Psyllid ID: psy12953
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 136 | ||||||
| 269794703 | 605 | glycosidase [Sanguibacter keddieii DSM 1 | 0.661 | 0.148 | 0.622 | 8e-29 | |
| 222147608 | 550 | alpha-glucosidase [Agrobacterium vitis S | 0.75 | 0.185 | 0.549 | 1e-28 | |
| 405965939 | 608 | Putative maltase H [Crassostrea gigas] | 0.676 | 0.151 | 0.586 | 1e-28 | |
| 238060720 | 558 | alpha amylase, catalytic subdomain [Micr | 0.705 | 0.172 | 0.593 | 3e-28 | |
| 418296609 | 551 | alpha-glucosidase [Agrobacterium tumefac | 0.676 | 0.166 | 0.586 | 1e-27 | |
| 328784980 | 620 | PREDICTED: maltase 1 [Apis mellifera] | 0.764 | 0.167 | 0.490 | 1e-27 | |
| 408378323 | 551 | alpha-glucosidase [Agrobacterium alberti | 0.727 | 0.179 | 0.555 | 2e-27 | |
| 430002202 | 551 | putative alpha-glucosidase [Rhizobium sp | 0.75 | 0.185 | 0.519 | 2e-27 | |
| 420239784 | 551 | glycosidase [Rhizobium sp. CF080] gi|398 | 0.75 | 0.185 | 0.529 | 3e-27 | |
| 150395522 | 551 | alpha amylase [Sinorhizobium medicae WSM | 0.75 | 0.185 | 0.539 | 4e-27 |
| >gi|269794703|ref|YP_003314158.1| glycosidase [Sanguibacter keddieii DSM 10542] gi|269096888|gb|ACZ21324.1| glycosidase [Sanguibacter keddieii DSM 10542] | Back alignment and taxonomy information |
|---|
Score = 131 bits (330), Expect = 8e-29, Method: Compositional matrix adjust.
Identities = 56/90 (62%), Positives = 74/90 (82%)
Query: 25 KEWWQTAIMYQIYPRSFRDVNGDGTGDMRGITEKLDHFVDLGIESLWIQPFYPAGGADLG 84
+EWW+TA++YQ+YPRSF D +GDG GD+ GIT KLDHFVDLG++++W+ PFY + AD G
Sbjct: 33 REWWRTAVIYQVYPRSFADADGDGIGDIPGITSKLDHFVDLGVDAVWLSPFYRSPQADAG 92
Query: 85 YDVSNYVDVDPLFGDMHDFEILIEEAHSRG 114
YDV++Y +VDPLFG DFE L+E AH+RG
Sbjct: 93 YDVADYREVDPLFGTNADFEALLEGAHARG 122
|
Source: Sanguibacter keddieii DSM 10542 Species: Sanguibacter keddieii Genus: Sanguibacter Family: Sanguibacteraceae Order: Actinomycetales Class: Actinobacteria Phylum: Actinobacteria Superkingdom: Bacteria |
| >gi|222147608|ref|YP_002548565.1| alpha-glucosidase [Agrobacterium vitis S4] gi|221734596|gb|ACM35559.1| alpha-glucosidase [Agrobacterium vitis S4] | Back alignment and taxonomy information |
|---|
| >gi|405965939|gb|EKC31277.1| Putative maltase H [Crassostrea gigas] | Back alignment and taxonomy information |
|---|
| >gi|238060720|ref|ZP_04605429.1| alpha amylase, catalytic subdomain [Micromonospora sp. ATCC 39149] gi|237882531|gb|EEP71359.1| alpha amylase, catalytic subdomain [Micromonospora sp. ATCC 39149] | Back alignment and taxonomy information |
|---|
| >gi|418296609|ref|ZP_12908452.1| alpha-glucosidase [Agrobacterium tumefaciens CCNWGS0286] gi|355538784|gb|EHH08026.1| alpha-glucosidase [Agrobacterium tumefaciens CCNWGS0286] | Back alignment and taxonomy information |
|---|
| >gi|328784980|ref|XP_624736.2| PREDICTED: maltase 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|408378323|ref|ZP_11175920.1| alpha-glucosidase [Agrobacterium albertimagni AOL15] gi|407747460|gb|EKF58979.1| alpha-glucosidase [Agrobacterium albertimagni AOL15] | Back alignment and taxonomy information |
|---|
| >gi|430002202|emb|CCF17983.1| putative alpha-glucosidase [Rhizobium sp.] | Back alignment and taxonomy information |
|---|
| >gi|420239784|ref|ZP_14744072.1| glycosidase [Rhizobium sp. CF080] gi|398078651|gb|EJL69543.1| glycosidase [Rhizobium sp. CF080] | Back alignment and taxonomy information |
|---|
| >gi|150395522|ref|YP_001325989.1| alpha amylase [Sinorhizobium medicae WSM419] gi|150027037|gb|ABR59154.1| alpha amylase catalytic region [Sinorhizobium medicae WSM419] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 136 | ||||||
| TIGR_CMR|SO_2213 | 540 | SO_2213 "oligo-1,6-glucosidase | 0.647 | 0.162 | 0.568 | 1e-26 | |
| ZFIN|ZDB-GENE-090313-225 | 674 | slc3a1 "solute carrier family | 0.772 | 0.155 | 0.485 | 7e-25 | |
| UNIPROTKB|Q4J6B8 | 391 | SLC3A1 "Neutral and basic amin | 0.654 | 0.227 | 0.494 | 2.3e-24 | |
| UNIPROTKB|E1C011 | 689 | SLC3A1 "Uncharacterized protei | 0.654 | 0.129 | 0.505 | 2.7e-24 | |
| FB|FBgn0033297 | 588 | Mal-A8 "Maltase A8" [Drosophil | 0.808 | 0.187 | 0.447 | 4.6e-24 | |
| FB|FBgn0032381 | 584 | Mal-B1 "Maltase B1" [Drosophil | 0.794 | 0.184 | 0.458 | 7.5e-24 | |
| FB|FBgn0002569 | 567 | Mal-A2 "Maltase A2" [Drosophil | 0.772 | 0.185 | 0.462 | 1.5e-23 | |
| UNIPROTKB|P28904 | 551 | treC [Escherichia coli K-12 (t | 0.647 | 0.159 | 0.488 | 1.7e-23 | |
| TIGR_CMR|BA_0371 | 554 | BA_0371 "glycosyl hydrolase fa | 0.654 | 0.160 | 0.539 | 1.7e-23 | |
| TIGR_CMR|CPS_0984 | 538 | CPS_0984 "alpha amylase family | 0.647 | 0.163 | 0.5 | 2.6e-23 |
| TIGR_CMR|SO_2213 SO_2213 "oligo-1,6-glucosidase" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
Score = 306 (112.8 bits), Expect = 1.0e-26, P = 1.0e-26
Identities = 50/88 (56%), Positives = 67/88 (76%)
Query: 27 WWQTAIMYQIYPRSFRDVNGDGTGDMRGITEKLDHFVDLGIESLWIQPFYPAGGADLGYD 86
WW+ A++YQIYPRS D NGDG GD+RGI KLD+ L ++++WI PF+ + AD GYD
Sbjct: 6 WWRGAVIYQIYPRSLLDTNGDGVGDLRGIITKLDYIASLNVDAIWISPFFKSPMADFGYD 65
Query: 87 VSNYVDVDPLFGDMHDFEILIEEAHSRG 114
+S+Y ++DPLFG M DF+ LIE+AH RG
Sbjct: 66 ISDYREIDPLFGSMQDFDELIEKAHQRG 93
|
|
| ZFIN|ZDB-GENE-090313-225 slc3a1 "solute carrier family 3, member 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4J6B8 SLC3A1 "Neutral and basic amino acid transport protein rBAT" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C011 SLC3A1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0033297 Mal-A8 "Maltase A8" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0032381 Mal-B1 "Maltase B1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0002569 Mal-A2 "Maltase A2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P28904 treC [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_0371 BA_0371 "glycosyl hydrolase family protein" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_0984 CPS_0984 "alpha amylase family protein" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 136 | |||
| cd11328 | 470 | cd11328, AmyAc_maltase, Alpha amylase catalytic do | 1e-47 | |
| cd11330 | 472 | cd11330, AmyAc_OligoGlu, Alpha amylase catalytic d | 8e-46 | |
| cd11331 | 450 | cd11331, AmyAc_OligoGlu_like, Alpha amylase cataly | 2e-44 | |
| cd11332 | 481 | cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalyti | 1e-43 | |
| cd11359 | 456 | cd11359, AmyAc_SLC3A1, Alpha amylase catalytic dom | 9e-43 | |
| cd11333 | 428 | cd11333, AmyAc_SI_OligoGlu_DGase, Alpha amylase ca | 2e-42 | |
| TIGR02403 | 543 | TIGR02403, trehalose_treC, alpha,alpha-phosphotreh | 2e-38 | |
| cd11334 | 447 | cd11334, AmyAc_TreS, Alpha amylase catalytic domai | 2e-36 | |
| PRK10933 | 551 | PRK10933, PRK10933, trehalose-6-phosphate hydrolas | 4e-34 | |
| cd11316 | 403 | cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic | 9e-32 | |
| cd11348 | 429 | cd11348, AmyAc_2, Alpha amylase catalytic domain f | 1e-28 | |
| TIGR02456 | 539 | TIGR02456, treS_nterm, trehalose synthase | 1e-27 | |
| COG0366 | 505 | COG0366, AmyA, Glycosidases [Carbohydrate transpor | 2e-27 | |
| smart00642 | 166 | smart00642, Aamy, Alpha-amylase domain | 1e-26 | |
| pfam00128 | 314 | pfam00128, Alpha-amylase, Alpha amylase, catalytic | 1e-22 | |
| cd00551 | 260 | cd00551, AmyAc_family, Alpha amylase catalytic dom | 8e-21 | |
| cd11313 | 336 | cd11313, AmyAc_arch_bac_AmyA, Alpha amylase cataly | 5e-19 | |
| cd11338 | 389 | cd11338, AmyAc_CMD, Alpha amylase catalytic domain | 2e-18 | |
| cd11324 | 536 | cd11324, AmyAc_Amylosucrase, Alpha amylase catalyt | 6e-12 | |
| cd11340 | 407 | cd11340, AmyAc_bac_CMD_like_3, Alpha amylase catal | 4e-11 | |
| cd11320 | 389 | cd11320, AmyAc_AmyMalt_CGTase_like, Alpha amylase | 8e-11 | |
| cd11345 | 326 | cd11345, AmyAc_SLC3A2, Alpha amylase catalytic dom | 9e-11 | |
| cd11339 | 344 | cd11339, AmyAc_bac_CMD_like_2, Alpha amylase catal | 5e-10 | |
| cd11352 | 443 | cd11352, AmyAc_5, Alpha amylase catalytic domain f | 6e-10 | |
| cd11350 | 390 | cd11350, AmyAc_4, Alpha amylase catalytic domain f | 4e-09 | |
| cd11354 | 357 | cd11354, AmyAc_bac_CMD_like, Alpha amylase catalyt | 3e-08 | |
| PRK09505 | 683 | PRK09505, malS, alpha-amylase; Reviewed | 3e-08 | |
| COG3280 | 889 | COG3280, TreY, Maltooligosyl trehalose synthase [C | 1e-07 | |
| cd11337 | 328 | cd11337, AmyAc_CMD_like, Alpha amylase catalytic d | 5e-07 | |
| cd11325 | 436 | cd11325, AmyAc_GTHase, Alpha amylase catalytic dom | 2e-06 | |
| PRK10785 | 598 | PRK10785, PRK10785, maltodextrin glucosidase; Prov | 2e-06 | |
| cd11319 | 375 | cd11319, AmyAc_euk_AmyA, Alpha amylase catalytic d | 1e-05 | |
| COG0296 | 628 | COG0296, GlgB, 1,4-alpha-glucan branching enzyme [ | 1e-05 | |
| PRK14511 | 879 | PRK14511, PRK14511, maltooligosyl trehalose syntha | 2e-05 | |
| cd11353 | 366 | cd11353, AmyAc_euk_bac_CMD_like, Alpha amylase cat | 2e-05 | |
| TIGR02401 | 825 | TIGR02401, trehalose_TreY, malto-oligosyltrehalose | 3e-05 | |
| PRK09441 | 479 | PRK09441, PRK09441, cytoplasmic alpha-amylase; Rev | 6e-05 | |
| TIGR02402 | 544 | TIGR02402, trehalose_TreZ, malto-oligosyltrehalose | 1e-04 | |
| PRK14510 | 1221 | PRK14510, PRK14510, putative bifunctional 4-alpha- | 8e-04 | |
| cd11336 | 660 | cd11336, AmyAc_MTSase, Alpha amylase catalytic dom | 8e-04 | |
| cd11349 | 456 | cd11349, AmyAc_3, Alpha amylase catalytic domain f | 0.001 | |
| TIGR03852 | 470 | TIGR03852, sucrose_gtfA, sucrose phosphorylase | 0.002 | |
| cd11355 | 433 | cd11355, AmyAc_Sucrose_phosphorylase, Alpha amylas | 0.002 |
| >gnl|CDD|200467 cd11328, AmyAc_maltase, Alpha amylase catalytic domain found in maltase (also known as alpha glucosidase) and related proteins | Back alignment and domain information |
|---|
Score = 158 bits (403), Expect = 1e-47
Identities = 50/90 (55%), Positives = 70/90 (77%)
Query: 25 KEWWQTAIMYQIYPRSFRDVNGDGTGDMRGITEKLDHFVDLGIESLWIQPFYPAGGADLG 84
K+WW+ A+ YQIYPRSF+D +GDG GD++GITEKLD+F D+GI+++W+ P + + D G
Sbjct: 2 KDWWENAVFYQIYPRSFKDSDGDGIGDLKGITEKLDYFKDIGIDAIWLSPIFKSPMVDFG 61
Query: 85 YDVSNYVDVDPLFGDMHDFEILIEEAHSRG 114
YD+S++ D+DP+FG M DFE LI EA G
Sbjct: 62 YDISDFTDIDPIFGTMEDFEELIAEAKKLG 91
|
Maltase (EC 3.2.1.20) hydrolyzes the terminal, non-reducing (1->4)-linked alpha-D-glucose residues in maltose, releasing alpha-D-glucose. In most cases, maltase is equivalent to alpha-glucosidase, but the term "maltase" emphasizes the disaccharide nature of the substrate from which glucose is cleaved, and the term "alpha-glucosidase" emphasizes the bond, whether the substrate is a disaccharide or polysaccharide. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase. Length = 470 |
| >gnl|CDD|200469 cd11330, AmyAc_OligoGlu, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200470 cd11331, AmyAc_OligoGlu_like, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200471 cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), trehalose synthase (also called maltose alpha-D-glucosyltransferase), and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200494 cd11359, AmyAc_SLC3A1, Alpha amylase catalytic domain found in Solute Carrier family 3 member 1 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200472 cd11333, AmyAc_SI_OligoGlu_DGase, Alpha amylase catalytic domain found in Sucrose isomerases, oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), dextran glucosidase (also called glucan 1,6-alpha-glucosidase), and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233851 TIGR02403, trehalose_treC, alpha,alpha-phosphotrehalase | Back alignment and domain information |
|---|
| >gnl|CDD|200473 cd11334, AmyAc_TreS, Alpha amylase catalytic domain found in Trehalose synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|182849 PRK10933, PRK10933, trehalose-6-phosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200455 cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic domain found in bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|200486 cd11348, AmyAc_2, Alpha amylase catalytic domain found in an uncharacterized protein family | Back alignment and domain information |
|---|
| >gnl|CDD|233874 TIGR02456, treS_nterm, trehalose synthase | Back alignment and domain information |
|---|
| >gnl|CDD|223443 COG0366, AmyA, Glycosidases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|214758 smart00642, Aamy, Alpha-amylase domain | Back alignment and domain information |
|---|
| >gnl|CDD|215737 pfam00128, Alpha-amylase, Alpha amylase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|200451 cd00551, AmyAc_family, Alpha amylase catalytic domain family | Back alignment and domain information |
|---|
| >gnl|CDD|200452 cd11313, AmyAc_arch_bac_AmyA, Alpha amylase catalytic domain found in archaeal and bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|200477 cd11338, AmyAc_CMD, Alpha amylase catalytic domain found in cyclomaltodextrinases and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200463 cd11324, AmyAc_Amylosucrase, Alpha amylase catalytic domain found in Amylosucrase | Back alignment and domain information |
|---|
| >gnl|CDD|200479 cd11340, AmyAc_bac_CMD_like_3, Alpha amylase catalytic domain found in bacterial cyclomaltodextrinases and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200459 cd11320, AmyAc_AmyMalt_CGTase_like, Alpha amylase catalytic domain found in maltogenic amylases, cyclodextrin glycosyltransferase, and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200483 cd11345, AmyAc_SLC3A2, Alpha amylase catalytic domain found in solute carrier family 3 member 2 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200478 cd11339, AmyAc_bac_CMD_like_2, Alpha amylase catalytic domain found in bacterial cyclomaltodextrinases and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200489 cd11352, AmyAc_5, Alpha amylase catalytic domain found in an uncharacterized protein family | Back alignment and domain information |
|---|
| >gnl|CDD|200488 cd11350, AmyAc_4, Alpha amylase catalytic domain found in an uncharacterized protein family | Back alignment and domain information |
|---|
| >gnl|CDD|200491 cd11354, AmyAc_bac_CMD_like, Alpha amylase catalytic domain found in bacterial cyclomaltodextrinases and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|236543 PRK09505, malS, alpha-amylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|225819 COG3280, TreY, Maltooligosyl trehalose synthase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|200476 cd11337, AmyAc_CMD_like, Alpha amylase catalytic domain found in cyclomaltodextrinases and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200464 cd11325, AmyAc_GTHase, Alpha amylase catalytic domain found in Glycosyltrehalose trehalohydrolase (also called Maltooligosyl trehalose Trehalohydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|236759 PRK10785, PRK10785, maltodextrin glucosidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200458 cd11319, AmyAc_euk_AmyA, Alpha amylase catalytic domain found in eukaryotic Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|223373 COG0296, GlgB, 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|237740 PRK14511, PRK14511, maltooligosyl trehalose synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200490 cd11353, AmyAc_euk_bac_CMD_like, Alpha amylase catalytic domain found in eukaryotic and bacterial cyclomaltodextrinases and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233849 TIGR02401, trehalose_TreY, malto-oligosyltrehalose synthase | Back alignment and domain information |
|---|
| >gnl|CDD|236518 PRK09441, PRK09441, cytoplasmic alpha-amylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233850 TIGR02402, trehalose_TreZ, malto-oligosyltrehalose trehalohydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|237739 PRK14510, PRK14510, putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200475 cd11336, AmyAc_MTSase, Alpha amylase catalytic domain found in maltooligosyl trehalose synthase (MTSase) | Back alignment and domain information |
|---|
| >gnl|CDD|200487 cd11349, AmyAc_3, Alpha amylase catalytic domain found in an uncharacterized protein family | Back alignment and domain information |
|---|
| >gnl|CDD|163564 TIGR03852, sucrose_gtfA, sucrose phosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|200492 cd11355, AmyAc_Sucrose_phosphorylase, Alpha amylase catalytic domain found in sucrose phosphorylase (also called sucrose glucosyltransferase, disaccharide glucosyltransferase, and sucrose-phosphate alpha-D glucosyltransferase) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 136 | |||
| PRK10933 | 551 | trehalose-6-phosphate hydrolase; Provisional | 99.97 | |
| TIGR02456 | 539 | treS_nterm trehalose synthase. Trehalose synthase | 99.97 | |
| PRK10785 | 598 | maltodextrin glucosidase; Provisional | 99.97 | |
| TIGR02403 | 543 | trehalose_treC alpha,alpha-phosphotrehalase. Treha | 99.97 | |
| PRK09505 | 683 | malS alpha-amylase; Reviewed | 99.95 | |
| smart00642 | 166 | Aamy Alpha-amylase domain. | 99.95 | |
| PRK12313 | 633 | glycogen branching enzyme; Provisional | 99.94 | |
| TIGR02402 | 542 | trehalose_TreZ malto-oligosyltrehalose trehalohydr | 99.94 | |
| KOG0471|consensus | 545 | 99.94 | ||
| COG0366 | 505 | AmyA Glycosidases [Carbohydrate transport and meta | 99.93 | |
| PRK05402 | 726 | glycogen branching enzyme; Provisional | 99.93 | |
| TIGR01515 | 613 | branching_enzym alpha-1,4-glucan:alpha-1,4-glucan | 99.93 | |
| PF00128 | 316 | Alpha-amylase: Alpha amylase, catalytic domain; In | 99.93 | |
| TIGR02100 | 688 | glgX_debranch glycogen debranching enzyme GlgX. Th | 99.92 | |
| PRK03705 | 658 | glycogen debranching enzyme; Provisional | 99.92 | |
| PRK14706 | 639 | glycogen branching enzyme; Provisional | 99.91 | |
| PRK12568 | 730 | glycogen branching enzyme; Provisional | 99.91 | |
| PLN02960 | 897 | alpha-amylase | 99.91 | |
| TIGR02104 | 605 | pulA_typeI pullulanase, type I. Pullulan is an unu | 99.91 | |
| PLN00196 | 428 | alpha-amylase; Provisional | 99.9 | |
| COG0296 | 628 | GlgB 1,4-alpha-glucan branching enzyme [Carbohydra | 99.9 | |
| PRK14705 | 1224 | glycogen branching enzyme; Provisional | 99.9 | |
| TIGR02102 | 1111 | pullulan_Gpos pullulanase, extracellular, Gram-pos | 99.89 | |
| PRK14510 | 1221 | putative bifunctional 4-alpha-glucanotransferase/g | 99.89 | |
| PLN02447 | 758 | 1,4-alpha-glucan-branching enzyme | 99.88 | |
| PRK09441 | 479 | cytoplasmic alpha-amylase; Reviewed | 99.88 | |
| PLN02877 | 970 | alpha-amylase/limit dextrinase | 99.86 | |
| PLN02361 | 401 | alpha-amylase | 99.85 | |
| TIGR02103 | 898 | pullul_strch alpha-1,6-glucosidases, pullulanase-t | 99.84 | |
| COG1523 | 697 | PulA Type II secretory pathway, pullulanase PulA a | 99.84 | |
| PLN02784 | 894 | alpha-amylase | 99.82 | |
| TIGR02401 | 825 | trehalose_TreY malto-oligosyltrehalose synthase. T | 99.81 | |
| PRK14511 | 879 | maltooligosyl trehalose synthase; Provisional | 99.81 | |
| PRK13840 | 495 | sucrose phosphorylase; Provisional | 99.81 | |
| KOG0470|consensus | 757 | 99.78 | ||
| PRK14507 | 1693 | putative bifunctional 4-alpha-glucanotransferase/m | 99.78 | |
| TIGR03852 | 470 | sucrose_gtfA sucrose phosphorylase. In the forward | 99.77 | |
| TIGR02455 | 688 | TreS_stutzeri trehalose synthase, Pseudomonas stut | 99.74 | |
| COG3280 | 889 | TreY Maltooligosyl trehalose synthase [Carbohydrat | 99.62 | |
| TIGR01531 | 1464 | glyc_debranch glycogen debranching enzymye. glycog | 99.6 | |
| PLN03244 | 872 | alpha-amylase; Provisional | 99.07 | |
| PF14701 | 423 | hDGE_amylase: glucanotransferase domain of human g | 99.0 | |
| KOG2212|consensus | 504 | 98.0 | ||
| PF14871 | 132 | GHL6: Hypothetical glycosyl hydrolase 6 | 97.96 | |
| KOG3625|consensus | 1521 | 97.88 | ||
| PF02324 | 809 | Glyco_hydro_70: Glycosyl hydrolase family 70; Inte | 97.7 | |
| PF02638 | 311 | DUF187: Glycosyl hydrolase like GH101; InterPro: I | 97.13 | |
| PF14872 | 811 | GHL5: Hypothetical glycoside hydrolase 5 | 97.12 | |
| PF14488 | 166 | DUF4434: Domain of unknown function (DUF4434) | 97.11 | |
| COG1649 | 418 | Uncharacterized protein conserved in bacteria [Fun | 97.08 | |
| PF00150 | 281 | Cellulase: Cellulase (glycosyl hydrolase family 5) | 96.32 | |
| PLN03059 | 840 | beta-galactosidase; Provisional | 96.05 | |
| PRK09936 | 296 | hypothetical protein; Provisional | 96.04 | |
| PRK14508 | 497 | 4-alpha-glucanotransferase; Provisional | 95.84 | |
| PF01301 | 319 | Glyco_hydro_35: Glycosyl hydrolases family 35; Int | 95.79 | |
| PF07745 | 332 | Glyco_hydro_53: Glycosyl hydrolase family 53; Inte | 95.53 | |
| PRK14510 | 1221 | putative bifunctional 4-alpha-glucanotransferase/g | 95.36 | |
| PF10566 | 273 | Glyco_hydro_97: Glycoside hydrolase 97 ; InterPro: | 95.21 | |
| PLN02950 | 909 | 4-alpha-glucanotransferase | 95.16 | |
| PF02446 | 496 | Glyco_hydro_77: 4-alpha-glucanotransferase; InterP | 94.98 | |
| cd06568 | 329 | GH20_SpHex_like A subgroup of the Glycosyl hydrola | 94.88 | |
| PLN03236 | 745 | 4-alpha-glucanotransferase; Provisional | 94.87 | |
| PRK11052 | 695 | malQ 4-alpha-glucanotransferase; Provisional | 94.74 | |
| PLN02635 | 538 | disproportionating enzyme | 94.68 | |
| cd06562 | 348 | GH20_HexA_HexB-like Beta-N-acetylhexosaminidases c | 94.38 | |
| PF01120 | 346 | Alpha_L_fucos: Alpha-L-fucosidase; InterPro: IPR00 | 94.36 | |
| cd06569 | 445 | GH20_Sm-chitobiase-like The chitobiase of Serratia | 94.28 | |
| PF13204 | 289 | DUF4038: Protein of unknown function (DUF4038); PD | 93.72 | |
| cd06565 | 301 | GH20_GcnA-like Glycosyl hydrolase family 20 (GH20) | 93.66 | |
| smart00812 | 384 | Alpha_L_fucos Alpha-L-fucosidase. O-Glycosyl hydro | 93.44 | |
| PRK10076 | 213 | pyruvate formate lyase II activase; Provisional | 92.83 | |
| TIGR03849 | 237 | arch_ComA phosphosulfolactate synthase. This model | 92.57 | |
| PF02449 | 374 | Glyco_hydro_42: Beta-galactosidase; InterPro: IPR0 | 92.46 | |
| PF00728 | 351 | Glyco_hydro_20: Glycosyl hydrolase family 20, cata | 92.27 | |
| cd02742 | 303 | GH20_hexosaminidase Beta-N-acetylhexosaminidases o | 92.27 | |
| cd06593 | 308 | GH31_xylosidase_YicI YicI alpha-xylosidase is a gl | 92.14 | |
| cd06592 | 303 | GH31_glucosidase_KIAA1161 KIAA1161 is an uncharact | 91.8 | |
| cd06564 | 326 | GH20_DspB_LnbB-like Glycosyl hydrolase family 20 ( | 91.15 | |
| PRK14507 | 1693 | putative bifunctional 4-alpha-glucanotransferase/m | 91.11 | |
| cd06563 | 357 | GH20_chitobiase-like The chitobiase of Serratia ma | 91.05 | |
| PF13380 | 116 | CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 | 90.92 | |
| TIGR03356 | 427 | BGL beta-galactosidase. | 90.77 | |
| cd06570 | 311 | GH20_chitobiase-like_1 A functionally uncharacteri | 90.6 | |
| PRK01060 | 281 | endonuclease IV; Provisional | 90.37 | |
| PRK14582 | 671 | pgaB outer membrane N-deacetylase; Provisional | 90.32 | |
| KOG0496|consensus | 649 | 90.21 | ||
| COG3867 | 403 | Arabinogalactan endo-1,4-beta-galactosidase [Carbo | 89.91 | |
| PF02679 | 244 | ComA: (2R)-phospho-3-sulfolactate synthase (ComA); | 89.89 | |
| PTZ00445 | 219 | p36-lilke protein; Provisional | 89.17 | |
| KOG1065|consensus | 805 | 88.94 | ||
| PLN02849 | 503 | beta-glucosidase | 88.52 | |
| PRK15452 | 443 | putative protease; Provisional | 88.1 | |
| PF05913 | 357 | DUF871: Bacterial protein of unknown function (DUF | 87.68 | |
| COG0329 | 299 | DapA Dihydrodipicolinate synthase/N-acetylneuramin | 87.61 | |
| cd06589 | 265 | GH31 The enzymes of glycosyl hydrolase family 31 ( | 87.49 | |
| cd06599 | 317 | GH31_glycosidase_Aec37 Glycosyl hydrolase family 3 | 87.43 | |
| PF13407 | 257 | Peripla_BP_4: Periplasmic binding protein domain; | 87.4 | |
| PRK15447 | 301 | putative protease; Provisional | 87.38 | |
| PF13199 | 559 | Glyco_hydro_66: Glycosyl hydrolase family 66; PDB: | 87.33 | |
| COG2730 | 407 | BglC Endoglucanase [Carbohydrate transport and met | 87.06 | |
| PRK13210 | 284 | putative L-xylulose 5-phosphate 3-epimerase; Revie | 87.0 | |
| PF13200 | 316 | DUF4015: Putative glycosyl hydrolase domain | 86.25 | |
| cd06594 | 317 | GH31_glucosidase_YihQ YihQ is a bacterial alpha-gl | 86.12 | |
| TIGR00542 | 279 | hxl6Piso_put hexulose-6-phosphate isomerase, putat | 86.09 | |
| COG3589 | 360 | Uncharacterized conserved protein [Function unknow | 85.86 | |
| cd06597 | 340 | GH31_transferase_CtsY CtsY (cyclic tetrasaccharide | 85.58 | |
| cd06604 | 339 | GH31_glucosidase_II_MalA Alpha-glucosidase II (alp | 85.56 | |
| PF03198 | 314 | Glyco_hydro_72: Glucanosyltransferase; InterPro: I | 85.45 | |
| cd04724 | 242 | Tryptophan_synthase_alpha Ttryptophan synthase (TR | 84.96 | |
| PF08139 | 25 | LPAM_1: Prokaryotic membrane lipoprotein lipid att | 84.94 | |
| cd05014 | 128 | SIS_Kpsf KpsF-like protein. KpsF is an arabinose-5 | 84.79 | |
| PRK12928 | 290 | lipoyl synthase; Provisional | 84.75 | |
| COG3222 | 211 | Uncharacterized protein conserved in bacteria [Fun | 83.64 | |
| cd00954 | 288 | NAL N-Acetylneuraminic acid aldolase, also called | 83.42 | |
| PLN02591 | 250 | tryptophan synthase | 83.4 | |
| PF03932 | 201 | CutC: CutC family; InterPro: IPR005627 Copper tran | 83.16 | |
| COG0826 | 347 | Collagenase and related proteases [Posttranslation | 82.72 | |
| cd00953 | 279 | KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolas | 82.35 | |
| PRK13111 | 258 | trpA tryptophan synthase subunit alpha; Provisiona | 82.1 | |
| PRK09856 | 275 | fructoselysine 3-epimerase; Provisional | 82.02 | |
| PRK09852 | 474 | cryptic 6-phospho-beta-glucosidase; Provisional | 81.78 | |
| cd06602 | 339 | GH31_MGAM_SI_GAA This family includes the followin | 80.97 | |
| TIGR00510 | 302 | lipA lipoate synthase. The family shows strong seq | 80.5 | |
| PF07071 | 218 | DUF1341: Protein of unknown function (DUF1341); In | 80.49 | |
| PF02065 | 394 | Melibiase: Melibiase; InterPro: IPR000111 O-Glycos | 80.48 | |
| cd01299 | 342 | Met_dep_hydrolase_A Metallo-dependent hydrolases, | 80.33 | |
| TIGR00262 | 256 | trpA tryptophan synthase, alpha subunit. Tryptopha | 80.13 | |
| PLN02814 | 504 | beta-glucosidase | 80.08 | |
| cd06600 | 317 | GH31_MGAM-like This family includes the following | 80.04 |
| >PRK10933 trehalose-6-phosphate hydrolase; Provisional | Back alignment and domain information |
|---|
Probab=99.97 E-value=1.5e-31 Score=225.74 Aligned_cols=109 Identities=42% Similarity=0.915 Sum_probs=103.8
Q ss_pred CCccccCCceEEEEecccccCcCCCCCCCHHHHHHhHHHHHHcCCcEEEEcCCccCCCCCCCCCccCCCCCCCCCCCHHH
Q psy12953 23 PQKEWWQTAIMYQIYPRSFRDVNGDGTGDMRGITEKLDHFVDLGIESLWIQPFYPAGGADLGYDVSNYVDVDPLFGDMHD 102 (136)
Q Consensus 23 ~~~~w~~~~~iY~v~~~~f~~~~~~~~g~~~~l~~~l~~l~~lG~~~I~l~Pi~~~~~~~~gY~~~d~~~vd~~~Gt~~~ 102 (136)
..+.||++.+|||+++++|.+++++++|||+|++++|+||++||||+|||+||++++..++||++.||+.|||+|||.++
T Consensus 3 ~~~~W~~~~v~Yqi~~~~f~d~~~~~~Gdl~gi~~~ldyl~~lGv~~i~l~P~~~~~~~~~gY~~~d~~~id~~~Gt~~d 82 (551)
T PRK10933 3 NLPHWWQNGVIYQIYPKSFQDTTGSGTGDLRGVTQRLDYLQKLGVDAIWLTPFYVSPQVDNGYDVANYTAIDPTYGTLDD 82 (551)
T ss_pred CcchhhhcCeEEEEEchHhhcCCCCCCcCHHHHHHhhHHHHhCCCCEEEECCCCCCCCCCCCCCcccCCCcCcccCCHHH
Confidence 45789999999999999999999999999999999999999999999999999998887899999999999999999999
Q ss_pred HHHHHHHHHHCCCcEEE---eccCCCccCCCC
Q psy12953 103 FEILIEEAHSRGKPKRT---FREVTKSFANNQ 131 (136)
Q Consensus 103 ~~~lv~~ah~~Gi~vil---~nh~~~~~~~~~ 131 (136)
|++||++||++||+||+ +||++.+|++++
T Consensus 83 ~~~lv~~~h~~gi~vilD~V~NH~s~~~~wf~ 114 (551)
T PRK10933 83 FDELVAQAKSRGIRIILDMVFNHTSTQHAWFR 114 (551)
T ss_pred HHHHHHHHHHCCCEEEEEECCCCccCchhHHH
Confidence 99999999999999999 999999887643
|
|
| >TIGR02456 treS_nterm trehalose synthase | Back alignment and domain information |
|---|
| >PRK10785 maltodextrin glucosidase; Provisional | Back alignment and domain information |
|---|
| >TIGR02403 trehalose_treC alpha,alpha-phosphotrehalase | Back alignment and domain information |
|---|
| >PRK09505 malS alpha-amylase; Reviewed | Back alignment and domain information |
|---|
| >smart00642 Aamy Alpha-amylase domain | Back alignment and domain information |
|---|
| >PRK12313 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase | Back alignment and domain information |
|---|
| >KOG0471|consensus | Back alignment and domain information |
|---|
| >COG0366 AmyA Glycosidases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05402 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase | Back alignment and domain information |
|---|
| >PF00128 Alpha-amylase: Alpha amylase, catalytic domain; InterPro: IPR006047 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >TIGR02100 glgX_debranch glycogen debranching enzyme GlgX | Back alignment and domain information |
|---|
| >PRK03705 glycogen debranching enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK14706 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK12568 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >PLN02960 alpha-amylase | Back alignment and domain information |
|---|
| >TIGR02104 pulA_typeI pullulanase, type I | Back alignment and domain information |
|---|
| >PLN00196 alpha-amylase; Provisional | Back alignment and domain information |
|---|
| >COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14705 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >TIGR02102 pullulan_Gpos pullulanase, extracellular, Gram-positive | Back alignment and domain information |
|---|
| >PRK14510 putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional | Back alignment and domain information |
|---|
| >PLN02447 1,4-alpha-glucan-branching enzyme | Back alignment and domain information |
|---|
| >PRK09441 cytoplasmic alpha-amylase; Reviewed | Back alignment and domain information |
|---|
| >PLN02877 alpha-amylase/limit dextrinase | Back alignment and domain information |
|---|
| >PLN02361 alpha-amylase | Back alignment and domain information |
|---|
| >TIGR02103 pullul_strch alpha-1,6-glucosidases, pullulanase-type | Back alignment and domain information |
|---|
| >COG1523 PulA Type II secretory pathway, pullulanase PulA and related glycosidases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02784 alpha-amylase | Back alignment and domain information |
|---|
| >TIGR02401 trehalose_TreY malto-oligosyltrehalose synthase | Back alignment and domain information |
|---|
| >PRK14511 maltooligosyl trehalose synthase; Provisional | Back alignment and domain information |
|---|
| >PRK13840 sucrose phosphorylase; Provisional | Back alignment and domain information |
|---|
| >KOG0470|consensus | Back alignment and domain information |
|---|
| >PRK14507 putative bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR03852 sucrose_gtfA sucrose phosphorylase | Back alignment and domain information |
|---|
| >TIGR02455 TreS_stutzeri trehalose synthase, Pseudomonas stutzeri type | Back alignment and domain information |
|---|
| >COG3280 TreY Maltooligosyl trehalose synthase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01531 glyc_debranch glycogen debranching enzymye | Back alignment and domain information |
|---|
| >PLN03244 alpha-amylase; Provisional | Back alignment and domain information |
|---|
| >PF14701 hDGE_amylase: glucanotransferase domain of human glycogen debranching enzyme | Back alignment and domain information |
|---|
| >KOG2212|consensus | Back alignment and domain information |
|---|
| >PF14871 GHL6: Hypothetical glycosyl hydrolase 6 | Back alignment and domain information |
|---|
| >KOG3625|consensus | Back alignment and domain information |
|---|
| >PF02324 Glyco_hydro_70: Glycosyl hydrolase family 70; InterPro: IPR003318 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PF02638 DUF187: Glycosyl hydrolase like GH101; InterPro: IPR003790 This entry describes proteins of unknown function | Back alignment and domain information |
|---|
| >PF14872 GHL5: Hypothetical glycoside hydrolase 5 | Back alignment and domain information |
|---|
| >PF14488 DUF4434: Domain of unknown function (DUF4434) | Back alignment and domain information |
|---|
| >COG1649 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF00150 Cellulase: Cellulase (glycosyl hydrolase family 5); InterPro: IPR001547 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PLN03059 beta-galactosidase; Provisional | Back alignment and domain information |
|---|
| >PRK09936 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14508 4-alpha-glucanotransferase; Provisional | Back alignment and domain information |
|---|
| >PF01301 Glyco_hydro_35: Glycosyl hydrolases family 35; InterPro: IPR001944 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PF07745 Glyco_hydro_53: Glycosyl hydrolase family 53; InterPro: IPR011683 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PRK14510 putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional | Back alignment and domain information |
|---|
| >PF10566 Glyco_hydro_97: Glycoside hydrolase 97 ; InterPro: IPR019563 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PLN02950 4-alpha-glucanotransferase | Back alignment and domain information |
|---|
| >PF02446 Glyco_hydro_77: 4-alpha-glucanotransferase; InterPro: IPR003385 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >cd06568 GH20_SpHex_like A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex) | Back alignment and domain information |
|---|
| >PLN03236 4-alpha-glucanotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11052 malQ 4-alpha-glucanotransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02635 disproportionating enzyme | Back alignment and domain information |
|---|
| >cd06562 GH20_HexA_HexB-like Beta-N-acetylhexosaminidases catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides | Back alignment and domain information |
|---|
| >PF01120 Alpha_L_fucos: Alpha-L-fucosidase; InterPro: IPR000933 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >cd06569 GH20_Sm-chitobiase-like The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin | Back alignment and domain information |
|---|
| >PF13204 DUF4038: Protein of unknown function (DUF4038); PDB: 3KZS_D | Back alignment and domain information |
|---|
| >cd06565 GH20_GcnA-like Glycosyl hydrolase family 20 (GH20) catalytic domain of N-acetyl-beta-D-glucosaminidase (GcnA, also known as BhsA) and related proteins | Back alignment and domain information |
|---|
| >smart00812 Alpha_L_fucos Alpha-L-fucosidase | Back alignment and domain information |
|---|
| >PRK10076 pyruvate formate lyase II activase; Provisional | Back alignment and domain information |
|---|
| >TIGR03849 arch_ComA phosphosulfolactate synthase | Back alignment and domain information |
|---|
| >PF02449 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR013529 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PF00728 Glyco_hydro_20: Glycosyl hydrolase family 20, catalytic domain; InterPro: IPR015883 Glycoside hydrolase family 20 GH20 from CAZY comprises enzymes with several known activities; beta-hexosaminidase (3 | Back alignment and domain information |
|---|
| >cd02742 GH20_hexosaminidase Beta-N-acetylhexosaminidases of glycosyl hydrolase family 20 (GH20) catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides | Back alignment and domain information |
|---|
| >cd06593 GH31_xylosidase_YicI YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose | Back alignment and domain information |
|---|
| >cd06592 GH31_glucosidase_KIAA1161 KIAA1161 is an uncharacterized Homo sapiens protein with a glycosyl hydrolase family 31 (GH31) domain that is homologous to the Escherichia coli YihQ glucosidase | Back alignment and domain information |
|---|
| >cd06564 GH20_DspB_LnbB-like Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins | Back alignment and domain information |
|---|
| >PRK14507 putative bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase; Provisional | Back alignment and domain information |
|---|
| >cd06563 GH20_chitobiase-like The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin | Back alignment and domain information |
|---|
| >PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A | Back alignment and domain information |
|---|
| >TIGR03356 BGL beta-galactosidase | Back alignment and domain information |
|---|
| >cd06570 GH20_chitobiase-like_1 A functionally uncharacterized subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin | Back alignment and domain information |
|---|
| >PRK01060 endonuclease IV; Provisional | Back alignment and domain information |
|---|
| >PRK14582 pgaB outer membrane N-deacetylase; Provisional | Back alignment and domain information |
|---|
| >KOG0496|consensus | Back alignment and domain information |
|---|
| >COG3867 Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF02679 ComA: (2R)-phospho-3-sulfolactate synthase (ComA); InterPro: IPR003830 Methanogenic archaea produce methane via the anaerobic reduction of acetate or single carbon compounds [] | Back alignment and domain information |
|---|
| >PTZ00445 p36-lilke protein; Provisional | Back alignment and domain information |
|---|
| >KOG1065|consensus | Back alignment and domain information |
|---|
| >PLN02849 beta-glucosidase | Back alignment and domain information |
|---|
| >PRK15452 putative protease; Provisional | Back alignment and domain information |
|---|
| >PF05913 DUF871: Bacterial protein of unknown function (DUF871); InterPro: IPR008589 This family consists of several conserved hypothetical proteins from bacteria and archaea | Back alignment and domain information |
|---|
| >COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd06589 GH31 The enzymes of glycosyl hydrolase family 31 (GH31) occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase | Back alignment and domain information |
|---|
| >cd06599 GH31_glycosidase_Aec37 Glycosyl hydrolase family 31 (GH31) domain of a bacterial protein family represented by Escherichia coli protein Aec37 | Back alignment and domain information |
|---|
| >PF13407 Peripla_BP_4: Periplasmic binding protein domain; PDB: 3BRS_B 3GBP_A 3GA5_A 1GCG_A 1GCA_A 3H75_A 3D02_A 3L49_B 3EJW_B 3T95_A | Back alignment and domain information |
|---|
| >PRK15447 putative protease; Provisional | Back alignment and domain information |
|---|
| >PF13199 Glyco_hydro_66: Glycosyl hydrolase family 66; PDB: 3VMO_A 3VMN_A 3VMP_A | Back alignment and domain information |
|---|
| >COG2730 BglC Endoglucanase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13210 putative L-xylulose 5-phosphate 3-epimerase; Reviewed | Back alignment and domain information |
|---|
| >PF13200 DUF4015: Putative glycosyl hydrolase domain | Back alignment and domain information |
|---|
| >cd06594 GH31_glucosidase_YihQ YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride | Back alignment and domain information |
|---|
| >TIGR00542 hxl6Piso_put hexulose-6-phosphate isomerase, putative | Back alignment and domain information |
|---|
| >COG3589 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd06597 GH31_transferase_CtsY CtsY (cyclic tetrasaccharide-synthesizing enzyme Y) is a bacterial 3-alpha-isomaltosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ | Back alignment and domain information |
|---|
| >cd06604 GH31_glucosidase_II_MalA Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities | Back alignment and domain information |
|---|
| >PF03198 Glyco_hydro_72: Glucanosyltransferase; InterPro: IPR004886 This family is a group of yeast glycolipid proteins anchored to the membrane | Back alignment and domain information |
|---|
| >cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) | Back alignment and domain information |
|---|
| >PF08139 LPAM_1: Prokaryotic membrane lipoprotein lipid attachment site; InterPro: IPR012640 In prokaryotes, membrane lipoproteins are synthesized with a precursor signal peptide, which is cleaved by a specific lipoprotein signal peptidase (signal peptidase II) | Back alignment and domain information |
|---|
| >cd05014 SIS_Kpsf KpsF-like protein | Back alignment and domain information |
|---|
| >PRK12928 lipoyl synthase; Provisional | Back alignment and domain information |
|---|
| >COG3222 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid) | Back alignment and domain information |
|---|
| >PLN02591 tryptophan synthase | Back alignment and domain information |
|---|
| >PF03932 CutC: CutC family; InterPro: IPR005627 Copper transport in Escherichia coli is mediated by the products of at least six genes, cutA, cutB, cutC, cutD, cutE, and cutF | Back alignment and domain information |
|---|
| >COG0826 Collagenase and related proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00953 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolases found in archaea | Back alignment and domain information |
|---|
| >PRK13111 trpA tryptophan synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK09856 fructoselysine 3-epimerase; Provisional | Back alignment and domain information |
|---|
| >PRK09852 cryptic 6-phospho-beta-glucosidase; Provisional | Back alignment and domain information |
|---|
| >cd06602 GH31_MGAM_SI_GAA This family includes the following three closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), and lysosomal acid alpha-glucosidase (GAA), also known as acid-maltase | Back alignment and domain information |
|---|
| >TIGR00510 lipA lipoate synthase | Back alignment and domain information |
|---|
| >PF07071 DUF1341: Protein of unknown function (DUF1341); InterPro: IPR010763 Members of this family of relatively uncommon proteins are found in both Gram-positive (e | Back alignment and domain information |
|---|
| >PF02065 Melibiase: Melibiase; InterPro: IPR000111 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >cd01299 Met_dep_hydrolase_A Metallo-dependent hydrolases, subgroup A is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site | Back alignment and domain information |
|---|
| >TIGR00262 trpA tryptophan synthase, alpha subunit | Back alignment and domain information |
|---|
| >PLN02814 beta-glucosidase | Back alignment and domain information |
|---|
| >cd06600 GH31_MGAM-like This family includes the following closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), lysosomal acid alpha-glucosidase (GAA), neutral alpha-glucosidase C (GANC), the alpha subunit of neutral alpha-glucosidase AB (GANAB), and alpha-glucosidase II | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 136 | ||||
| 4gin_A | 584 | Crystal Structure Of The Mutb R284c Mutant From Cry | 1e-26 | ||
| 2ze0_A | 555 | Alpha-glucosidase Gsj Length = 555 | 3e-25 | ||
| 1zja_A | 557 | Crystal Structure Of The Trehalulose Synthase Mutb | 1e-24 | ||
| 4h2c_A | 557 | Trehalulose Synthase Mutb R284c Mutant Length = 557 | 1e-24 | ||
| 4gi6_A | 557 | Crystal Structure Of The Mutb F164l Mutant In Compl | 1e-24 | ||
| 2pwe_A | 556 | Crystal Structure Of The Mutb E254q Mutant In Compl | 1e-24 | ||
| 2pwg_A | 556 | Crystal Structure Of The Trehalulose Synthase Mutb | 1e-24 | ||
| 2pwf_A | 556 | Crystal Structure Of The Mutb D200a Mutant In Compl | 1e-24 | ||
| 1m53_A | 570 | Crystal Structure Of Isomaltulose Synthase (Pali) F | 3e-24 | ||
| 1uok_A | 558 | Crystal Structure Of B. Cereus Oligo-1,6-Glucosidas | 1e-23 | ||
| 2zic_A | 543 | Crystal Structure Of Streptococcus Mutans Dextran G | 3e-23 | ||
| 2zid_A | 543 | Crystal Structure Of Dextran Glucosidase E236q Comp | 3e-23 | ||
| 4aie_A | 549 | Structure Of Glucan-1,6-Alpha-Glucosidase From Lact | 7e-23 | ||
| 3gbd_A | 558 | Crystal Structure Of The Isomaltulose Synthase Smua | 1e-22 | ||
| 3a47_A | 589 | Crystal Structure Of Isomaltase From Saccharomyces | 5e-22 | ||
| 3axh_A | 589 | Crystal Structure Of Isomaltase In Complex With Iso | 5e-22 | ||
| 3k8k_A | 669 | Crystal Structure Of Susg Length = 669 | 2e-17 | ||
| 3k8l_A | 669 | Crystal Structure Of Susg-D498n Mutant With Maltohe | 3e-17 | ||
| 1wza_A | 488 | Crystal Structure Of Alpha-Amylase From H.Orenii Le | 5e-15 | ||
| 1vfm_A | 585 | Crystal Structure Of Thermoactinomyces Vulgaris R-4 | 4e-12 | ||
| 1wzk_A | 585 | Thermoactinomyces Vulgaris R-47 Alpha-Amylase Ii (T | 5e-12 | ||
| 1jl8_A | 585 | Complex Of Alpha-Amylase Ii (Tva Ii) From Thermoact | 5e-12 | ||
| 1jf5_A | 585 | Crystal Structure Of Thermoactinomyces Vulgaris R-4 | 5e-12 | ||
| 1bvz_A | 585 | Alpha-Amylase Ii (Tvaii) From Thermoactinomyces Vul | 5e-12 | ||
| 1wzm_A | 585 | Thermoactinomyces Vulgaris R-47 Alpha-amylase Ii (t | 5e-12 | ||
| 1g1y_A | 585 | Crystal Structure Of Alpha-Amylase Ii (Tvaii) From | 5e-12 | ||
| 1wzl_A | 585 | Thermoactinomyces Vulgaris R-47 Alpha-Amylase Ii (T | 5e-12 | ||
| 1jf6_A | 585 | Crystal Structure Of Thermoactinomyces Vulgaris R-4 | 5e-12 | ||
| 1lwh_A | 441 | Crystal Structure Of T. Maritima 4-Alpha-Glucanotra | 1e-10 | ||
| 1j0j_A | 588 | Crystal Structure Of Neopullulanase E357q Complex W | 3e-10 | ||
| 1j0h_A | 588 | Crystal Structure Of Bacillus Stearothermophilus Ne | 3e-10 | ||
| 1ea9_C | 583 | Cyclomaltodextrinase Length = 583 | 4e-10 | ||
| 1gvi_A | 588 | Thermus Maltogenic Amylase In Complex With Beta-Cd | 9e-10 | ||
| 1sma_A | 588 | Crystal Structure Of A Maltogenic Amylase Length = | 1e-09 | ||
| 4aee_A | 696 | Crystal Structure Of Maltogenic Amylase From S.Mari | 6e-09 | ||
| 2dh3_A | 424 | Crystal Structure Of Human Ed-4f2hc Length = 424 | 2e-08 | ||
| 2dh2_A | 424 | Crystal Structure Of Human Ed-4f2hc Length = 424 | 2e-08 | ||
| 1mvy_A | 628 | Amylosucrase Mutant E328q Co-Crystallized With Malt | 3e-08 | ||
| 1jgi_A | 628 | Crystal Structure Of The Active Site Mutant Glu328g | 3e-08 | ||
| 2z1k_A | 475 | Crystal Structure Of Ttha1563 From Thermus Thermoph | 6e-08 | ||
| 4fls_A | 628 | Crystal Structure Of Amylosucrase Inactive Double M | 1e-07 | ||
| 4flo_A | 628 | Crystal Structure Of Amylosucrase Double Mutant A28 | 1e-07 | ||
| 4flr_A | 628 | Crystal Structure Of Amylosucrase Double Mutant A28 | 1e-07 | ||
| 1g5a_A | 628 | Amylosucrase From Neisseria Polysaccharea Length = | 1e-07 | ||
| 3ueq_A | 632 | Crystal Structure Of Amylosucrase From Neisseria Po | 1e-07 | ||
| 4flq_A | 628 | Crystal Structure Of Amylosucrase Double Mutant A28 | 1e-07 | ||
| 2wc7_A | 488 | Crystal Structure Of Nostoc Punctiforme Debranching | 4e-07 | ||
| 3dhu_A | 449 | Crystal Structure Of An Alpha-Amylase From Lactobac | 9e-07 | ||
| 1cgu_A | 684 | Catalytic Center Of Cyclodextrin Glycosyltransferas | 2e-06 | ||
| 8cgt_A | 684 | Structure Of Cyclodextrin Glycosyltransferase Compl | 2e-06 | ||
| 6cgt_A | 684 | Hoxa Complex Of Cyclodextrin Glycosyltransferase Mu | 2e-06 | ||
| 1cgt_A | 684 | Structure Of Cyclodextrin Glycosyltransferase Refin | 2e-06 | ||
| 4cgt_A | 678 | Deletion Mutant Delta(145-150), F151d Of Cyclodextr | 3e-06 | ||
| 4aef_A | 645 | The Crystal Structure Of Thermostable Amylase From | 6e-06 | ||
| 1izk_A | 637 | Thermoactinomyces Vulgaris R-47 Alpha-amylase 1 Mut | 8e-06 | ||
| 1izj_A | 637 | Thermoactinomyces Vulgaris R-47 Alpha-Amylase 1 Mut | 9e-06 | ||
| 2d0f_A | 637 | Crystal Structure Of Thermoactinomyces Vulgaris R-4 | 9e-06 | ||
| 1uh2_A | 637 | Thermoactinomyces Vulgaris R-47 Alpha-AmylaseMALTO- | 9e-06 | ||
| 1ji1_A | 637 | Crystal Structure Analysis Of Thermoactinomyces Vul | 9e-06 | ||
| 3hje_A | 704 | Crystal Structure Of Sulfolobus Tokodaii Hypothetic | 3e-05 | ||
| 3vge_A | 558 | Crystal Structure Of Glycosyltrehalose Trehalohydro | 1e-04 | ||
| 3vgg_A | 558 | Crystal Structure Of Glycosyltrehalose Trehalohydro | 1e-04 | ||
| 3vgd_A | 558 | Ctystal Structure Of Glycosyltrehalose Trehalohydro | 1e-04 | ||
| 1eh9_A | 558 | Crystal Structure Of Sulfolobus Solfataricus Glycos | 1e-04 | ||
| 1eha_A | 558 | Crystal Structure Of Glycosyltrehalose Trehalohydro | 1e-04 | ||
| 1qho_A | 686 | Five-Domain Alpha-Amylase From Bacillus Stearotherm | 2e-04 | ||
| 1uks_A | 686 | Crystal Structure Of F183lF259L MUTANT CYCLODEXTRIN | 3e-04 | ||
| 1cyg_A | 680 | Cyclodextrin Glucanotransferase (E.C.2.4.1.19) (Cgt | 3e-04 | ||
| 1v3j_A | 686 | Crystal Structure Of F283l Mutant Cyclodextrin Glyc | 3e-04 | ||
| 1v3k_A | 686 | Crystal Structure Of F283y Mutant Cyclodextrin Glyc | 3e-04 | ||
| 1d7f_A | 686 | Crystal Structure Of Asparagine 233-Replaced Cyclod | 3e-04 | ||
| 1pam_A | 686 | Cyclodextrin Glucanotransferase Length = 686 | 3e-04 | ||
| 3ucq_A | 655 | Crystal Structure Of Amylosucrase From Deinococcus | 3e-04 | ||
| 4gkl_A | 422 | Crystal Structure Of A Noncanonic Maltogenic Alpha- | 4e-04 | ||
| 1tcm_A | 686 | Cyclodextrin Glycosyltransferase W616a Mutant From | 6e-04 | ||
| 1ot2_A | 686 | Bacillus Circulans Strain 251 Cyclodextrin Glycosyl | 6e-04 | ||
| 1ot1_A | 686 | Bacillus Circulans Strain 251 Cyclodextrin Glycosyl | 6e-04 | ||
| 1cxk_A | 686 | Complex Between A Maltononaose Substrate And Bacill | 6e-04 | ||
| 1cdg_A | 686 | Nucleotide Sequence And X-Ray Structure Of Cyclodex | 6e-04 | ||
| 1cgx_A | 686 | Site Directed Mutations Of The Active Site Residue | 6e-04 | ||
| 1cgv_A | 686 | Site Directed Mutations Of The Active Site Residue | 6e-04 | ||
| 1kcl_A | 686 | Bacillus Ciruclans Strain 251 Cyclodextrin Glycosyl | 6e-04 | ||
| 1eo5_A | 686 | Bacillus Circulans Strain 251 Cyclodextrin Glycosyl | 6e-04 | ||
| 1cgw_A | 686 | Site Directed Mutations Of The Active Site Residue | 6e-04 | ||
| 1cgy_A | 686 | Site Directed Mutations Of The Active Site Residue | 6e-04 | ||
| 1kck_A | 686 | Bacillus Circulans Strain 251 Cyclodextrin Glycosyl | 6e-04 | ||
| 1cxl_A | 686 | Complex Between A Covalent Intermediate And Bacillu | 7e-04 | ||
| 2wpg_A | 637 | Sucrose Hydrolase Length = 637 | 7e-04 | ||
| 1pez_A | 686 | Bacillus Circulans Strain 251 Mutant A230v Length = | 7e-04 | ||
| 1dtu_A | 686 | Bacillus Circulans Strain 251 Cyclodextrin Glycosyl | 8e-04 |
| >pdb|4GIN|A Chain A, Crystal Structure Of The Mutb R284c Mutant From Crystals Soaked With The Inhibitor Deoxynojirimycin Length = 584 | Back alignment and structure |
|
| >pdb|2ZE0|A Chain A, Alpha-glucosidase Gsj Length = 555 | Back alignment and structure |
| >pdb|1ZJA|A Chain A, Crystal Structure Of The Trehalulose Synthase Mutb From Pseudomonas Mesoacidophila Mx-45 (Triclinic Form) Length = 557 | Back alignment and structure |
| >pdb|4H2C|A Chain A, Trehalulose Synthase Mutb R284c Mutant Length = 557 | Back alignment and structure |
| >pdb|4GI6|A Chain A, Crystal Structure Of The Mutb F164l Mutant In Complex With Glucose Length = 557 | Back alignment and structure |
| >pdb|2PWE|A Chain A, Crystal Structure Of The Mutb E254q Mutant In Complex With The Substrate Sucrose Length = 556 | Back alignment and structure |
| >pdb|2PWG|A Chain A, Crystal Structure Of The Trehalulose Synthase Mutb From Pseudomonas Mesoacidophila Mx-45 Complexed To The Inhibitor Castanospermine Length = 556 | Back alignment and structure |
| >pdb|2PWF|A Chain A, Crystal Structure Of The Mutb D200a Mutant In Complex With Glucose Length = 556 | Back alignment and structure |
| >pdb|1M53|A Chain A, Crystal Structure Of Isomaltulose Synthase (Pali) From Klebsiella Sp. Lx3 Length = 570 | Back alignment and structure |
| >pdb|1UOK|A Chain A, Crystal Structure Of B. Cereus Oligo-1,6-Glucosidase Length = 558 | Back alignment and structure |
| >pdb|2ZIC|A Chain A, Crystal Structure Of Streptococcus Mutans Dextran Glucosidase Length = 543 | Back alignment and structure |
| >pdb|2ZID|A Chain A, Crystal Structure Of Dextran Glucosidase E236q Complex With Isomaltotriose Length = 543 | Back alignment and structure |
| >pdb|4AIE|A Chain A, Structure Of Glucan-1,6-Alpha-Glucosidase From Lactobacillus Acidophilus Ncfm Length = 549 | Back alignment and structure |
| >pdb|3GBD|A Chain A, Crystal Structure Of The Isomaltulose Synthase Smua From Protaminobacter Rubrum Length = 558 | Back alignment and structure |
| >pdb|3A47|A Chain A, Crystal Structure Of Isomaltase From Saccharomyces Cerevisiae Length = 589 | Back alignment and structure |
| >pdb|3AXH|A Chain A, Crystal Structure Of Isomaltase In Complex With Isomaltose Length = 589 | Back alignment and structure |
| >pdb|3K8K|A Chain A, Crystal Structure Of Susg Length = 669 | Back alignment and structure |
| >pdb|3K8L|A Chain A, Crystal Structure Of Susg-D498n Mutant With Maltoheptaose Length = 669 | Back alignment and structure |
| >pdb|1WZA|A Chain A, Crystal Structure Of Alpha-Amylase From H.Orenii Length = 488 | Back alignment and structure |
| >pdb|1VFM|A Chain A, Crystal Structure Of Thermoactinomyces Vulgaris R-47 Alpha- Amylase 2ALPHA-Cyclodextrin Complex Length = 585 | Back alignment and structure |
| >pdb|1WZK|A Chain A, Thermoactinomyces Vulgaris R-47 Alpha-Amylase Ii (Tva Ii) Mutatnt D465n Length = 585 | Back alignment and structure |
| >pdb|1JL8|A Chain A, Complex Of Alpha-Amylase Ii (Tva Ii) From Thermoactinomyces Vulgaris R-47 With Beta-Cyclodextrin Based On A Co- Crystallization With Methyl Beta-Cyclodextrin Length = 585 | Back alignment and structure |
| >pdb|1JF5|A Chain A, Crystal Structure Of Thermoactinomyces Vulgaris R-47 Alpha- Amylase 2 Mutant F286a Length = 585 | Back alignment and structure |
| >pdb|1BVZ|A Chain A, Alpha-Amylase Ii (Tvaii) From Thermoactinomyces Vulgaris R- 47 Length = 585 | Back alignment and structure |
| >pdb|1WZM|A Chain A, Thermoactinomyces Vulgaris R-47 Alpha-amylase Ii (tva Ii) Mutatnt R469k Length = 585 | Back alignment and structure |
| >pdb|1G1Y|A Chain A, Crystal Structure Of Alpha-Amylase Ii (Tvaii) From Thermoactinomyces Vulgaris R-47 And Beta-Cyclodextrin Complex Length = 585 | Back alignment and structure |
| >pdb|1WZL|A Chain A, Thermoactinomyces Vulgaris R-47 Alpha-Amylase Ii (Tva Ii) Mutatnt R469l Length = 585 | Back alignment and structure |
| >pdb|1JF6|A Chain A, Crystal Structure Of Thermoactinomyces Vulgaris R-47 Alpha- Amylase Mutant F286y Length = 585 | Back alignment and structure |
| >pdb|1LWH|A Chain A, Crystal Structure Of T. Maritima 4-Alpha-Glucanotransferase Length = 441 | Back alignment and structure |
| >pdb|1J0J|A Chain A, Crystal Structure Of Neopullulanase E357q Complex With Maltotetraose Length = 588 | Back alignment and structure |
| >pdb|1J0H|A Chain A, Crystal Structure Of Bacillus Stearothermophilus Neopullulanase Length = 588 | Back alignment and structure |
| >pdb|1EA9|C Chain C, Cyclomaltodextrinase Length = 583 | Back alignment and structure |
| >pdb|1GVI|A Chain A, Thermus Maltogenic Amylase In Complex With Beta-Cd Length = 588 | Back alignment and structure |
| >pdb|1SMA|A Chain A, Crystal Structure Of A Maltogenic Amylase Length = 588 | Back alignment and structure |
| >pdb|4AEE|A Chain A, Crystal Structure Of Maltogenic Amylase From S.Marinus Length = 696 | Back alignment and structure |
| >pdb|2DH3|A Chain A, Crystal Structure Of Human Ed-4f2hc Length = 424 | Back alignment and structure |
| >pdb|2DH2|A Chain A, Crystal Structure Of Human Ed-4f2hc Length = 424 | Back alignment and structure |
| >pdb|1MVY|A Chain A, Amylosucrase Mutant E328q Co-Crystallized With Maltoheptaose. Length = 628 | Back alignment and structure |
| >pdb|1JGI|A Chain A, Crystal Structure Of The Active Site Mutant Glu328gln Of Amylosucrase From Neisseria Polysaccharea In Complex With The Natural Substrate Sucrose Length = 628 | Back alignment and structure |
| >pdb|2Z1K|A Chain A, Crystal Structure Of Ttha1563 From Thermus Thermophilus Hb8 Length = 475 | Back alignment and structure |
| >pdb|4FLS|A Chain A, Crystal Structure Of Amylosucrase Inactive Double Mutant F290k-E328q From Neisseria Polysaccharea In Complex With Sucrose Length = 628 | Back alignment and structure |
| >pdb|4FLO|A Chain A, Crystal Structure Of Amylosucrase Double Mutant A289p-F290c From Neisseria Polysaccharea Length = 628 | Back alignment and structure |
| >pdb|4FLR|A Chain A, Crystal Structure Of Amylosucrase Double Mutant A289p-F290l From Neisseria Polysaccharea Length = 628 | Back alignment and structure |
| >pdb|1G5A|A Chain A, Amylosucrase From Neisseria Polysaccharea Length = 628 | Back alignment and structure |
| >pdb|3UEQ|A Chain A, Crystal Structure Of Amylosucrase From Neisseria Polysaccharea In Complex With Turanose Length = 632 | Back alignment and structure |
| >pdb|4FLQ|A Chain A, Crystal Structure Of Amylosucrase Double Mutant A289p-F290i From Neisseria Polysaccharea Length = 628 | Back alignment and structure |
| >pdb|2WC7|A Chain A, Crystal Structure Of Nostoc Punctiforme Debranching Enzyme( Npde)(Acarbose Soaked) Length = 488 | Back alignment and structure |
| >pdb|3DHU|A Chain A, Crystal Structure Of An Alpha-Amylase From Lactobacillus Plantarum Length = 449 | Back alignment and structure |
| >pdb|1CGU|A Chain A, Catalytic Center Of Cyclodextrin Glycosyltransferase Derived From X-Ray Structure Analysis Combined With Site- Directed Mutagenesis Length = 684 | Back alignment and structure |
| >pdb|8CGT|A Chain A, Structure Of Cyclodextrin Glycosyltransferase Complexed With A Thio-Maltohexaose Length = 684 | Back alignment and structure |
| >pdb|6CGT|A Chain A, Hoxa Complex Of Cyclodextrin Glycosyltransferase Mutant Length = 684 | Back alignment and structure |
| >pdb|1CGT|A Chain A, Structure Of Cyclodextrin Glycosyltransferase Refined At 2.0 Angstroms Resolution Length = 684 | Back alignment and structure |
| >pdb|4CGT|A Chain A, Deletion Mutant Delta(145-150), F151d Of Cyclodextrin Glycosyltransferase Length = 678 | Back alignment and structure |
| >pdb|4AEF|A Chain A, The Crystal Structure Of Thermostable Amylase From The Pyrococcus Length = 645 | Back alignment and structure |
| >pdb|1IZK|A Chain A, Thermoactinomyces Vulgaris R-47 Alpha-amylase 1 Mutant Enzyme W398v Length = 637 | Back alignment and structure |
| >pdb|1IZJ|A Chain A, Thermoactinomyces Vulgaris R-47 Alpha-Amylase 1 Mutant Enzyme F313a Length = 637 | Back alignment and structure |
| >pdb|2D0F|A Chain A, Crystal Structure Of Thermoactinomyces Vulgaris R-47 Alpha- Amylase 1 (Tvai) Mutant D356n Complexed With P2, A Pullulan Model Oligosaccharide Length = 637 | Back alignment and structure |
| >pdb|1UH2|A Chain A, Thermoactinomyces Vulgaris R-47 Alpha-AmylaseMALTO-Hexaose Complex Length = 637 | Back alignment and structure |
| >pdb|1JI1|A Chain A, Crystal Structure Analysis Of Thermoactinomyces Vulgaris R- 47 Alpha-amylase 1 Length = 637 | Back alignment and structure |
| >pdb|3HJE|A Chain A, Crystal Structure Of Sulfolobus Tokodaii Hypothetical Maltooligosyl Trehalose Synthase Length = 704 | Back alignment and structure |
| >pdb|3VGE|A Chain A, Crystal Structure Of Glycosyltrehalose Trehalohydrolase (D252s) Length = 558 | Back alignment and structure |
| >pdb|3VGG|A Chain A, Crystal Structure Of Glycosyltrehalose Trehalohydrolase (E283q) Complexed With Maltoheptaose Length = 558 | Back alignment and structure |
| >pdb|3VGD|A Chain A, Ctystal Structure Of Glycosyltrehalose Trehalohydrolase (D252e) Length = 558 | Back alignment and structure |
| >pdb|1EH9|A Chain A, Crystal Structure Of Sulfolobus Solfataricus Glycosyltrehalose Trehalohydrolase Length = 558 | Back alignment and structure |
| >pdb|1EHA|A Chain A, Crystal Structure Of Glycosyltrehalose Trehalohydrolase From Sulfolobus Solfataricus Length = 558 | Back alignment and structure |
| >pdb|1QHO|A Chain A, Five-Domain Alpha-Amylase From Bacillus Stearothermophilus, MaltoseACARBOSE COMPLEX Length = 686 | Back alignment and structure |
| >pdb|1UKS|A Chain A, Crystal Structure Of F183lF259L MUTANT CYCLODEXTRIN Glucanotransferase Complexed With A Pseudo-Maltotetraose Derived From Acarbose Length = 686 | Back alignment and structure |
| >pdb|1CYG|A Chain A, Cyclodextrin Glucanotransferase (E.C.2.4.1.19) (Cgtase) Length = 680 | Back alignment and structure |
| >pdb|1V3J|A Chain A, Crystal Structure Of F283l Mutant Cyclodextrin Glycosyltransferase Length = 686 | Back alignment and structure |
| >pdb|1V3K|A Chain A, Crystal Structure Of F283y Mutant Cyclodextrin Glycosyltransferase Length = 686 | Back alignment and structure |
| >pdb|1D7F|A Chain A, Crystal Structure Of Asparagine 233-Replaced Cyclodextrin Glucanotransferase From Alkalophilic Bacillus Sp. 1011 Determined At 1.9 A Resolution Length = 686 | Back alignment and structure |
| >pdb|1PAM|A Chain A, Cyclodextrin Glucanotransferase Length = 686 | Back alignment and structure |
| >pdb|3UCQ|A Chain A, Crystal Structure Of Amylosucrase From Deinococcus Geothermalis Length = 655 | Back alignment and structure |
| >pdb|4GKL|A Chain A, Crystal Structure Of A Noncanonic Maltogenic Alpha-amylase Amyb From Thermotoga Neapolitana Length = 422 | Back alignment and structure |
| >pdb|1TCM|A Chain A, Cyclodextrin Glycosyltransferase W616a Mutant From Bacillus Circulans Strain 251 Length = 686 | Back alignment and structure |
| >pdb|1OT2|A Chain A, Bacillus Circulans Strain 251 Cyclodextrin Glycosyl Transferase Mutant D135n Length = 686 | Back alignment and structure |
| >pdb|1OT1|A Chain A, Bacillus Circulans Strain 251 Cyclodextrin Glycosyl Transferase Mutant D135a Length = 686 | Back alignment and structure |
| >pdb|1CXK|A Chain A, Complex Between A Maltononaose Substrate And Bacillus Circulans Strain 251 Cgtase E257qD229N Length = 686 | Back alignment and structure |
| >pdb|1CDG|A Chain A, Nucleotide Sequence And X-Ray Structure Of Cyclodextrin Glycosyltransferase From Bacillus Circulans Strain 251 In A Maltose-Dependent Crystal Form Length = 686 | Back alignment and structure |
| >pdb|1CGX|A Chain A, Site Directed Mutations Of The Active Site Residue Tyrosine 195 Of Cyclodextrin Glyxosyltransferase From Bacillus Circulans Strain 251 Affecting Activity And Product Specificity Length = 686 | Back alignment and structure |
| >pdb|1CGV|A Chain A, Site Directed Mutations Of The Active Site Residue Tyrosine 195 Of Cyclodextrin Glycosyltransferase From Bacillus Circulans Strain 251 Affecting Activity And Product Specificity Length = 686 | Back alignment and structure |
| >pdb|1KCL|A Chain A, Bacillus Ciruclans Strain 251 Cyclodextrin Glycosyl Transferase Mutant G179l Length = 686 | Back alignment and structure |
| >pdb|1EO5|A Chain A, Bacillus Circulans Strain 251 Cyclodextrin Glycosyltransferase In Complex With Maltoheptaose Length = 686 | Back alignment and structure |
| >pdb|1CGW|A Chain A, Site Directed Mutations Of The Active Site Residue Tyrosine 195 Of Cyclodextrin Glycosyltransferase From Bacillus Circulans Strain 251 Affecting Activity And Product Specificity Length = 686 | Back alignment and structure |
| >pdb|1CGY|A Chain A, Site Directed Mutations Of The Active Site Residue Tyrosine 195 Of Cyclodextrin Glyxosyltransferase From Bacillus Circulans Strain 251 Affecting Activity And Product Specificity Length = 686 | Back alignment and structure |
| >pdb|1KCK|A Chain A, Bacillus Circulans Strain 251 Cyclodextrin Glycosyl Transferase Mutant N193g Length = 686 | Back alignment and structure |
| >pdb|1CXL|A Chain A, Complex Between A Covalent Intermediate And Bacillus Circulans Strain 251 Cgtase E257q Length = 686 | Back alignment and structure |
| >pdb|2WPG|A Chain A, Sucrose Hydrolase Length = 637 | Back alignment and structure |
| >pdb|1PEZ|A Chain A, Bacillus Circulans Strain 251 Mutant A230v Length = 686 | Back alignment and structure |
| >pdb|1DTU|A Chain A, Bacillus Circulans Strain 251 Cyclodextrin Glycosyltransferase: A Mutant Y89dS146P COMPLEXED TO AN Hexasaccharide Inhibitor Length = 686 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 136 | |||
| 1zja_A | 557 | Trehalulose synthase; sucrose isomerase, alpha-amy | 4e-47 | |
| 1m53_A | 570 | Isomaltulose synthase; klebsiella SP. LX3, sucrose | 8e-47 | |
| 2zic_A | 543 | Dextran glucosidase; TIM barrel, (beta/alpha)8-bar | 1e-46 | |
| 2ze0_A | 555 | Alpha-glucosidase; TIM barrel, glucoside hydrolase | 2e-46 | |
| 1uok_A | 558 | Oligo-1,6-glucosidase; sugar degradation, hydrolas | 3e-46 | |
| 3aj7_A | 589 | Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro | 4e-46 | |
| 3k8k_A | 669 | Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet | 2e-43 | |
| 1wza_A | 488 | Alpha-amylase A; hydrolase, halophilic, thermophil | 1e-41 | |
| 1lwj_A | 441 | 4-alpha-glucanotransferase; alpha-amylase family, | 4e-41 | |
| 2dh2_A | 424 | 4F2 cell-surface antigen heavy chain; TIM-barrel, | 8e-41 | |
| 3dhu_A | 449 | Alpha-amylase; structural genomics, hydrolase, gly | 4e-32 | |
| 4aee_A | 696 | Alpha amylase, catalytic region; hydrolase, hypert | 2e-30 | |
| 2z1k_A | 475 | (NEO)pullulanase; hydrolase, structural genomics, | 1e-28 | |
| 1g5a_A | 628 | Amylosucrase; glycosyltransferase, glycoside hydro | 2e-27 | |
| 3ucq_A | 655 | Amylosucrase; thermostability, amylose synthesis, | 2e-27 | |
| 3czg_A | 644 | Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; | 3e-27 | |
| 2wc7_A | 488 | Alpha amylase, catalytic region; CD/PUL-hydrolyzin | 4e-25 | |
| 1ea9_C | 583 | Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A | 7e-25 | |
| 1wzl_A | 585 | Alpha-amylase II; pullulan, GH-13, alpha-amylase f | 1e-24 | |
| 1j0h_A | 588 | Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 | 2e-24 | |
| 3hje_A | 704 | 704AA long hypothetical glycosyltransferase; treha | 2e-24 | |
| 1gjw_A | 637 | Maltodextrin glycosyltransferase; alpha-amylase, m | 6e-24 | |
| 3zss_A | 695 | Putative glucanohydrolase PEP1A; alpha-glucan bios | 2e-23 | |
| 3edf_A | 601 | FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c | 3e-23 | |
| 2guy_A | 478 | Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; | 1e-21 | |
| 1qho_A | 686 | Alpha-amylase; glycoside hydrolase, starch degrada | 5e-21 | |
| 1cyg_A | 680 | Cyclodextrin glucanotransferase; glycosyltransfera | 1e-20 | |
| 1d3c_A | 686 | Cyclodextrin glycosyltransferase; alpha-amylase, p | 1e-20 | |
| 1iv8_A | 720 | Maltooligosyl trehalose synthase; beta alpha barre | 1e-20 | |
| 1ji1_A | 637 | Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 | 1e-20 | |
| 2aaa_A | 484 | Alpha-amylase; glycosidase; 2.10A {Aspergillus nig | 3e-20 | |
| 3bmv_A | 683 | Cyclomaltodextrin glucanotransferase; glycosidase, | 8e-20 | |
| 3bc9_A | 599 | AMYB, alpha amylase, catalytic region; acarbose, t | 5e-19 | |
| 1hvx_A | 515 | Alpha-amylase; hydrolase, glycosyltransferase, the | 3e-17 | |
| 1ht6_A | 405 | AMY1, alpha-amylase isozyme 1; barley, beta-alpha- | 3e-17 | |
| 3bh4_A | 483 | Alpha-amylase; calcium, carbohydrate metabolism, g | 8e-17 | |
| 3aie_A | 844 | Glucosyltransferase-SI; beta-alpha-barrels; HET: M | 1e-16 | |
| 1r7a_A | 504 | Sucrose phosphorylase; beta-alpha-barrels, dimer, | 4e-16 | |
| 1ud2_A | 480 | Amylase, alpha-amylase; calcium-free, alkaline, hy | 1e-15 | |
| 1wpc_A | 485 | Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr | 2e-14 | |
| 1mxg_A | 435 | Alpha amylase; hyperthermostable, family 13 glycos | 1e-11 | |
| 1ua7_A | 422 | Alpha-amylase; beta-alpha-barrels, acarbose, greek | 8e-11 | |
| 1gcy_A | 527 | Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b | 8e-08 | |
| 3m07_A | 618 | Putative alpha amylase; IDP00968, csgid, structura | 2e-05 | |
| 3vgf_A | 558 | Malto-oligosyltrehalose trehalohydrolase; alpha/be | 2e-05 | |
| 1g94_A | 448 | Alpha-amylase; beta-alpha-8-barrel, 3 domain struc | 2e-04 | |
| 2bhu_A | 602 | Maltooligosyltrehalose trehalohydrolase; alpha-amy | 3e-04 |
| >1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Length = 557 | Back alignment and structure |
|---|
Score = 158 bits (402), Expect = 4e-47
Identities = 46/92 (50%), Positives = 64/92 (69%)
Query: 23 PQKEWWQTAIMYQIYPRSFRDVNGDGTGDMRGITEKLDHFVDLGIESLWIQPFYPAGGAD 82
P WW++A+ YQ+YPRSF+D NGDG GD +G+TEKLD+ LGI+++WI P Y + D
Sbjct: 2 PGAPWWKSAVFYQVYPRSFKDTNGDGIGDFKGLTEKLDYLKGLGIDAIWINPHYASPNTD 61
Query: 83 LGYDVSNYVDVDPLFGDMHDFEILIEEAHSRG 114
GYD+S+Y +V +G M DF+ L+ E RG
Sbjct: 62 NGYDISDYREVMKEYGTMEDFDRLMAELKKRG 93
|
| >1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Length = 570 | Back alignment and structure |
|---|
| >2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Length = 543 | Back alignment and structure |
|---|
| >2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Length = 555 | Back alignment and structure |
|---|
| >1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Length = 558 | Back alignment and structure |
|---|
| >3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Length = 589 | Back alignment and structure |
|---|
| >3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Length = 669 | Back alignment and structure |
|---|
| >1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 Length = 488 | Back alignment and structure |
|---|
| >1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* Length = 441 | Back alignment and structure |
|---|
| >2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Length = 424 | Back alignment and structure |
|---|
| >3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Length = 449 | Back alignment and structure |
|---|
| >4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Length = 696 | Back alignment and structure |
|---|
| >2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Length = 475 | Back alignment and structure |
|---|
| >1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* Length = 628 | Back alignment and structure |
|---|
| >3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* Length = 655 | Back alignment and structure |
|---|
| >3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A Length = 644 | Back alignment and structure |
|---|
| >2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Length = 488 | Back alignment and structure |
|---|
| >1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Length = 583 | Back alignment and structure |
|---|
| >1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Length = 585 | Back alignment and structure |
|---|
| >1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Length = 588 | Back alignment and structure |
|---|
| >3hje_A 704AA long hypothetical glycosyltransferase; trehalose biosynthesis, maltooligoside trehalose synthase (M family 13 glycoside hydrolases; 1.90A {Sulfolobus tokodaii str} Length = 704 | Back alignment and structure |
|---|
| >1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Length = 637 | Back alignment and structure |
|---|
| >3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* Length = 695 | Back alignment and structure |
|---|
| >3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Length = 601 | Back alignment and structure |
|---|
| >2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Length = 478 | Back alignment and structure |
|---|
| >1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Length = 686 | Back alignment and structure |
|---|
| >1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Length = 680 | Back alignment and structure |
|---|
| >1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Length = 686 | Back alignment and structure |
|---|
| >1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 Length = 720 | Back alignment and structure |
|---|
| >1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A Length = 637 | Back alignment and structure |
|---|
| >2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Length = 484 | Back alignment and structure |
|---|
| >3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Length = 683 | Back alignment and structure |
|---|
| >3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Length = 599 | Back alignment and structure |
|---|
| >1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Length = 515 | Back alignment and structure |
|---|
| >1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* Length = 405 | Back alignment and structure |
|---|
| >3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Length = 483 | Back alignment and structure |
|---|
| >3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Length = 844 | Back alignment and structure |
|---|
| >1r7a_A Sucrose phosphorylase; beta-alpha-barrels, dimer, glycoside hydrolase, transferase; 1.77A {Bifidobacterium adolescentis} SCOP: b.71.1.1 c.1.8.1 PDB: 2gdv_A* 2gdu_A* Length = 504 | Back alignment and structure |
|---|
| >1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Length = 480 | Back alignment and structure |
|---|
| >1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Length = 485 | Back alignment and structure |
|---|
| >1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* Length = 435 | Back alignment and structure |
|---|
| >1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A Length = 422 | Back alignment and structure |
|---|
| >1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Length = 527 | Back alignment and structure |
|---|
| >3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} Length = 618 | Back alignment and structure |
|---|
| >3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A Length = 558 | Back alignment and structure |
|---|
| >1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* Length = 448 | Back alignment and structure |
|---|
| >2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* Length = 602 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 136 | |||
| 4aie_A | 549 | Glucan 1,6-alpha-glucosidase; hydrolase, glycoside | 100.0 | |
| 1zja_A | 557 | Trehalulose synthase; sucrose isomerase, alpha-amy | 100.0 | |
| 3aj7_A | 589 | Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro | 99.98 | |
| 4aef_A | 645 | Neopullulanase (alpha-amylase II); hydrolase, ther | 99.98 | |
| 1m53_A | 570 | Isomaltulose synthase; klebsiella SP. LX3, sucrose | 99.98 | |
| 2zic_A | 543 | Dextran glucosidase; TIM barrel, (beta/alpha)8-bar | 99.98 | |
| 1uok_A | 558 | Oligo-1,6-glucosidase; sugar degradation, hydrolas | 99.97 | |
| 2ze0_A | 555 | Alpha-glucosidase; TIM barrel, glucoside hydrolase | 99.97 | |
| 2wc7_A | 488 | Alpha amylase, catalytic region; CD/PUL-hydrolyzin | 99.97 | |
| 4aee_A | 696 | Alpha amylase, catalytic region; hydrolase, hypert | 99.97 | |
| 2dh2_A | 424 | 4F2 cell-surface antigen heavy chain; TIM-barrel, | 99.97 | |
| 2guy_A | 478 | Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; | 99.97 | |
| 2z1k_A | 475 | (NEO)pullulanase; hydrolase, structural genomics, | 99.97 | |
| 2aaa_A | 484 | Alpha-amylase; glycosidase; 2.10A {Aspergillus nig | 99.97 | |
| 1lwj_A | 441 | 4-alpha-glucanotransferase; alpha-amylase family, | 99.96 | |
| 1j0h_A | 588 | Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 | 99.96 | |
| 1wza_A | 488 | Alpha-amylase A; hydrolase, halophilic, thermophil | 99.96 | |
| 3edf_A | 601 | FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c | 99.96 | |
| 1wzl_A | 585 | Alpha-amylase II; pullulan, GH-13, alpha-amylase f | 99.96 | |
| 1qho_A | 686 | Alpha-amylase; glycoside hydrolase, starch degrada | 99.96 | |
| 1ea9_C | 583 | Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A | 99.96 | |
| 1ji1_A | 637 | Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 | 99.96 | |
| 3dhu_A | 449 | Alpha-amylase; structural genomics, hydrolase, gly | 99.96 | |
| 3k8k_A | 669 | Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet | 99.95 | |
| 3bmv_A | 683 | Cyclomaltodextrin glucanotransferase; glycosidase, | 99.95 | |
| 3czg_A | 644 | Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; | 99.95 | |
| 1d3c_A | 686 | Cyclodextrin glycosyltransferase; alpha-amylase, p | 99.95 | |
| 1g5a_A | 628 | Amylosucrase; glycosyltransferase, glycoside hydro | 99.95 | |
| 1cyg_A | 680 | Cyclodextrin glucanotransferase; glycosyltransfera | 99.95 | |
| 2wsk_A | 657 | Glycogen debranching enzyme; carbohydrate metaboli | 99.94 | |
| 3bc9_A | 599 | AMYB, alpha amylase, catalytic region; acarbose, t | 99.94 | |
| 2vr5_A | 718 | Glycogen operon protein GLGX; hydrolase, glycosida | 99.94 | |
| 2bhu_A | 602 | Maltooligosyltrehalose trehalohydrolase; alpha-amy | 99.94 | |
| 1m7x_A | 617 | 1,4-alpha-glucan branching enzyme; alpha/beta barr | 99.94 | |
| 1bf2_A | 750 | Isoamylase; hydrolase, glycosidase, debranching en | 99.94 | |
| 2e8y_A | 718 | AMYX protein, pullulanase; multiple domain, beta-a | 99.94 | |
| 1ht6_A | 405 | AMY1, alpha-amylase isozyme 1; barley, beta-alpha- | 99.93 | |
| 3ucq_A | 655 | Amylosucrase; thermostability, amylose synthesis, | 99.93 | |
| 3vgf_A | 558 | Malto-oligosyltrehalose trehalohydrolase; alpha/be | 99.93 | |
| 1mxg_A | 435 | Alpha amylase; hyperthermostable, family 13 glycos | 99.93 | |
| 4aio_A | 884 | Limit dextrinase; hydrolase, pullulanase, glycosid | 99.93 | |
| 1gjw_A | 637 | Maltodextrin glycosyltransferase; alpha-amylase, m | 99.93 | |
| 3m07_A | 618 | Putative alpha amylase; IDP00968, csgid, structura | 99.92 | |
| 1wpc_A | 485 | Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr | 99.92 | |
| 2ya0_A | 714 | Putative alkaline amylopullulanase; hydrolase, gly | 99.92 | |
| 2wan_A | 921 | Pullulanase; hydrolase, glycoside hydrolase, polys | 99.92 | |
| 3faw_A | 877 | Reticulocyte binding protein; TIM barrel, beta bar | 99.92 | |
| 3zss_A | 695 | Putative glucanohydrolase PEP1A; alpha-glucan bios | 99.92 | |
| 3aml_A | 755 | OS06G0726400 protein; starch-branching, transferas | 99.92 | |
| 1ud2_A | 480 | Amylase, alpha-amylase; calcium-free, alkaline, hy | 99.92 | |
| 3bh4_A | 483 | Alpha-amylase; calcium, carbohydrate metabolism, g | 99.91 | |
| 1hvx_A | 515 | Alpha-amylase; hydrolase, glycosyltransferase, the | 99.91 | |
| 3k1d_A | 722 | 1,4-alpha-glucan-branching enzyme; mycobacterium t | 99.91 | |
| 2ya1_A | 1014 | Putative alkaline amylopullulanase; hydrolase, gly | 99.91 | |
| 2fhf_A | 1083 | Pullulanase; multiple domain, beta-alpha-barrel, a | 99.89 | |
| 3aie_A | 844 | Glucosyltransferase-SI; beta-alpha-barrels; HET: M | 99.89 | |
| 1gcy_A | 527 | Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b | 99.89 | |
| 1ua7_A | 422 | Alpha-amylase; beta-alpha-barrels, acarbose, greek | 99.89 | |
| 1g94_A | 448 | Alpha-amylase; beta-alpha-8-barrel, 3 domain struc | 99.87 | |
| 1jae_A | 471 | Alpha-amylase; glycosidase, carbohydrate metabolis | 99.87 | |
| 3klk_A | 1039 | Glucansucrase; native form, open conformation, mul | 99.86 | |
| 1iv8_A | 720 | Maltooligosyl trehalose synthase; beta alpha barre | 99.85 | |
| 1r7a_A | 504 | Sucrose phosphorylase; beta-alpha-barrels, dimer, | 99.82 | |
| 3ttq_A | 1108 | Dextransucrase; (beta/alpha)8 barrel, transferase; | 99.82 | |
| 4gqr_A | 496 | Pancreatic alpha-amylase; glycosyl hydrolase, diab | 99.81 | |
| 3hje_A | 704 | 704AA long hypothetical glycosyltransferase; treha | 99.8 | |
| 1qnr_A | 344 | Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt | 96.8 | |
| 3qho_A | 458 | Endoglucanase, 458AA long hypothetical endo-1,4-be | 96.74 | |
| 1ece_A | 358 | Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. | 96.61 | |
| 3civ_A | 343 | Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1. | 96.52 | |
| 1hjs_A | 332 | Beta-1,4-galactanase; 4-galactanases, family 53 gl | 96.42 | |
| 3n9k_A | 399 | Glucan 1,3-beta-glucosidase; aromatic entranceway/ | 96.28 | |
| 2whl_A | 294 | Beta-mannanase, baman5; glycoside hydrolase, hydro | 96.27 | |
| 1ur4_A | 399 | Galactanase; hydrolase, beta-1, glycoside hydrolas | 96.08 | |
| 1bqc_A | 302 | Protein (beta-mannanase); glycosyl hydrolase, fami | 95.99 | |
| 3vup_A | 351 | Beta-1,4-mannanase; TIM barrel, digestive fluid, H | 95.91 | |
| 1h4p_A | 408 | Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca | 95.9 | |
| 3pzt_A | 327 | Endoglucanase; alpha/beta barrel, glycosyl hydrola | 95.89 | |
| 3nco_A | 320 | Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 | 95.87 | |
| 3jug_A | 345 | Beta-mannanase; TIM-barrel, glycosidase, hydrolase | 95.77 | |
| 3icg_A | 515 | Endoglucanase D; cellulase, xylanase, carbohydrate | 95.74 | |
| 1fob_A | 334 | Beta-1,4-galactanase; B/A barrel, glycosyl hydrola | 95.7 | |
| 1edg_A | 380 | Endoglucanase A; family A, cellulases, xylanases, | 95.57 | |
| 1ceo_A | 343 | Cellulase CELC; glycosyl hydrolase, family A/5 of | 95.51 | |
| 1esw_A | 500 | Amylomaltase; (beta,alpha)8-barrel, glucanotransfe | 95.5 | |
| 1vjz_A | 341 | Endoglucanase; TM1752, structural genomics, JCSG, | 95.39 | |
| 1wky_A | 464 | Endo-beta-1,4-mannanase; TIM barrel, catalytic dom | 95.32 | |
| 1x1n_A | 524 | 4-alpha-glucanotransferase; disproportionating enz | 95.23 | |
| 3aof_A | 317 | Endoglucanase; glycosyl hydrolase family 5, cellul | 95.22 | |
| 1uuq_A | 440 | Mannosyl-oligosaccharide glucosidase; hydrolase, m | 95.2 | |
| 1tz7_A | 505 | 4-alpha-glucanotransferase; (beta, alpha)8- barrel | 95.19 | |
| 3ndz_A | 345 | Endoglucanase D; cellotriose, xylanase, carbohydra | 95.17 | |
| 3qr3_A | 340 | Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A | 95.13 | |
| 3gyc_A | 393 | Putative glycoside hydrolase; YP_001304622.1, stru | 95.12 | |
| 3a24_A | 641 | Alpha-galactosidase; glycoside hydrolase family 97 | 95.07 | |
| 2jep_A | 395 | Xyloglucanase; family 5, plant cell WALL, hydrolas | 95.03 | |
| 2y8k_A | 491 | Arabinoxylanase, carbohydrate binding family 6; hy | 94.96 | |
| 3ayr_A | 376 | Endoglucanase; TIM barrel, hydrolase, carbohydrate | 94.95 | |
| 3pzg_A | 383 | Mannan endo-1,4-beta-mannosidase. glycosyl hydrol | 94.94 | |
| 2ki0_A | 36 | DS119; beta-alpha-beta, de novo protein; NMR {Synt | 94.88 | |
| 1tvn_A | 293 | Cellulase, endoglucanase G; glycoside hydrolase, C | 94.87 | |
| 3l55_A | 353 | B-1,4-endoglucanase/cellulase; putative beta-1,4-e | 94.86 | |
| 1rh9_A | 373 | Endo-beta-mannanase; endo-beta-mannase, retaining, | 94.82 | |
| 1egz_A | 291 | Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL | 94.72 | |
| 2c0h_A | 353 | Mannan endo-1,4-beta-mannosidase; hydrolase, signa | 94.59 | |
| 1g01_A | 364 | Endoglucanase; alpha/beta barrel, TIM barrel, hydr | 94.55 | |
| 2osx_A | 481 | Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel | 94.39 | |
| 1h1n_A | 305 | Endo type cellulase ENGI; hydrolase, glycosyl hydr | 94.34 | |
| 2wvv_A | 450 | Alpha-L-fucosidase; alpha-L-fucose, hydrolase, gly | 94.16 | |
| 3can_A | 182 | Pyruvate-formate lyase-activating enzyme; structur | 94.04 | |
| 2cks_A | 306 | Endoglucanase E-5; carbohydrate metabolism, polysa | 94.02 | |
| 4awe_A | 387 | Endo-beta-D-1,4-mannanase; hydrolase, endo-mannana | 93.97 | |
| 7a3h_A | 303 | Endoglucanase; hydrolase, cellulose degradation, g | 93.94 | |
| 4h41_A | 340 | Putative alpha-L-fucosidase; hydrolase, carbohydra | 93.58 | |
| 3d3a_A | 612 | Beta-galactosidase; protein structure initiative I | 93.52 | |
| 3tty_A | 675 | Beta-GAL, beta-galactosidase; TIM barrel, glycosid | 93.5 | |
| 3u7v_A | 552 | Beta-galactosidase; structural genomics, PSI-biolo | 93.44 | |
| 4e8d_A | 595 | Glycosyl hydrolase, family 35; TIM barrel, beta-pr | 93.13 | |
| 3thd_A | 654 | Beta-galactosidase; TIM-barrel domain, glycosyl hy | 93.01 | |
| 2d73_A | 738 | Alpha-glucosidase SUSB; glycoside hydrolase family | 92.97 | |
| 2w61_A | 555 | GAS2P, glycolipid-anchored surface protein 2; glyc | 92.96 | |
| 2yfo_A | 720 | Alpha-galactosidase-sucrose kinase agask; hydrolas | 92.78 | |
| 1vem_A | 516 | Beta-amylase; beta-alpha-barrels, optimum PH, hydr | 92.69 | |
| 2xn2_A | 732 | Alpha-galactosidase; hydrolase, glycosidase; HET: | 92.62 | |
| 3og2_A | 1003 | Beta-galactosidase; TIM barrel domain, glycoside h | 91.8 | |
| 2zxd_A | 455 | Alpha-L-fucosidase, putative; TIM barrel, hydrolas | 91.74 | |
| 1kwg_A | 645 | Beta-galactosidase; TIM barrel, glycoside hydrolas | 91.72 | |
| 1yht_A | 367 | DSPB; beta barrel, hydrolase; 2.00A {Aggregatibact | 91.7 | |
| 1zy9_A | 564 | Alpha-galactosidase; TM1192, struc genomics, joint | 91.54 | |
| 3lpp_A | 898 | Sucrase-isomaltase; glycoside hydrolase family 31, | 91.28 | |
| 4hty_A | 359 | Cellulase; (alpha/beta)8 barrel, family 5 endogluc | 90.99 | |
| 1qwg_A | 251 | PSL synthase;, (2R)-phospho-3-sulfolactate synthas | 90.9 | |
| 3nsx_A | 666 | Alpha-glucosidase; structural genomics, PSI-2, pro | 90.89 | |
| 3mi6_A | 745 | Alpha-galactosidase; NESG, structural genomics, PS | 90.71 | |
| 1now_A | 507 | Beta-hexosaminidase beta chain; (beta/alpha)8-barr | 90.67 | |
| 1tg7_A | 971 | Beta-galactosidase; TIM barrel domain, glycoside h | 90.65 | |
| 1x7f_A | 385 | Outer surface protein; structural genomics, unknow | 90.61 | |
| 3kzs_A | 463 | Glycosyl hydrolase family 5; structural genomics, | 90.43 | |
| 3l4y_A | 875 | Maltase-glucoamylase, intestinal; glycoside hydrol | 90.38 | |
| 2gjx_A | 507 | Beta-hexosaminidase alpha chain; beta-hexosaminida | 90.0 | |
| 1ug6_A | 431 | Beta-glycosidase; glucosidase, atomic resolution, | 89.78 | |
| 3eyp_A | 469 | Putative alpha-L-fucosidase; structural genomics, | 89.57 | |
| 2j6v_A | 301 | UV endonuclease, UVDE; plasmid, TIM barrel, DNA re | 89.21 | |
| 2o9p_A | 454 | Beta-glucosidase B; family 1 glycoside hydrolase; | 89.21 | |
| 3ozo_A | 572 | N-acetylglucosaminidase; beta-N-acetyl-D-hexosamin | 89.17 | |
| 1vff_A | 423 | Beta-glucosidase; glycosyl hydrolase, membrane-bou | 89.17 | |
| 3c8f_A | 245 | Pyruvate formate-lyase 1-activating enzyme; adoMet | 89.06 | |
| 3lmz_A | 257 | Putative sugar isomerase; structural genomics, joi | 88.89 | |
| 3ff4_A | 122 | Uncharacterized protein; structural genomics, PSI- | 88.62 | |
| 3ues_A | 478 | Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydr | 88.5 | |
| 1jak_A | 512 | Beta-N-acetylhexosaminidase; glycoside hydrolase, | 88.22 | |
| 1uas_A | 362 | Alpha-galactosidase; TIM-barrel, beta-alpha-barrel | 88.03 | |
| 2p0o_A | 372 | Hypothetical protein DUF871; structural genomics, | 87.92 | |
| 3ahx_A | 453 | Beta-glucosidase A; cellulases, glycosyl hydrolase | 87.85 | |
| 2j78_A | 468 | Beta-glucosidase A; family 1, hydrolase, inhibitor | 87.69 | |
| 2g3m_A | 693 | Maltase, alpha-glucosidase; hydrolase, glycoside h | 87.54 | |
| 3rcn_A | 543 | Beta-N-acetylhexosaminidase; structural genomics, | 87.51 | |
| 1c7s_A | 858 | Beta-N-acetylhexosaminidase; glycosyl hydrolase, c | 87.48 | |
| 3obe_A | 305 | Sugar phosphate isomerase/epimerase; structural ge | 87.36 | |
| 1szn_A | 417 | Alpha-galactosidase; (beta/alpha)8 barrel,TWO doma | 87.34 | |
| 3p6l_A | 262 | Sugar phosphate isomerase/epimerase; TIM barrel, s | 87.34 | |
| 2ebf_X | 746 | Dermonecrotic toxin; pasteurella multocida toxin, | 87.06 | |
| 2cho_A | 716 | Glucosaminidase, hexosaminiase; O-GLCNACASE, hydro | 86.79 | |
| 3gh5_A | 525 | HEX1, beta-hexosaminidase; beta-N-acetylhexosamini | 86.74 | |
| 3fj0_A | 465 | Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase | 86.66 | |
| 3gza_A | 443 | Putative alpha-L-fucosidase; NP_812709.1, structur | 86.1 | |
| 1wcg_A | 464 | Thioglucosidase, myrosinase; aphid, beta-glucosida | 86.06 | |
| 2epl_X | 627 | N-acetyl-beta-D-glucosaminidase; glycoside hydrola | 85.45 | |
| 1w91_A | 503 | Beta-xylosidase; MAD, seMet, tetramer, hydrolase; | 85.44 | |
| 2bdq_A | 224 | Copper homeostasis protein CUTC; alpha beta protei | 84.89 | |
| 1qox_A | 449 | Beta-glucosidase; hydrolase, cellulose degradation | 83.87 | |
| 3tva_A | 290 | Xylose isomerase domain protein TIM barrel; struct | 83.78 | |
| 4fnq_A | 729 | Alpha-galactosidase AGAB; glycoside hydrolase, hyd | 83.78 | |
| 2yl5_A | 442 | Beta-N-acetylhexosaminidase; hydrolase; 2.15A {Str | 83.72 | |
| 3gnp_A | 488 | OS03G0212800 protein; beta-alpha barrel, glycosida | 83.06 | |
| 2v5d_A | 737 | O-GLCNACASE NAGJ; family 32 carbohydrate binding m | 82.96 | |
| 2e9l_A | 469 | Cytosolic beta-glucosidase; novel cytosolic neutra | 82.91 | |
| 1twd_A | 256 | Copper homeostasis protein CUTC; TIM-like protein, | 82.89 | |
| 1v08_A | 512 | Beta-glucosidase; glycoside hydrolase, dimboa-gluc | 82.6 | |
| 2xhy_A | 479 | BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, | 82.43 | |
| 4hz8_A | 444 | Beta-glucosidase; BGLB,BGL, hydrolase, glycosid ba | 82.14 | |
| 3aam_A | 270 | Endonuclease IV, endoiv; DNA repair, base excision | 81.79 | |
| 1e4i_A | 447 | Beta-glucosidase; hydrolase, family 1 glycosyl hyd | 81.75 | |
| 3vmn_A | 643 | Dextranase; TIM barrel, immunoglobrin fold, greek- | 81.56 | |
| 3a21_A | 614 | Putative secreted alpha-galactosidase; beta-alpha- | 81.02 | |
| 3apg_A | 473 | Beta-glucosidase; TIM barrel, hydrolase, sugar bin | 80.83 | |
| 3ngf_A | 269 | AP endonuclease, family 2; structural genomics, se | 80.42 | |
| 4ba0_A | 817 | Alpha-glucosidase, putative, ADG31B; hydrolase; HE | 80.14 | |
| 2yl6_A | 434 | Beta-N-acetylhexosaminidase; peptidoglycan-anchor, | 80.07 | |
| 2v5c_A | 594 | O-GLCNACASE NAGJ; glycosidase, GH84, GH84C, hydrol | 80.07 | |
| 1pbg_A | 468 | PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g | 80.01 |
| >4aie_A Glucan 1,6-alpha-glucosidase; hydrolase, glycoside hydrolase 13; HET: MES GOL; 2.05A {Lactobacillus acidophilus ncfm} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.8e-36 Score=250.57 Aligned_cols=106 Identities=39% Similarity=0.857 Sum_probs=102.2
Q ss_pred CccccCCceEEEEecccccCcCCCCCCCHHHHHHhHHHHHHcCCcEEEEcCCccCCCCCCCCCccCCCCCCCCCCCHHHH
Q psy12953 24 QKEWWQTAIMYQIYPRSFRDVNGDGTGDMRGITEKLDHFVDLGIESLWIQPFYPAGGADLGYDVSNYVDVDPLFGDMHDF 103 (136)
Q Consensus 24 ~~~w~~~~~iY~v~~~~f~~~~~~~~g~~~~l~~~l~~l~~lG~~~I~l~Pi~~~~~~~~gY~~~d~~~vd~~~Gt~~~~ 103 (136)
+++||++.||||+++++|+++++++.|||+|++++|+|||+||||+|||+||+++++.++||++.||++|||+|||++||
T Consensus 3 ~~~Ww~~~viYei~~~~F~d~~~dg~Gdl~Gi~~kLdYLk~LGvt~I~L~Pi~~~~~~~~GYd~~dy~~vdp~~Gt~~df 82 (549)
T 4aie_A 3 SASWWKNAVVYQVYPKSFQDSNGDGIGDLQGIISRLDYLEKLGIDAIWLSPVYQSPGVDNGYDISDYEAIDPQYGTMADM 82 (549)
T ss_dssp -CCGGGSCCEEEECGGGTCCSSSSSSCCHHHHHTTHHHHHHHTCSEEEECCCEECCCTTTTSSCSEEEEECTTTCCHHHH
T ss_pred CchhhccCeEEEEEcchhcCCCCCCCcCHHHHHHhhHHHHHCCCCEEEeCCCcCCCCCCCCcCccCCCCcCcccCCHHHH
Confidence 57899999999999999999999999999999999999999999999999999999888999999999999999999999
Q ss_pred HHHHHHHHHCCCcEEE---eccCCCccCC
Q psy12953 104 EILIEEAHSRGKPKRT---FREVTKSFAN 129 (136)
Q Consensus 104 ~~lv~~ah~~Gi~vil---~nh~~~~~~~ 129 (136)
++||++||++||+||+ +||++.+|++
T Consensus 83 k~Lv~~aH~~Gi~VilD~V~NHts~~~~w 111 (549)
T 4aie_A 83 DELISKAKEHHIKIVMDLVVNHTSDQHKW 111 (549)
T ss_dssp HHHHHHHHHTTCEEEEEECCSBCCTTSHH
T ss_pred HHHHHHHHHCCCEEEEEECccCCcCCcch
Confidence 9999999999999999 9999988764
|
| >1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* | Back alignment and structure |
|---|
| >3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* | Back alignment and structure |
|---|
| >4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* | Back alignment and structure |
|---|
| >1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} | Back alignment and structure |
|---|
| >2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A | Back alignment and structure |
|---|
| >4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} | Back alignment and structure |
|---|
| >2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A | Back alignment and structure |
|---|
| >2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A | Back alignment and structure |
|---|
| >2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* | Back alignment and structure |
|---|
| >1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* | Back alignment and structure |
|---|
| >1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A | Back alignment and structure |
|---|
| >1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A | Back alignment and structure |
|---|
| >1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* | Back alignment and structure |
|---|
| >1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A | Back alignment and structure |
|---|
| >3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* | Back alignment and structure |
|---|
| >3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A | Back alignment and structure |
|---|
| >3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A | Back alignment and structure |
|---|
| >1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... | Back alignment and structure |
|---|
| >1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* | Back alignment and structure |
|---|
| >1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A | Back alignment and structure |
|---|
| >2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A | Back alignment and structure |
|---|
| >2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* | Back alignment and structure |
|---|
| >1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* | Back alignment and structure |
|---|
| >1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* | Back alignment and structure |
|---|
| >1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* | Back alignment and structure |
|---|
| >3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* | Back alignment and structure |
|---|
| >3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A | Back alignment and structure |
|---|
| >1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* | Back alignment and structure |
|---|
| >4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A | Back alignment and structure |
|---|
| >1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* | Back alignment and structure |
|---|
| >3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* | Back alignment and structure |
|---|
| >2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* | Back alignment and structure |
|---|
| >2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} | Back alignment and structure |
|---|
| >3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* | Back alignment and structure |
|---|
| >3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* | Back alignment and structure |
|---|
| >3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A | Back alignment and structure |
|---|
| >1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A | Back alignment and structure |
|---|
| >3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A | Back alignment and structure |
|---|
| >1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2fhf_A Pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with maltotetraose, hydrolase; HET: GLC; 1.65A {Klebsiella aerogenes} SCOP: b.1.18.2 b.1.18.2 b.3.1.3 b.71.1.1 c.1.8.1 PDB: 2fh6_A* 2fh8_A* 2fhb_A* 2fhc_A* 2fgz_A* | Back alignment and structure |
|---|
| >3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* | Back alignment and structure |
|---|
| >1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* | Back alignment and structure |
|---|
| >1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A | Back alignment and structure |
|---|
| >1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* | Back alignment and structure |
|---|
| >1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* | Back alignment and structure |
|---|
| >3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* 4amc_A | Back alignment and structure |
|---|
| >1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1r7a_A Sucrose phosphorylase; beta-alpha-barrels, dimer, glycoside hydrolase, transferase; 1.77A {Bifidobacterium adolescentis} SCOP: b.71.1.1 c.1.8.1 PDB: 2gdv_A* 2gdu_A* | Back alignment and structure |
|---|
| >3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* | Back alignment and structure |
|---|
| >4gqr_A Pancreatic alpha-amylase; glycosyl hydrolase, diabetes, obesity, digestion, glycosidas inhibition, flavonol, drug design; HET: NAG MYC; 1.20A {Homo sapiens} PDB: 1cpu_A* 1bsi_A 1u2y_A* 1u30_A* 1u33_A* 1xcw_A* 1xcx_A* 1xd0_A* 1xd1_A* 2qmk_A* 2qv4_A* 3bai_A* 3baj_A* 3baw_A* 3ij7_A* 1hny_A* 3ij9_A* 3ij8_A* 4gqq_A* 1kgw_A* ... | Back alignment and structure |
|---|
| >3hje_A 704AA long hypothetical glycosyltransferase; trehalose biosynthesis, maltooligoside trehalose synthase (M family 13 glycoside hydrolases; 1.90A {Sulfolobus tokodaii str} | Back alignment and structure |
|---|
| >1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* | Back alignment and structure |
|---|
| >3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* | Back alignment and structure |
|---|
| >1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A | Back alignment and structure |
|---|
| >3civ_A Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* | Back alignment and structure |
|---|
| >3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} SCOP: c.1.8.3 PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A | Back alignment and structure |
|---|
| >2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A | Back alignment and structure |
|---|
| >1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* | Back alignment and structure |
|---|
| >1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* | Back alignment and structure |
|---|
| >3vup_A Beta-1,4-mannanase; TIM barrel, digestive fluid, HYD; 1.05A {Aplysia kurodai} | Back alignment and structure |
|---|
| >1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A | Back alignment and structure |
|---|
| >3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* | Back alignment and structure |
|---|
| >3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} | Back alignment and structure |
|---|
| >1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A | Back alignment and structure |
|---|
| >1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A | Back alignment and structure |
|---|
| >1esw_A Amylomaltase; (beta,alpha)8-barrel, glucanotransferase, alpha-amylase FAMI acarbose, transferase; HET: ACR; 1.90A {Thermus aquaticus} SCOP: c.1.8.1 PDB: 1cwy_A* 1fp8_A 1fp9_A 2owc_A* 2oww_A* 2owx_A* 2x1i_A* | Back alignment and structure |
|---|
| >1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 | Back alignment and structure |
|---|
| >1x1n_A 4-alpha-glucanotransferase; disproportionating enzyme, amylomaltase, D-enzyme; 1.80A {Solanum tuberosum} SCOP: c.1.8.1 | Back alignment and structure |
|---|
| >3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* | Back alignment and structure |
|---|
| >1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A* | Back alignment and structure |
|---|
| >1tz7_A 4-alpha-glucanotransferase; (beta, alpha)8- barrel; 2.15A {Aquifex aeolicus} SCOP: c.1.8.1 | Back alignment and structure |
|---|
| >3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* | Back alignment and structure |
|---|
| >3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} | Back alignment and structure |
|---|
| >3gyc_A Putative glycoside hydrolase; YP_001304622.1, structural GEN joint center for structural genomics, JCSG; HET: MSE; 1.85A {Parabacteroides distasonis atcc 8503} | Back alignment and structure |
|---|
| >3a24_A Alpha-galactosidase; glycoside hydrolase family 97, retaining glycosidase; HET: MES; 2.30A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* | Back alignment and structure |
|---|
| >2y8k_A Arabinoxylanase, carbohydrate binding family 6; hydrolase; 1.47A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* | Back alignment and structure |
|---|
| >3pzg_A Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 5; alpha/beta barrel, glycosyl hydrolase, sugar binding, secret hydrolase; 1.40A {Thermotoga petrophila} PDB: 3pz9_A 3pzi_A* 3pzm_A 3pzn_A* 3pzo_A* 3pzq_A* | Back alignment and structure |
|---|
| >2ki0_A DS119; beta-alpha-beta, de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* | Back alignment and structure |
|---|
| >1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >2c0h_A Mannan endo-1,4-beta-mannosidase; hydrolase, signal, TIM alpha/beta barrel; 1.6A {Mytilus edulis} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* | Back alignment and structure |
|---|
| >2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* | Back alignment and structure |
|---|
| >1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A | Back alignment and structure |
|---|
| >2wvv_A Alpha-L-fucosidase; alpha-L-fucose, hydrolase, glycoside hydrolase family 29; 1.73A {Bacteroides thetaiotaomicron} PDB: 2xii_A* 2xib_A* 2wvv_B 2wvt_A* 2wvu_A* 2wvs_A* | Back alignment and structure |
|---|
| >3can_A Pyruvate-formate lyase-activating enzyme; structural genomics, pyruvate-formate lyase-activating enzym MCSG, APC20359.1; 1.80A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A* | Back alignment and structure |
|---|
| >4awe_A Endo-beta-D-1,4-mannanase; hydrolase, endo-mannanase, glycosyl hydrolase, GH5; HET: NAG; 1.40A {Neurospora sitophila} | Back alignment and structure |
|---|
| >7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A | Back alignment and structure |
|---|
| >4h41_A Putative alpha-L-fucosidase; hydrolase, carbohydrate metabolism, HOST glycans, structural genomics; HET: MSE 1PE PE4 PG4 PG6; 1.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3d3a_A Beta-galactosidase; protein structure initiative II, PSI II, NYSGXRC, 11092F, structural genomics; 2.15A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >3tty_A Beta-GAL, beta-galactosidase; TIM barrel, glycoside hydrolase, hydrolase; HET: GLA; 2.25A {Bacillus circulans subsp} PDB: 3tts_A* | Back alignment and structure |
|---|
| >3u7v_A Beta-galactosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, TIM barrel, glyco_hydro_42; HET: MSE; 1.80A {Caulobacter crescentus} | Back alignment and structure |
|---|
| >4e8d_A Glycosyl hydrolase, family 35; TIM barrel, beta-propeller, glycohydrolase; 1.80A {Streptococcus pneumoniae} PDB: 4e8c_A | Back alignment and structure |
|---|
| >3thd_A Beta-galactosidase; TIM-barrel domain, glycosyl hydrolase, glycosylation, hydrolase; HET: NAG DGJ; 1.79A {Homo sapiens} PDB: 3thc_A* | Back alignment and structure |
|---|
| >2d73_A Alpha-glucosidase SUSB; glycoside hydrolase family 97, TIM barrel; 1.60A {Bacteroides thetaiotaomicron vpi-5482} PDB: 2zq0_A* 2jke_A* 2jka_A* 2jkp_A* | Back alignment and structure |
|---|
| >2w61_A GAS2P, glycolipid-anchored surface protein 2; glycoprotein, cell membrane, fungal cell WALL, transglycosyl glucan, membrane, GPI-anchor; 1.62A {Saccharomyces cerevisiae} PDB: 2w62_A* 2w63_A* | Back alignment and structure |
|---|
| >2yfo_A Alpha-galactosidase-sucrose kinase agask; hydrolase; HET: GLA GAL; 1.35A {Ruminococcus gnavus E1} PDB: 2yfn_A* | Back alignment and structure |
|---|
| >1vem_A Beta-amylase; beta-alpha-barrels, optimum PH, hydrolase; HET: GLC; 1.85A {Bacillus cereus} SCOP: b.3.1.1 c.1.8.1 PDB: 1b90_A* 1j0y_A* 1j0z_A* 1j10_A* 1b9z_A* 1j12_A* 1j18_A* 1j11_A* 5bca_A 1veo_A* 1itc_A* 1ven_A* 1vep_A* 1cqy_A | Back alignment and structure |
|---|
| >2xn2_A Alpha-galactosidase; hydrolase, glycosidase; HET: SME GLA IMD; 1.58A {Lactobacillus acidophilus ncfm} PDB: 2xn1_A* 2xn0_A* | Back alignment and structure |
|---|
| >3og2_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family 35, glycoprot hydrolase; HET: NAG BMA MAN GLC; 1.20A {Trichoderma reesei} PDB: 3ogr_A* 3ogs_A* 3ogv_A* | Back alignment and structure |
|---|
| >2zxd_A Alpha-L-fucosidase, putative; TIM barrel, hydrolase; HET: ZXD; 2.15A {Thermotoga maritima} PDB: 2zwy_A* 2zx5_A* 2zx6_A* 2zx7_A* 2zwz_A* 2zx9_A* 2zxa_A* 2zxb_A* 2zx8_A* 1hl9_A* 1hl8_A* 1odu_A* 2wsp_A* | Back alignment and structure |
|---|
| >1kwg_A Beta-galactosidase; TIM barrel, glycoside hydrolase family 42, trimer, hydrolase; 1.60A {Thermus thermophilus} SCOP: b.71.1.1 c.1.8.1 c.23.16.5 PDB: 1kwk_A* | Back alignment and structure |
|---|
| >1yht_A DSPB; beta barrel, hydrolase; 2.00A {Aggregatibacter actinomycetemcomitans} SCOP: c.1.8.6 | Back alignment and structure |
|---|
| >1zy9_A Alpha-galactosidase; TM1192, struc genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI, hydrolase; 2.34A {Thermotoga maritima} SCOP: b.30.5.11 c.1.8.13 | Back alignment and structure |
|---|
| >3lpp_A Sucrase-isomaltase; glycoside hydrolase family 31, alpha-glucosidase membrane, disease mutation, disulfide bond, glycoprotein, glycosidase; HET: NAG BMA MAN KTL; 2.15A {Homo sapiens} PDB: 3lpo_A* | Back alignment and structure |
|---|
| >4hty_A Cellulase; (alpha/beta)8 barrel, family 5 endoglucanase, hydrolase; 2.00A {Uncultured bacterium} PDB: 4hu0_A* | Back alignment and structure |
|---|
| >1qwg_A PSL synthase;, (2R)-phospho-3-sulfolactate synthase; beta-alpha-barrel, lyase; 1.60A {Methanocaldococcus jannaschii} SCOP: c.1.27.1 | Back alignment and structure |
|---|
| >3nsx_A Alpha-glucosidase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, acarbose; 1.57A {Ruminococcus obeum} PDB: 3ffj_A 3n04_A 3pha_A* 3nuk_A 3nxm_A* 3m46_A 3mkk_A* 3m6d_A* 3nqq_A* 3poc_A* | Back alignment and structure |
|---|
| >3mi6_A Alpha-galactosidase; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium, hydrolase; 2.70A {Lactobacillus brevis} | Back alignment and structure |
|---|
| >1now_A Beta-hexosaminidase beta chain; (beta/alpha)8-barrel, homodimer, family 20 glycosidase, HYDR; HET: NAG IFG; 2.20A {Homo sapiens} SCOP: c.1.8.6 d.92.2.1 PDB: 1nou_A* 1np0_A* 2gjx_B* 3lmy_A* 1o7a_A* 2gk1_B* | Back alignment and structure |
|---|
| >1tg7_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family GH35, glycopr penicillium, hydrolase; HET: NAG BMA MAN; 1.90A {Penicillium SP} SCOP: b.149.1.1 b.18.1.27 b.18.1.27 b.71.1.5 c.1.8.14 PDB: 1xc6_A* | Back alignment and structure |
|---|
| >1x7f_A Outer surface protein; structural genomics, unknown function, MCSG, PSI, midwest center for struct genomics; 2.30A {Bacillus cereus atcc 14579} SCOP: b.62.1.2 c.1.8.12 | Back alignment and structure |
|---|
| >3kzs_A Glycosyl hydrolase family 5; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3l4y_A Maltase-glucoamylase, intestinal; glycoside hydrolase family 31, cell membrane, disulfide bond, glycoprotein, glycosidase, hydrolase, membrane; HET: NR4 NAG; 1.80A {Homo sapiens} PDB: 3l4u_A* 3l4v_A* 3l4w_A* 3l4x_A* 3l4t_A* 3l4z_A* 2qmj_A* 2qly_A* 3ctt_A* | Back alignment and structure |
|---|
| >2gjx_A Beta-hexosaminidase alpha chain; beta-hexosaminidase A, glycosidase, TAY-sachs disease, GM2 ganglisode, TIM barrel, hydrolase; HET: NAG BMA NDG; 2.80A {Homo sapiens} SCOP: c.1.8.6 d.92.2.1 PDB: 2gk1_A* | Back alignment and structure |
|---|
| >1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A | Back alignment and structure |
|---|
| >3eyp_A Putative alpha-L-fucosidase; structural genomics, hydrolase, lipoprotein, PSI-2, protein initiative; 1.90A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2j6v_A UV endonuclease, UVDE; plasmid, TIM barrel, DNA repair, DNA binding protein, lyase; HET: KCX ALY; 1.55A {Thermus thermophilus} PDB: 3bzg_A 3c0s_A* 3c0l_A 3c0q_A* 3bzj_A | Back alignment and structure |
|---|
| >2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* | Back alignment and structure |
|---|
| >3ozo_A N-acetylglucosaminidase; beta-N-acetyl-D-hexosaminidase, hydrolase-hydrolase inhibito; HET: NGT; 2.00A {Ostrinia furnacalis} PDB: 3nsn_A* 3nsm_A* 3ozp_A* 3s6t_A* 3vtr_A* | Back alignment and structure |
|---|
| >1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 | Back alignment and structure |
|---|
| >3c8f_A Pyruvate formate-lyase 1-activating enzyme; adoMet radical, SAM radical, activase, glycyl radical, 4Fe- 4S, carbohydrate metabolism, cytoplasm; HET: MT2 PGE; 2.25A {Escherichia coli} PDB: 3cb8_A* | Back alignment and structure |
|---|
| >3lmz_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS isomerase; HET: MSE CIT PGE; 1.44A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3ues_A Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydrolase inhibitor complex; HET: DFU; 1.60A {Bifidobacterium longum subsp} PDB: 3mo4_A* 3uet_A* | Back alignment and structure |
|---|
| >1jak_A Beta-N-acetylhexosaminidase; glycoside hydrolase, family 20, substrate-assisted catalysis, alpha/beta barrel, isofagomin inhibitor complex; HET: IFG; 1.75A {Streptomyces plicatus} SCOP: c.1.8.6 d.92.2.1 PDB: 1hp4_A* 1hp5_A* 1m01_A* 1m04_A* 1m03_A* | Back alignment and structure |
|---|
| >1uas_A Alpha-galactosidase; TIM-barrel, beta-alpha-barrel, greek KEY motif, hydrolase; HET: GLA; 1.50A {Oryza sativa} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >2p0o_A Hypothetical protein DUF871; structural genomics, TIM barrel, PF05 2, protein structure initiative, midwest center for structu genomics; 2.15A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} | Back alignment and structure |
|---|
| >2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... | Back alignment and structure |
|---|
| >2g3m_A Maltase, alpha-glucosidase; hydrolase, glycoside hydrolase family 31, multidomain protein, (beta/alpha)8 barrel, retaining mechanism; 2.55A {Sulfolobus solfataricus} PDB: 2g3n_A* | Back alignment and structure |
|---|
| >3rcn_A Beta-N-acetylhexosaminidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta half sandwich; HET: MSE; 2.51A {Arthrobacter aurescens} | Back alignment and structure |
|---|
| >1c7s_A Beta-N-acetylhexosaminidase; glycosyl hydrolase, chitinolysis, A/B(TIM)-barrel, site directed mutagenesis; HET: CBS; 1.80A {Serratia marcescens} SCOP: b.1.18.2 b.2.2.3 c.1.8.6 d.92.2.1 PDB: 1c7t_A* 1qba_A 1qbb_A* | Back alignment and structure |
|---|
| >3obe_A Sugar phosphate isomerase/epimerase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.70A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >1szn_A Alpha-galactosidase; (beta/alpha)8 barrel,TWO domains, glycoprotein, hydrolase; HET: NAG BMA MAN; 1.54A {Hypocrea jecorina} SCOP: b.71.1.1 c.1.8.1 PDB: 1t0o_A* | Back alignment and structure |
|---|
| >3p6l_A Sugar phosphate isomerase/epimerase; TIM barrel, structural genomics, joint center for structural genomics, JCSG; HET: CIT; 1.85A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >2ebf_X Dermonecrotic toxin; pasteurella multocida toxin, trojan horse-like fold; HET: TRE; 1.90A {Pasteurella multocida} SCOP: a.296.1.1 c.150.1.2 d.3.1.17 PDB: 2ec5_A 2ebh_X* | Back alignment and structure |
|---|
| >2cho_A Glucosaminidase, hexosaminiase; O-GLCNACASE, hydrolase, N-acetylglucosamine; 1.85A {Bacteroides thetaiotaomicron} SCOP: a.246.1.1 c.1.8.10 d.92.2.3 PDB: 2chn_A 2vvn_A* 2vvs_A* 2x0h_A* 2xm2_A* 2w4x_A* 2w66_A* 2w67_A* 2wca_A* 2xj7_A* 2xm1_A* 2j47_A* 2jiw_A* 2wzh_A* 2wzi_A* 2j4g_A* | Back alignment and structure |
|---|
| >3gh5_A HEX1, beta-hexosaminidase; beta-N-acetylhexosaminidase, glycosphingolipids, paenibacill GH20, hydrolase, structural genomics, NPPSFA; HET: NAG; 1.60A {Paenibacillus SP} PDB: 3gh4_A* 3gh7_A* 3sur_A* 3sus_A* 3sut_A* 3suu_A* 3suv_A* 3suw_A* | Back alignment and structure |
|---|
| >3gza_A Putative alpha-L-fucosidase; NP_812709.1, structural genomic center for structural genomics, JCSG; HET: MSE EPE; 1.60A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 | Back alignment and structure |
|---|
| >2epl_X N-acetyl-beta-D-glucosaminidase; glycoside hydrolase, family 20, GCNA, hydro; 1.40A {Streptococcus gordonii} PDB: 2epk_X 2epm_X 2epn_A* 2epo_A | Back alignment and structure |
|---|
| >1w91_A Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 2.2A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 2bs9_A 2bfg_A* | Back alignment and structure |
|---|
| >2bdq_A Copper homeostasis protein CUTC; alpha beta protein, structural genomics, PSI, protein structure initiative; 2.30A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 | Back alignment and structure |
|---|
| >3tva_A Xylose isomerase domain protein TIM barrel; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.15A {Planctomyces limnophilus} | Back alignment and structure |
|---|
| >4fnq_A Alpha-galactosidase AGAB; glycoside hydrolase, hydrolase; 1.80A {Geobacillus stearothermophilus} PDB: 4fnr_A 4fnu_A* 4fnt_A* 4fns_A* 4fnp_A* | Back alignment and structure |
|---|
| >2yl5_A Beta-N-acetylhexosaminidase; hydrolase; 2.15A {Streptococcus pneumoniae} PDB: 2yla_A* 2yl9_A* | Back alignment and structure |
|---|
| >3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* | Back alignment and structure |
|---|
| >2v5d_A O-GLCNACASE NAGJ; family 32 carbohydrate binding module, glycosidase, GH84, GH84C, CBM32, hydrolase, coiled coil; 3.30A {Clostridium perfringens} | Back alignment and structure |
|---|
| >2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* | Back alignment and structure |
|---|
| >1twd_A Copper homeostasis protein CUTC; TIM-like protein, structural genomics, PSI, protein structure initiative; 1.70A {Shigella flexneri} SCOP: c.1.30.1 PDB: 1x7i_A 1x8c_A | Back alignment and structure |
|---|
| >1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A | Back alignment and structure |
|---|
| >2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >4hz8_A Beta-glucosidase; BGLB,BGL, hydrolase, glycosid barrel, carbohydrate/sugar binding; HET: BGC; 1.14A {Uncultured bacterium} PDB: 4hz7_A* 4hz6_A* 3fj0_A* 3cmj_A 3fiz_A* 3fiy_A* | Back alignment and structure |
|---|
| >3aam_A Endonuclease IV, endoiv; DNA repair, base excision repair, BER, TIM barrel, endonucle hydrolase, structural genomics, NPPSFA; 1.58A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* | Back alignment and structure |
|---|
| >3vmn_A Dextranase; TIM barrel, immunoglobrin fold, greek-KEY-motif, glycoside H family 66, hydrolase; 1.60A {Streptococcus mutans} PDB: 3vmo_A* 3vmp_A* | Back alignment and structure |
|---|
| >3a21_A Putative secreted alpha-galactosidase; beta-alpha-barrel, greek KEY motif, beta-jellyroll, beta-TRE hydrolase; HET: GOL 1PG EPE; 1.51A {Streptomyces avermitilis} PDB: 3a22_A* 3a23_A* | Back alignment and structure |
|---|
| >3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3ngf_A AP endonuclease, family 2; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 1.80A {Brucella melitensis biovar abortus} SCOP: c.1.15.0 | Back alignment and structure |
|---|
| >4ba0_A Alpha-glucosidase, putative, ADG31B; hydrolase; HET: 5GF PGE ARG; 1.85A {Cellvibrio japonicus} PDB: 4b9z_A* 4b9y_A* | Back alignment and structure |
|---|
| >2yl6_A Beta-N-acetylhexosaminidase; peptidoglycan-anchor, hydrolase; HET: ETE; 1.60A {Streptococcus pneumoniae} PDB: 2yll_A* 2yl8_A* 3rpm_A* | Back alignment and structure |
|---|
| >2v5c_A O-GLCNACASE NAGJ; glycosidase, GH84, GH84C, hydrolase, coiled coil, family 84 glycoside hydrolase, carbohydrate binding module; 2.10A {Clostridium perfringens} PDB: 2cbj_A* 2cbi_A 2vur_A* 2x0y_A* 2j62_A* 2wb5_A* 2xpk_A* 2yds_A* 2ydr_A* 2ydq_A* | Back alignment and structure |
|---|
| >1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 136 | ||||
| d1uoka2 | 479 | c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus | 6e-36 | |
| d1m53a2 | 478 | c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Kle | 1e-35 | |
| d1lwha2 | 391 | c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Ther | 2e-29 | |
| d1wzaa2 | 409 | c.1.8.1 (A:28-436) Bacterial alpha-amylase {Haloth | 1e-27 | |
| d1gjwa2 | 572 | c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga | 6e-24 | |
| d1g5aa2 | 554 | c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysacc | 8e-23 | |
| d1eh9a3 | 400 | c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrol | 3e-22 | |
| d1iv8a2 | 653 | c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase | 3e-21 | |
| d1j0ha3 | 382 | c.1.8.1 (A:124-505) Neopullulanase, central domain | 3e-21 | |
| d1h3ga3 | 422 | c.1.8.1 (A:96-517) Cyclomaltodextrinase, central d | 5e-21 | |
| d1wzla3 | 382 | c.1.8.1 (A:121-502) Maltogenic amylase, central do | 5e-21 | |
| d1bf2a3 | 475 | c.1.8.1 (A:163-637) Isoamylase, central domain {Ps | 1e-19 | |
| d1ht6a2 | 347 | c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hor | 2e-19 | |
| d2bhua3 | 420 | c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydro | 2e-19 | |
| d1r7aa2 | 434 | c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobac | 3e-19 | |
| d1ea9c3 | 382 | c.1.8.1 (C:122-503) Maltogenic amylase, central do | 3e-18 | |
| d2aaaa2 | 381 | c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergill | 2e-17 | |
| d1m7xa3 | 396 | c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enz | 2e-17 | |
| d2guya2 | 381 | c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergill | 4e-17 | |
| d1ji1a3 | 432 | c.1.8.1 (A:123-554) Maltogenic amylase, central do | 4e-17 | |
| d1qhoa4 | 407 | c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase | 3e-16 | |
| d3bmva4 | 406 | c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase | 8e-16 | |
| d1e43a2 | 393 | c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera | 8e-15 | |
| d1ud2a2 | 390 | c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillu | 3e-14 | |
| d1hvxa2 | 393 | c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillu | 4e-14 | |
| d2d3na2 | 394 | c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillu | 2e-13 | |
| d1gcya2 | 357 | c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan m | 1e-12 | |
| d1mxga2 | 361 | c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeo | 2e-12 | |
| d2fhfa5 | 563 | c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella p | 4e-12 | |
| d1ua7a2 | 344 | c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillu | 2e-10 | |
| d1g94a2 | 354 | c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoa | 1e-07 | |
| d1hx0a2 | 403 | c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus s | 3e-07 | |
| d1jaea2 | 378 | c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mea | 9e-06 |
| >d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Length = 479 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: (Trans)glycosidases family: Amylase, catalytic domain domain: Oligo-1,6, glucosidase species: Bacillus cereus [TaxId: 1396]
Score = 126 bits (316), Expect = 6e-36
Identities = 44/91 (48%), Positives = 63/91 (69%)
Query: 24 QKEWWQTAIMYQIYPRSFRDVNGDGTGDMRGITEKLDHFVDLGIESLWIQPFYPAGGADL 83
+K+WW+ +++YQIYPRSF D NGDG GD+RGI KLD+ +LGI+ +W+ P Y + D
Sbjct: 2 EKQWWKESVVYQIYPRSFMDSNGDGIGDLRGIISKLDYLKELGIDVIWLSPVYESPNDDN 61
Query: 84 GYDVSNYVDVDPLFGDMHDFEILIEEAHSRG 114
GYD+S+Y + FG M D++ L+ E H R
Sbjct: 62 GYDISDYCKIMNEFGTMEDWDELLHEMHERN 92
|
| >d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Length = 478 | Back information, alignment and structure |
|---|
| >d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Length = 391 | Back information, alignment and structure |
|---|
| >d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Length = 409 | Back information, alignment and structure |
|---|
| >d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Length = 572 | Back information, alignment and structure |
|---|
| >d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Length = 554 | Back information, alignment and structure |
|---|
| >d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Length = 400 | Back information, alignment and structure |
|---|
| >d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 653 | Back information, alignment and structure |
|---|
| >d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 382 | Back information, alignment and structure |
|---|
| >d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} Length = 422 | Back information, alignment and structure |
|---|
| >d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Length = 382 | Back information, alignment and structure |
|---|
| >d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Length = 475 | Back information, alignment and structure |
|---|
| >d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Length = 347 | Back information, alignment and structure |
|---|
| >d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Length = 420 | Back information, alignment and structure |
|---|
| >d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} Length = 434 | Back information, alignment and structure |
|---|
| >d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Length = 382 | Back information, alignment and structure |
|---|
| >d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Length = 381 | Back information, alignment and structure |
|---|
| >d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Length = 396 | Back information, alignment and structure |
|---|
| >d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Length = 381 | Back information, alignment and structure |
|---|
| >d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} Length = 432 | Back information, alignment and structure |
|---|
| >d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Length = 407 | Back information, alignment and structure |
|---|
| >d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Length = 406 | Back information, alignment and structure |
|---|
| >d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Length = 393 | Back information, alignment and structure |
|---|
| >d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Length = 390 | Back information, alignment and structure |
|---|
| >d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Length = 393 | Back information, alignment and structure |
|---|
| >d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Length = 394 | Back information, alignment and structure |
|---|
| >d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Length = 357 | Back information, alignment and structure |
|---|
| >d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Length = 361 | Back information, alignment and structure |
|---|
| >d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Length = 563 | Back information, alignment and structure |
|---|
| >d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} Length = 344 | Back information, alignment and structure |
|---|
| >d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Length = 354 | Back information, alignment and structure |
|---|
| >d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Length = 403 | Back information, alignment and structure |
|---|
| >d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Length = 378 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 136 | |||
| d1m53a2 | 478 | Isomaltulose synthase PalI {Klebsiella sp., lx3 [T | 100.0 | |
| d1uoka2 | 479 | Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13 | 100.0 | |
| d1ea9c3 | 382 | Maltogenic amylase, central domain {Bacillus sp., | 100.0 | |
| d1j0ha3 | 382 | Neopullulanase, central domain {Bacillus stearothe | 99.98 | |
| d1ji1a3 | 432 | Maltogenic amylase, central domain {Thermoactinomy | 99.98 | |
| d1bf2a3 | 475 | Isoamylase, central domain {Pseudomonas amyloderam | 99.98 | |
| d1h3ga3 | 422 | Cyclomaltodextrinase, central domain {Flavobacteri | 99.97 | |
| d1wzla3 | 382 | Maltogenic amylase, central domain {Thermoactinomy | 99.97 | |
| d1qhoa4 | 407 | Cyclodextrin glycosyltransferase {Bacillus stearot | 99.97 | |
| d3bmva4 | 406 | Cyclodextrin glycosyltransferase {Thermoanaerobact | 99.97 | |
| d1m7xa3 | 396 | 1,4-alpha-glucan branching enzyme, central domain | 99.97 | |
| d2fhfa5 | 563 | Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 | 99.97 | |
| d1eh9a3 | 400 | Glycosyltrehalose trehalohydrolase, central domain | 99.97 | |
| d2guya2 | 381 | Fungal alpha-amylases {Aspergillus oryzae, Taka-am | 99.97 | |
| d1lwha2 | 391 | 4-alpha-glucanotransferase {Thermotoga maritima [T | 99.97 | |
| d1gjwa2 | 572 | Maltosyltransferase {Thermotoga maritima [TaxId: 2 | 99.97 | |
| d1wzaa2 | 409 | Bacterial alpha-amylase {Halothermothrix orenii [T | 99.97 | |
| d2aaaa2 | 381 | Fungal alpha-amylases {Aspergillus niger, acid amy | 99.97 | |
| d2bhua3 | 420 | Glycosyltrehalose trehalohydrolase, central domain | 99.97 | |
| d1ht6a2 | 347 | Plant alpha-amylase {Barley (Hordeum vulgare), AMY | 99.95 | |
| d1g5aa2 | 554 | Amylosucrase {Neisseria polysaccharea [TaxId: 489] | 99.95 | |
| d1r7aa2 | 434 | Sucrose phosphorylase {Bifidobacterium adolescenti | 99.93 | |
| d1mxga2 | 361 | Bacterial alpha-amylase {Archaeon Pyrococcus woese | 99.92 | |
| d1gcya2 | 357 | G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase | 99.92 | |
| d1ud2a2 | 390 | Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta | 99.92 | |
| d1ua7a2 | 344 | Bacterial alpha-amylase {Bacillus subtilis [TaxId: | 99.92 | |
| d1e43a2 | 393 | Bacterial alpha-amylase {Chimera (Bacillus amyloli | 99.91 | |
| d2d3na2 | 394 | Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: | 99.9 | |
| d1hvxa2 | 393 | Bacterial alpha-amylase {Bacillus stearothermophil | 99.9 | |
| d1iv8a2 | 653 | Maltooligosyl trehalose synthase {Archaeon Sulfolo | 99.88 | |
| d1g94a2 | 354 | Bacterial alpha-amylase {Pseudoalteromonas halopla | 99.87 | |
| d1jaea2 | 378 | Animal alpha-amylase {Yellow mealworm (Tenebrio mo | 99.86 | |
| d1hx0a2 | 403 | Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 | 99.84 | |
| d1ecea_ | 358 | Endocellulase E1 {Acidothermus cellulolyticus [Tax | 97.17 | |
| d1uuqa_ | 410 | Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} | 97.03 | |
| d2c0ha1 | 350 | endo-1,4-beta-mannosidase {Blue mussel (Mytilus ed | 96.94 | |
| d2pb1a1 | 394 | Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) | 96.86 | |
| d1hjsa_ | 332 | Beta-1,4-galactanase {Thielavia heterothallica, ak | 96.77 | |
| d1qnra_ | 344 | Beta-mannanase {Trichoderma reesei [TaxId: 51453]} | 96.73 | |
| d1wkya2 | 297 | Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 2449 | 96.71 | |
| d1edga_ | 380 | Endoglucanase CelA {Clostridium cellulolyticum [Ta | 96.7 | |
| d1h4pa_ | 408 | Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom | 96.64 | |
| d1rh9a1 | 370 | Beta-mannanase {Tomato (Lycopersicon esculentum) [ | 96.51 | |
| d1vjza_ | 325 | Endoglucanase homologue TM1752 {Thermotoga maritim | 96.44 | |
| d1ceoa_ | 340 | Endoglucanase CelC {Clostridium thermocellum [TaxI | 96.35 | |
| d1eswa_ | 500 | Amylomaltase MalQ {Thermus aquaticus [TaxId: 271]} | 96.34 | |
| d1ur4a_ | 387 | Beta-1,4-galactanase {Bacillus licheniformis [TaxI | 96.29 | |
| d1foba_ | 334 | Beta-1,4-galactanase {Fungus (Aspergillus aculeatu | 96.18 | |
| d1kwga2 | 393 | A4 beta-galactosidase {Thermus thermophilus [TaxId | 95.92 | |
| d1bqca_ | 302 | Beta-mannanase {Thermomonospora fusca [TaxId: 2021 | 95.9 | |
| d1g01a_ | 357 | Alkaline cellulase K catalytic domain {Bacillus sp | 95.81 | |
| d1x1na1 | 523 | Amylomaltase MalQ {Potato (Solanum tuberosum) [Tax | 95.78 | |
| d1tz7a1 | 485 | Amylomaltase MalQ {Aquifex aeolicus [TaxId: 63363] | 95.71 | |
| d1nowa1 | 353 | beta-hexosaminidase B {Human (Homo sapiens) [TaxId | 95.54 | |
| d7a3ha_ | 300 | Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId | 95.51 | |
| d1h1na_ | 305 | Endocellulase EngI {Thermoascus aurantiacus [TaxId | 95.3 | |
| d1tg7a5 | 354 | Beta-galactosidase LacA, N-terminal domain {Penici | 95.26 | |
| d2ebfx2 | 219 | Dermonecrotic toxin, ToxA {Pasteurella multocida [ | 95.14 | |
| d1tvna1 | 293 | Endoglucanase Cel5a {Pseudoalteromonas haloplankti | 94.67 | |
| d2gjxa1 | 362 | beta-hexosaminidase A {Human (Homo sapiens) [TaxId | 94.5 | |
| d1egza_ | 291 | Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: | 94.23 | |
| d1qbaa3 | 443 | Bacterial chitobiase (beta-N-acetylhexosaminidase) | 94.2 | |
| d1hl9a2 | 350 | Putative alpha-L-fucosidase, catalytic domain {The | 94.0 | |
| d1yhta1 | 344 | Dispersin B, DspB {Actinobacillus actinomycetemcom | 93.18 | |
| d1x7fa2 | 244 | Outer surface protein, N-terminal domain {Bacillus | 93.06 | |
| d1jaka1 | 356 | beta-N-acetylhexosaminidase {Streptomyces plicatus | 92.23 | |
| d1vema2 | 417 | Bacterial beta-amylase {Bacillus cereus [TaxId: 13 | 91.83 | |
| d1zy9a2 | 348 | Alpha-galactosidase GalA catalytic domain {Thermot | 91.6 | |
| d1qwga_ | 251 | (2r)-phospho-3-sulfolactate synthase ComA {Archaeo | 90.84 | |
| d2f2ha4 | 338 | Putative glucosidase YicI, domain 2 {Escherichia c | 88.72 | |
| d2hvma_ | 273 | Hevamine A (chitinase/lysozyme) {Para rubber tree | 87.11 | |
| d1twda_ | 247 | Copper homeostasis protein CutC {Shigella flexneri | 85.27 | |
| d8abpa_ | 305 | L-arabinose-binding protein {Escherichia coli [Tax | 84.14 | |
| d2j78a1 | 443 | Beta-glucosidase A {Thermotoga maritima [TaxId: 23 | 83.88 | |
| d1e4ia_ | 447 | Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406 | 83.62 | |
| d1iuka_ | 136 | Hypothetical protein TT1466 {Thermus thermophilus | 82.71 | |
| d1ohea2 | 182 | Proline directed phosphatase CDC14b2 {Human (Homo | 82.15 | |
| d1m3ga_ | 145 | Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax | 81.95 | |
| d1gnxa_ | 464 | Beta-glucosidase A {Streptomyces sp. [TaxId: 1931] | 81.85 | |
| d1vffa1 | 423 | Beta-glucosidase A {Archaeon Pyrococcus horikoshii | 81.82 | |
| d2fhfa5 | 563 | Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 | 81.62 | |
| d1wcga1 | 462 | Thioglucosidase {Cabbage aphid (Brevicoryne brassi | 80.97 | |
| d1ug6a_ | 426 | Beta-glucosidase A {Thermus thermophilus [TaxId: 2 | 80.9 | |
| d1cbga_ | 490 | Plant beta-glucosidase (myrosinase) {Creeping whit | 80.71 | |
| d1i60a_ | 278 | Hypothetical protein IolI {Bacillus subtilis [TaxI | 80.52 | |
| d2vzsa5 | 339 | Exochitosanase CsxA {Amycolatopsis orientalis [Tax | 80.29 |
| >d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: (Trans)glycosidases family: Amylase, catalytic domain domain: Isomaltulose synthase PalI species: Klebsiella sp., lx3 [TaxId: 576]
Probab=100.00 E-value=3.6e-36 Score=241.71 Aligned_cols=106 Identities=42% Similarity=0.849 Sum_probs=102.2
Q ss_pred CccccCCceEEEEecccccCcCCCCCCCHHHHHHhHHHHHHcCCcEEEEcCCccCCCCCCCCCccCCCCCCCCCCCHHHH
Q psy12953 24 QKEWWQTAIMYQIYPRSFRDVNGDGTGDMRGITEKLDHFVDLGIESLWIQPFYPAGGADLGYDVSNYVDVDPLFGDMHDF 103 (136)
Q Consensus 24 ~~~w~~~~~iY~v~~~~f~~~~~~~~g~~~~l~~~l~~l~~lG~~~I~l~Pi~~~~~~~~gY~~~d~~~vd~~~Gt~~~~ 103 (136)
.|+||++.|||||++++|.++++++.|||+|++++|+||++||||+|||+||++++..+|||++.||++|||+|||+++|
T Consensus 2 ~P~W~~~~viYei~~~~F~d~~~~~~Gd~~Gi~~kLdyLk~LGv~~I~L~Pi~~~~~~~~GY~~~d~~~vd~~~Gt~~df 81 (478)
T d1m53a2 2 YPAWWKEAVFYQIYPRSFKDTNDDGIGDIRGIIEKLDYLKSLGIDAIWINPHYDSPNTDNGYDISNYRQIMKEYGTMEDF 81 (478)
T ss_dssp CCCHHHHCCEEEECGGGTCCSSSSSSCCHHHHHHTHHHHHHHTCCEEEECCCEECCCTTTTSSCSEEEEECGGGCCHHHH
T ss_pred CCcccccCeEEEEecchhcCCCCCCccCHHHHHHhhHHHHHcCCCEEEECCCCCCCCCCCCcCccCCCCcCcccCCHHHH
Confidence 48999999999999999999999999999999999999999999999999999998888999999999999999999999
Q ss_pred HHHHHHHHHCCCcEEE---eccCCCccCC
Q psy12953 104 EILIEEAHSRGKPKRT---FREVTKSFAN 129 (136)
Q Consensus 104 ~~lv~~ah~~Gi~vil---~nh~~~~~~~ 129 (136)
++||++||++||+||+ +||++.+|+.
T Consensus 82 ~~Lv~~aH~~Gi~VilD~V~NH~~~~~~~ 110 (478)
T d1m53a2 82 DSLVAEMKKRNMRLMIDVVINHTSDQHPW 110 (478)
T ss_dssp HHHHHHHHHTTCEEEEEECCSBCCTTSHH
T ss_pred HHHHHHHHHCCCEEEeccccccccccCch
Confidence 9999999999999999 9999987654
|
| >d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} | Back information, alignment and structure |
|---|
| >d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} | Back information, alignment and structure |
|---|
| >d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} | Back information, alignment and structure |
|---|
| >d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} | Back information, alignment and structure |
|---|
| >d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} | Back information, alignment and structure |
|---|
| >d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} | Back information, alignment and structure |
|---|
| >d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} | Back information, alignment and structure |
|---|
| >d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} | Back information, alignment and structure |
|---|
| >d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} | Back information, alignment and structure |
|---|
| >d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} | Back information, alignment and structure |
|---|
| >d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} | Back information, alignment and structure |
|---|
| >d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} | Back information, alignment and structure |
|---|
| >d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} | Back information, alignment and structure |
|---|
| >d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} | Back information, alignment and structure |
|---|
| >d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} | Back information, alignment and structure |
|---|
| >d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} | Back information, alignment and structure |
|---|
| >d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} | Back information, alignment and structure |
|---|
| >d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} | Back information, alignment and structure |
|---|
| >d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} | Back information, alignment and structure |
|---|
| >d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} | Back information, alignment and structure |
|---|
| >d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} | Back information, alignment and structure |
|---|
| >d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} | Back information, alignment and structure |
|---|
| >d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} | Back information, alignment and structure |
|---|
| >d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1eswa_ c.1.8.1 (A:) Amylomaltase MalQ {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} | Back information, alignment and structure |
|---|
| >d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} | Back information, alignment and structure |
|---|
| >d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1x1na1 c.1.8.1 (A:2-524) Amylomaltase MalQ {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d1tz7a1 c.1.8.1 (A:1-485) Amylomaltase MalQ {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1nowa1 c.1.8.6 (A:200-552) beta-hexosaminidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} | Back information, alignment and structure |
|---|
| >d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} | Back information, alignment and structure |
|---|
| >d1tg7a5 c.1.8.14 (A:41-394) Beta-galactosidase LacA, N-terminal domain {Penicillium sp. [TaxId: 5081]} | Back information, alignment and structure |
|---|
| >d2ebfx2 c.150.1.2 (X:875-1093) Dermonecrotic toxin, ToxA {Pasteurella multocida [TaxId: 747]} | Back information, alignment and structure |
|---|
| >d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} | Back information, alignment and structure |
|---|
| >d2gjxa1 c.1.8.6 (A:167-528) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1qbaa3 c.1.8.6 (A:338-780) Bacterial chitobiase (beta-N-acetylhexosaminidase) {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1hl9a2 c.1.8.11 (A:7-356) Putative alpha-L-fucosidase, catalytic domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1yhta1 c.1.8.6 (A:16-359) Dispersin B, DspB {Actinobacillus actinomycetemcomitans [TaxId: 714]} | Back information, alignment and structure |
|---|
| >d1x7fa2 c.1.8.12 (A:1-244) Outer surface protein, N-terminal domain {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1jaka1 c.1.8.6 (A:151-506) beta-N-acetylhexosaminidase {Streptomyces plicatus [TaxId: 1922]} | Back information, alignment and structure |
|---|
| >d1vema2 c.1.8.1 (A:1-417) Bacterial beta-amylase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1zy9a2 c.1.8.13 (A:178-525) Alpha-galactosidase GalA catalytic domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qwga_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2f2ha4 c.1.8.13 (A:248-585) Putative glucosidase YicI, domain 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} | Back information, alignment and structure |
|---|
| >d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]} | Back information, alignment and structure |
|---|
| >d8abpa_ c.93.1.1 (A:) L-arabinose-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} | Back information, alignment and structure |
|---|
| >d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} | Back information, alignment and structure |
|---|
| >d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} | Back information, alignment and structure |
|---|
| >d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} | Back information, alignment and structure |
|---|
| >d1i60a_ c.1.15.4 (A:) Hypothetical protein IolI {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2vzsa5 c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|