn60CP 9e-12
1wnr_A94 Crystal Structure Of The Cpn10 From Thermus Thermop 1e-11
3nx6_A95 Crystal Structure Of Co-Chaperonin, Groes (Xoo4289) 9e-11
1hx5_A99 Crystal Structure Of M. Tuberculosis Chaperonin-10 2e-10
1lep_A99 Three-Dimensional Structure Of The Immunodominant H 2e-10
1aon_O97 Crystal Structure Of The Asymmetric Chaperonin Comp 2e-07
>pdb|1WE3|O Chain O, Crystal Structure Of The Chaperonin Complex Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS Length = 100 Back     alignment and structure

Iteration: 1

Score = 65.1 bits (157), Expect = 9e-12, Method: Compositional matrix adjust. Identities = 35/93 (37%), Positives = 57/93 (61%) Query: 16 FRPLLDRILVIKDEPLTKTKGGVLIPEKAQQEXXXXXXXXXGPGARTPNGEYIKPVVNVG 75 +PL DR++V + E KTKGG+++P+ A+++ G G NG+ + V G Sbjct: 8 IKPLGDRVVVKRIEEEPKTKGGIVLPDTAKEKPQKGKVIAVGTGRVLENGQRVPLEVKEG 67 Query: 76 DKVLLPKFGGTKIEVEGQELHLFKEADLLAVIE 108 D V+ K+GGT+IE++G+E + E DLLAV++ Sbjct: 68 DIVVFAKYGGTEIEIDGEEYVILSERDLLAVLQ 100
>pdb|1WNR|A Chain A, Crystal Structure Of The Cpn10 From Thermus Thermophilus Hb8 Length = 94 Back     alignment and structure
>pdb|3NX6|A Chain A, Crystal Structure Of Co-Chaperonin, Groes (Xoo4289) From Xanthomonas Oryzae Pv. Oryzae Kacc10331 Length = 95 Back     alignment and structure
>pdb|1HX5|A Chain A, Crystal Structure Of M. Tuberculosis Chaperonin-10 Length = 99 Back     alignment and structure
>pdb|1LEP|A Chain A, Three-Dimensional Structure Of The Immunodominant Heat- Shock Protein Chaperonin-10 Of Mycobacterium Leprae Length = 99 Back     alignment and structure
>pdb|1AON|O Chain O, Crystal Structure Of The Asymmetric Chaperonin Complex GroelGROES(ADP)7 Length = 97 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
1we3_O100 CPN10(groes); chaperonin, chaperone, groel, HSP60, 5e-29
1p3h_A99 10 kDa chaperonin; beta barrel, acidic cluster, fl 3e-28
3nx6_A95 10KDA chaperonin; bacterial blight, XOO4289, groes 4e-28
1pcq_O97 Groes protein; chaperone; HET: ADP; 2.81A {Escheri 1e-26
>1we3_O CPN10(groes); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} SCOP: b.35.1.1 PDB: 1wf4_o* 1wnr_A Length = 100 Back     alignment and structure
 Score = 99.5 bits (249), Expect = 5e-29
 Identities = 38/98 (38%), Positives = 62/98 (63%)

Query: 11  TLSQKFRPLLDRILVIKDEPLTKTKGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKP 70
            +    +PL DR++V + E   KTKGG+++P+ A+++     V+AVG G    NG+ +  
Sbjct: 3   EVKTVIKPLGDRVVVKRIEEEPKTKGGIVLPDTAKEKPQKGKVIAVGTGRVLENGQRVPL 62

Query: 71  VVNVGDKVLLPKFGGTKIEVEGQELHLFKEADLLAVIE 108
            V  GD V+  K+GGT+IE++G+E  +  E DLLAV++
Sbjct: 63  EVKEGDIVVFAKYGGTEIEIDGEEYVILSERDLLAVLQ 100


>1p3h_A 10 kDa chaperonin; beta barrel, acidic cluster, flexible loop, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: b.35.1.1 PDB: 1hx5_A 1lep_A 1p82_A 1p83_A Length = 99 Back     alignment and structure
>3nx6_A 10KDA chaperonin; bacterial blight, XOO4289, groes, xanthomonas oryzae PV. ORY KACC10331, chaperone; 1.97A {Xanthomonas oryzae PV} Length = 95 Back     alignment and structure
>1pcq_O Groes protein; chaperone; HET: ADP; 2.81A {Escherichia coli} SCOP: b.35.1.1 PDB: 1gru_O 1aon_O* 1pf9_O* 1svt_O* 1sx4_O* 2c7c_O 2c7d_O Length = 97 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query111
1p3h_A99 10 kDa chaperonin; beta barrel, acidic cluster, fl 100.0
3nx6_A95 10KDA chaperonin; bacterial blight, XOO4289, groes 100.0
1pcq_O97 Groes protein; chaperone; HET: ADP; 2.81A {Escheri 100.0
1we3_O100 CPN10(groes); chaperonin, chaperone, groel, HSP60, 100.0
1g31_A111 GP31; chaperone, CO-chaperonin, groes, in VIVO pro 99.95
3qwb_A 334 Probable quinone oxidoreductase; rossmann fold, qu 89.85
3uko_A 378 Alcohol dehydrogenase class-3; alcohol dehydrogena 88.4
2eih_A 343 Alcohol dehydrogenase; zinc ION binding protein, s 87.33
1zsy_A 357 Mitochondrial 2-enoyl thioester reductase; medium- 87.27
3goh_A 315 Alcohol dehydrogenase, zinc-containing; NP_718042. 86.48
1gu7_A 364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 86.36
3m6i_A 363 L-arabinitol 4-dehydrogenase; medium chain dehydro 83.75
1wly_A 333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 83.32
3mlq_E71 Transcription-repair coupling factor; tudor, trans 83.28
2dq4_A 343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 82.92
4dup_A 353 Quinone oxidoreductase; PSI-biology, structural ge 82.83
3two_A 348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 82.8
4eez_A 348 Alcohol dehydrogenase 1; site-saturation mutagenes 82.79
4a27_A 349 Synaptic vesicle membrane protein VAT-1 homolog-L; 82.71
1f8f_A 371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 82.69
2d8a_A 348 PH0655, probable L-threonine 3-dehydrogenase; pyro 82.37
1cdo_A 374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 82.11
2cf5_A 357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 82.1
1pl8_A 356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 81.98
1yqd_A 366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 81.94
2j8z_A 354 Quinone oxidoreductase; medium-chain dehydrogenase 81.86
3jv7_A 345 ADH-A; dehydrogenase, nucleotide binding, rossmann 81.79
4a0s_A 447 Octenoyl-COA reductase/carboxylase; oxidoreductase 81.74
1p0f_A 373 NADP-dependent alcohol dehydrogenase; ADH topology 81.66
1e3j_A 352 NADP(H)-dependent ketose reductase; oxidoreductase 81.53
2fzw_A 373 Alcohol dehydrogenase class III CHI chain; S-nitro 81.49
3jyn_A 325 Quinone oxidoreductase; rossmann fold, protein-NAD 81.47
2jhf_A 374 Alcohol dehydrogenase E chain; oxidoreductase, met 81.42
3s2e_A 340 Zinc-containing alcohol dehydrogenase superfamily; 81.33
1kol_A 398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 81.25
4dvj_A 363 Putative zinc-dependent alcohol dehydrogenase Pro; 81.22
3tqh_A 321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 81.16
1e3i_A 376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 81.09
2dph_A 398 Formaldehyde dismutase; dismutation of aldehydes, 80.97
2hcy_A 347 Alcohol dehydrogenase 1; tetramer of asymmetric di 80.97
3fpc_A 352 NADP-dependent alcohol dehydrogenase; oxydoreducta 80.71
3uog_A 363 Alcohol dehydrogenase; structural genomics, protei 80.7
1rjw_A 339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 80.62
2vn8_A 375 Reticulon-4-interacting protein 1; mitochondrion, 80.25
3gms_A 340 Putative NADPH:quinone reductase; structural genom 80.23
1uuf_A 369 YAHK, zinc-type alcohol dehydrogenase-like protein 80.23
3krt_A 456 Crotonyl COA reductase; structural genomics, prote 80.22
1jvb_A 347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 80.14
>1p3h_A 10 kDa chaperonin; beta barrel, acidic cluster, flexible loop, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: b.35.1.1 PDB: 1hx5_A 1lep_A 1p82_A 1p83_A Back     alignment and structure
Probab=100.00  E-value=7.2e-42  Score=233.36  Aligned_cols=97  Identities=39%  Similarity=0.660  Sum_probs=94.3

Q ss_pred             ccceeeeCCeEEEEecCCCCcccceEEeccCccccceeeEEEEecCceeCCCC-eeecceeeeCCEEEccCCCceEEEEC
Q psy12951         13 SQKFRPLLDRILVIKDEPLTKTKGGVLIPEKAQQEVNNAVVVAVGPGARTPNG-EYIKPVVNVGDKVLLPKFGGTKIEVE   91 (111)
Q Consensus        13 ~~~i~PlgDrVLVk~~~~e~~T~gGIiLP~~~~~k~~~G~VvaVG~G~~~~~G-~~~p~~vk~GD~Vl~~~y~g~~v~~~   91 (111)
                      .++|+||+|||||++.++|++|+|||+||+++++|+++|+|+|||||+.+++| +++|++||+||+|+|++|+|++|+++
T Consensus         2 ~~~i~PL~DRVlVk~~e~e~kT~gGI~LP~sakeKp~~G~VvAVG~G~~~~~G~~~~p~~VkvGD~Vlf~ky~Gtevk~d   81 (99)
T 1p3h_A            2 KVNIKPLEDKILVQANEAETTTASGLVIPDTAKEKPQEGTVVAVGPGRWDEDGEKRIPLDVAEGDTVIYSKYGGTEIKYN   81 (99)
T ss_dssp             CCEEEECTTEEEEEECCCCCBCTTSCBCCCSSCCSEEEEEEEEECCCEECSSSSCEECCSCCTTCEEEEECTTCEEEEET
T ss_pred             CceeEEeCCEEEEEEccccccccceEEeCcccccCCceEEEEEECCCcCcCCCCEEEccccCCCCEEEECCcCCeEEEEC
Confidence            47899999999999999999999999999999999999999999999999999 99999999999999999999999999


Q ss_pred             CEEEEEEecCcEEEEeec
Q psy12951         92 GQELHLFKEADLLAVIEK  109 (111)
Q Consensus        92 g~~y~iv~~~DIlavi~~  109 (111)
                      |++|+++|++||||++++
T Consensus        82 geey~i~re~DIlavi~~   99 (99)
T 1p3h_A           82 GEEYLILSARDVLAVVSK   99 (99)
T ss_dssp             TEEEEEEEGGGEEEEEEC
T ss_pred             CEEEEEEEhHhEEEEeeC
Confidence            999999999999999974



>3nx6_A 10KDA chaperonin; bacterial blight, XOO4289, groes, xanthomonas oryzae PV. ORY KACC10331, chaperone; 1.97A {Xanthomonas oryzae PV} SCOP: b.35.1.0 Back     alignment and structure
>1pcq_O Groes protein; chaperone; HET: ADP; 2.81A {Escherichia coli} SCOP: b.35.1.1 PDB: 1gru_O 1aon_O* 1pf9_O* 1svt_O* 1sx4_O* 2c7c_O 2c7d_O Back     alignment and structure
>1we3_O CPN10(groes); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} SCOP: b.35.1.1 PDB: 1wf4_o* 1wnr_A Back     alignment and structure
>1g31_A GP31; chaperone, CO-chaperonin, groes, in VIVO protein folding, bacteriophage T4; 2.30A {Enterobacteria phage T4} SCOP: b.35.1.1 PDB: 2cgt_O Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>3mlq_E Transcription-repair coupling factor; tudor, transferase-transcription complex; 2.91A {Thermus thermophilus} Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 111
d1aono_97 b.35.1.1 (O:) Chaperonin-10 (GroES) {Escherichia c 1e-28
d1p3ha_99 b.35.1.1 (A:) Chaperonin-10 (GroES) {Mycobacterium 9e-28
d1we3o_96 b.35.1.1 (O:) Chaperonin-10 (GroES) {Thermus therm 3e-26
>d1aono_ b.35.1.1 (O:) Chaperonin-10 (GroES) {Escherichia coli [TaxId: 562]} Length = 97 Back     information, alignment and structure

class: All beta proteins
fold: GroES-like
superfamily: GroES-like
family: GroES
domain: Chaperonin-10 (GroES)
species: Escherichia coli [TaxId: 562]
 Score = 97.6 bits (243), Expect = 1e-28
 Identities = 32/95 (33%), Positives = 52/95 (54%), Gaps = 1/95 (1%)

Query: 15  KFRPLLDRILVIKDEPLTKTKGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNV 74
             RPL DR++V + E  TK+ GG+++   A  +     V+AVG G    NGE     V V
Sbjct: 2   NIRPLHDRVIVKRKEVETKSAGGIVLTGSAAAKSTRGEVLAVGNGRILENGEVKPLDVKV 61

Query: 75  GDKVLLPKF-GGTKIEVEGQELHLFKEADLLAVIE 108
           GD V+     G    +++ +E+ +  E+D+LA++E
Sbjct: 62  GDIVIFNDGYGVKSEKIDNEEVLIMSESDILAIVE 96


>d1p3ha_ b.35.1.1 (A:) Chaperonin-10 (GroES) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 99 Back     information, alignment and structure
>d1we3o_ b.35.1.1 (O:) Chaperonin-10 (GroES) {Thermus thermophilus [TaxId: 274]} Length = 96 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query111
d1p3ha_99 Chaperonin-10 (GroES) {Mycobacterium tuberculosis 100.0
d1aono_97 Chaperonin-10 (GroES) {Escherichia coli [TaxId: 56 100.0
d1we3o_96 Chaperonin-10 (GroES) {Thermus thermophilus [TaxId 100.0
d1g31a_107 GP31 co-chaperonin {Bacteriophage T4 [TaxId: 10665 97.67
d1qora1147 Quinone oxidoreductase {Escherichia coli [TaxId: 5 90.73
d1f8fa1194 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 90.09
d1jqba1177 Bacterial secondary alcohol dehydrogenase {Clostri 89.95
d1e3ja1178 Ketose reductase (sorbitol dehydrogenase) {Silverl 89.6
d1jvba1177 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 89.1
d1kola1201 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 89.02
d1yb5a1150 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 87.63
d1llua1175 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 86.95
d1pl8a1185 Ketose reductase (sorbitol dehydrogenase) {Human ( 86.68
d1uufa1179 Hypothetical protein YahK {Escherichia coli [TaxId 85.96
d2jhfa1198 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 85.79
d1h2ba1171 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 84.2
d1p0fa1198 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 83.41
d1vj0a1184 Hypothetical protein TM0436 {Thermotoga maritima [ 83.34
d1rjwa1171 Alcohol dehydrogenase {Bacillus stearothermophilus 82.69
d1e3ia1202 Alcohol dehydrogenase {Mouse (Mus musculus), class 81.17
d1cdoa1199 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 80.69
>d1p3ha_ b.35.1.1 (A:) Chaperonin-10 (GroES) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: All beta proteins
fold: GroES-like
superfamily: GroES-like
family: GroES
domain: Chaperonin-10 (GroES)
species: Mycobacterium tuberculosis [TaxId: 1773]
Probab=100.00  E-value=1.1e-35  Score=200.06  Aligned_cols=97  Identities=39%  Similarity=0.660  Sum_probs=91.7

Q ss_pred             ccceeeeCCeEEEEecCCCCcccceEEeccCccccceeeEEEEecCceeCCCC-eeecceeeeCCEEEccCCCceEEEEC
Q psy12951         13 SQKFRPLLDRILVIKDEPLTKTKGGVLIPEKAQQEVNNAVVVAVGPGARTPNG-EYIKPVVNVGDKVLLPKFGGTKIEVE   91 (111)
Q Consensus        13 ~~~i~PlgDrVLVk~~~~e~~T~gGIiLP~~~~~k~~~G~VvaVG~G~~~~~G-~~~p~~vk~GD~Vl~~~y~g~~v~~~   91 (111)
                      -++|+||+|||||++.+.+++|+|||+||+++++++..|+|+|||+|+...+| ...|+.||+||+|+|++|+|++|+++
T Consensus         2 km~ikPlgdrVLVk~~~~~~kT~gGIiLp~~~~~~~~~G~VvavG~g~~~~~~~~~~~~~vk~GD~Vl~~~~~g~~v~~d   81 (99)
T d1p3ha_           2 KVNIKPLEDKILVQANEAETTTASGLVIPDTAKEKPQEGTVVAVGPGRWDEDGEKRIPLDVAEGDTVIYSKYGGTEIKYN   81 (99)
T ss_dssp             CCEEEECTTEEEEEECCCCCBCTTSCBCCCSSCCSEEEEEEEEECCCEECSSSSCEECCSCCTTCEEEEECTTCEEEEET
T ss_pred             CccceEcCCEEEEEEcchhcccccceEeccccccCceEEEEEEECCceEcCCCCEecCCeeecCCEEEEcccCceEEEEC
Confidence            47899999999999999999999999999999999999999999999988665 46788999999999999999999999


Q ss_pred             CEEEEEEecCcEEEEeec
Q psy12951         92 GQELHLFKEADLLAVIEK  109 (111)
Q Consensus        92 g~~y~iv~~~DIlavi~~  109 (111)
                      |++|++++++||||++++
T Consensus        82 g~~y~ii~e~dIlavi~~   99 (99)
T d1p3ha_          82 GEEYLILSARDVLAVVSK   99 (99)
T ss_dssp             TEEEEEEEGGGEEEEEEC
T ss_pred             CEEEEEEEHHHEEEEEeC
Confidence            999999999999999974



>d1aono_ b.35.1.1 (O:) Chaperonin-10 (GroES) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1we3o_ b.35.1.1 (O:) Chaperonin-10 (GroES) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g31a_ b.35.1.1 (A:) GP31 co-chaperonin {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1qora1 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1jqba1 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1yb5a1 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jhfa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1vj0a1 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rjwa1 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure